F406914

General Info

Members Datasets Scaffolds Average Seq Length
323 249 646 137

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10960052|Ga0105249_109600522
Length 160
Sequence MRVYPVLSGNHEEASPAMKKSNPKEEKSAATPSRLIDARVRELGDWRGETLARIRKIIKEADPEVVEEWKWRGVPVWSHGGIICTGETYKSVVKLTFARGAALKDPARLFNSSLEGNVRRAIDIHEGEKINATALKTLFRAAIELNLSKTAAPPRKKVGR

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
90 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
136 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
137 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
138 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
165 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
166 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
167 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
168 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
169 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
170 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
171 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
172 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
173 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
176 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
184 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
185 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
213 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
214 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
215 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
216 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
217 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
218 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
219 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
220 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
230 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
231 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
232 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
233 2511231006 Pseudomonas sp. GM17 Isolate Nodule
234 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
235 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
236 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
237 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
238 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
239 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
240 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
241 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
242 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
243 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
244 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
245 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
246 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
247 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
248 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
249 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.43
Metatranscriptomes 0
Isolates 5.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.62
Nodule 1.24
Rhizoplane 3.72
Rhizosphere 74.92
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10960052 3300009553 Bacteria 923
2 JGI24738J21930_10081331 3300002075 Bacteria 678
3 JGI25159J45721_1000180 3300002987 Bacteria 29383
4 JGI25151J46595_10000191 3300003187 Bacteria 75432
5 JGI25406J46586_10026018 3300003203 Bacteria 2263
6 rootH2_10059834 3300003320 Bacteria 3204
7 rootH1_10182940 3300003323 Bacteria 2098
8 JGI25160J50197_1000145 3300003354 Bacteria 63479
9 JGI25161J50226_1000064 3300003374 Bacteria 99448
10 Ga0055526_1000957 3300003771 Bacteria 21294
11 Ga0055524_1000068 3300003775 Bacteria 130413
12 Ga0055536_1000028 3300003781 Bacteria 162550
13 Ga0055534_1035443 3300003784 Bacteria 753
14 Ga0055530_10000443 3300003791 Bacteria 36792
15 Ga0055530_10025979 3300003791 Bacteria 1626
16 Ga0055540_1000496 3300003792 Bacteria 30037
17 Ga0055543_1004455 3300004625 Bacteria 3821
18 Ga0065165_1016640 3300005262 Bacteria 2744
19 Ga0065704_10217709 3300005289 Bacteria 1085
20 Ga0065715_10161232 3300005293 Bacteria 1619
21 Ga0070676_11458433 3300005328 Bacteria 526
22 Ga0070690_100011203 3300005330 Bacteria 5240
23 Ga0068869_100000262 3300005334 Bacteria 27673
24 Ga0070666_10152607 3300005335 Bacteria 1612
25 Ga0070680_100204025 3300005336 Bacteria 1667
26 Ga0070680_100386217 3300005336 Bacteria 1192
27 Ga0068868_100000778 3300005338 Bacteria 21576
28 Ga0068868_100003406 3300005338 Bacteria 11062
29 Ga0070660_100038377 3300005339 Bacteria 3636
30 Ga0070660_100190605 3300005339 Bacteria 1661
31 Ga0070689_100041734 3300005340 Bacteria 3521
32 Ga0070691_10019533 3300005341 Bacteria 3128
33 Ga0070687_100005885 3300005343 Bacteria 4987
34 Ga0070692_10172229 3300005345 Bacteria 1249
35 Ga0070671_100050731 3300005355 Bacteria 3451
36 Ga0070674_100322422 3300005356 Bacteria 1239
37 Ga0070673_100014563 3300005364 Bacteria 5483
38 Ga0070673_100029668 3300005364 Bacteria 4081
39 Ga0070659_100001158 3300005366 Bacteria 19261
40 Ga0070703_10105324 3300005406 Bacteria 1001
41 Ga0070701_10004284 3300005438 Bacteria 5756
42 Ga0070705_100000307 3300005440 Bacteria 28982
43 Ga0070700_100000145 3300005441 Bacteria 42177
44 Ga0070694_100014092 3300005444 Bacteria 5003
45 Ga0070678_101588299 3300005456 Bacteria 614
46 Ga0070681_10031969 3300005458 Bacteria 5283
47 Ga0070681_10105587 3300005458 Bacteria 2759
48 Ga0070681_10969116 3300005458 Bacteria 770
49 Ga0068867_100082781 3300005459 Bacteria 2422
50 Ga0068867_100116203 3300005459 Bacteria 2061
51 Ga0070706_101249322 3300005467 Bacteria 682
52 Ga0070699_100328087 3300005518 Bacteria 1376
53 Ga0070679_100028908 3300005530 Bacteria 5467
54 Ga0070679_100084423 3300005530 Bacteria 3164
55 Ga0070679_100335196 3300005530 Bacteria 1461
56 Ga0070672_101410849 3300005543 Bacteria 623
57 Ga0070695_100000365 3300005545 Bacteria 23251
58 Ga0070696_100000248 3300005546 Bacteria 32432
59 Ga0070696_100096013 3300005546 Bacteria 2118
60 Ga0070693_100000311 3300005547 Bacteria 22539
61 Ga0070693_100665330 3300005547 Bacteria 759
62 Ga0070704_100009465 3300005549 Bacteria 5887
63 Ga0070704_100063892 3300005549 Bacteria 2643
64 Ga0068855_101272255 3300005563 Bacteria 762
65 Ga0068855_101752457 3300005563 Bacteria 632
66 Ga0068854_100005409 3300005578 Bacteria 8063
67 Ga0070702_100000014 3300005615 Bacteria 51486
68 Ga0068852_100124932 3300005616 Bacteria 2361
69 Ga0068859_100147748 3300005617 Bacteria 2426
70 Ga0068858_100206640 3300005842 Bacteria 1858
71 Ga0068858_100215939 3300005842 Bacteria 1816
72 Ga0068862_100002480 3300005844 Bacteria 16334
73 Ga0081455_10515561 3300005937 Bacteria 799
74 Ga0081539_10001847 3300005985 Bacteria 33403
75 Ga0075367_10258917 3300006178 Bacteria 1092
76 Ga0097621_100002188 3300006237 Bacteria 13375
77 Ga0075370_10383583 3300006353 Bacteria 842
78 Ga0068871_100015650 3300006358 Bacteria 5685
79 Ga0068871_100724472 3300006358 Bacteria 913
80 Ga0068871_101198224 3300006358 Bacteria 712
81 Ga0075433_10323921 3300006852 Bacteria 1363
82 Ga0075433_10965010 3300006852 Bacteria 743
83 Ga0068865_100010886 3300006881 Bacteria 5675
84 Ga0097620_100147752 3300006931 Bacteria 2426
85 Ga0075435_100061559 3300007076 Bacteria 3045
86 Ga0105251_10015904 3300009011 Bacteria 4091
87 Ga0105240_10093354 3300009093 Bacteria 3673
88 Ga0105245_10004168 3300009098 Bacteria 12841
89 Ga0105245_10015409 3300009098 Bacteria 6664
90 Ga0114129_10105484 3300009147 Bacteria 3894
91 Ga0105243_10001207 3300009148 Bacteria 23267
92 Ga0105243_10063942 3300009148 Bacteria 2950
93 Ga0105241_10073428 3300009174 Bacteria 2661
94 Ga0105241_11033743 3300009174 Bacteria 770
95 Ga0105242_10018837 3300009176 Bacteria 5404
96 Ga0105242_10052058 3300009176 Bacteria 3339
97 Ga0105248_10115534 3300009177 Bacteria 3027
98 Ga0105248_10846346 3300009177 Bacteria 1032
99 Ga0105237_11076206 3300009545 Bacteria 811
100 Ga0105238_10221420 3300009551 Bacteria 1869
101 Ga0105249_10102782 3300009553 Bacteria 2690
102 Ga0105239_10013196 3300010375 Bacteria 9181
103 Ga0105239_10021973 3300010375 Bacteria 7033
104 Ga0105239_10123585 3300010375 Bacteria 2875
105 Ga0105239_11419352 3300010375 Bacteria 802
106 Ga0105239_12082091 3300010375 Bacteria 659
107 Ga0157371_10165646 3300013102 Bacteria 1578
108 Ga0157378_10158405 3300013297 Bacteria 2115
109 Ga0163162_10011756 3300013306 Bacteria 8538
110 Ga0163162_10853451 3300013306 Bacteria 1026
111 Ga0163162_10876947 3300013306 Bacteria 1011
112 Ga0157375_11223993 3300013308 Bacteria 881
113 Ga0157380_10045025 3300014326 Bacteria 3461
114 Ga0157380_12933650 3300014326 Bacteria 543
115 Ga0182008_10024204 3300014497 Bacteria 3093
116 Ga0157379_10257343 3300014968 Bacteria 1586
117 Ga0157379_10614927 3300014968 Bacteria 1015
118 Ga0157376_10003855 3300014969 Bacteria 10366
119 Ga0157376_10018773 3300014969 Bacteria 5312
120 Ga0157376_10298492 3300014969 Bacteria 1524
121 Ga0163161_10101420 3300017792 Bacteria 2143
122 Ga0209436_104892 3300025208 Bacteria 3209
123 Ga0207425_1000827 3300025245 Bacteria 15430
124 Ga0209129_1011420 3300025258 Bacteria 2122
125 Ga0209129_1020355 3300025258 Bacteria 1236
126 Ga0209565_1001101 3300025263 Bacteria 13306
127 Ga0209130_1000094 3300025284 Bacteria 145569
128 Ga0209675_1000988 3300025291 Bacteria 17980
129 Ga0209675_1002022 3300025291 Bacteria 10848
130 Ga0209676_1000062 3300025292 Bacteria 332319
131 Ga0209676_1003643 3300025292 Bacteria 9253
132 Ga0209025_1000008 3300025294 Bacteria 1130876
133 Ga0209025_1028611 3300025294 Bacteria 2723
134 Ga0209025_1030562 3300025294 Bacteria 2575
135 Ga0209564_1000041 3300025295 Bacteria 405199
136 Ga0209758_1024813 3300025297 Bacteria 2657
137 Ga0209758_1030322 3300025297 Bacteria 2242
138 Ga0209050_1000150 3300025298 Bacteria 162946
139 Ga0209050_1009876 3300025298 Bacteria 4798
140 Ga0209256_1000014 3300025299 Bacteria 687409
141 Ga0209256_1023330 3300025299 Bacteria 1847
142 Ga0207426_1000025 3300025302 Bacteria 532921
143 Ga0209051_1000695 3300025303 Bacteria 37054
144 Ga0207713_1009868 3300025735 Bacteria 5340
145 Ga0207653_10054468 3300025885 Bacteria 1338
146 Ga0207642_10030168 3300025899 Bacteria 2255
147 Ga0207642_10237723 3300025899 Bacteria 1027
148 Ga0207684_10886270 3300025910 Bacteria 751
149 Ga0207654_10093939 3300025911 Bacteria 1834
150 Ga0207707_10107527 3300025912 Bacteria 2438
151 Ga0207695_10102530 3300025913 Bacteria 2854
152 Ga0207695_10151897 3300025913 Bacteria 2254
153 Ga0207695_10961242 3300025913 Bacteria 734
154 Ga0207663_11022972 3300025916 Bacteria 663
155 Ga0207660_10005717 3300025917 Bacteria 8070
156 Ga0207660_10298176 3300025917 Bacteria 1283
157 Ga0207657_10041992 3300025919 Bacteria 4039
158 Ga0207652_10100501 3300025921 Bacteria 2553
159 Ga0207652_10507791 3300025921 Bacteria 1085
160 Ga0207694_10111531 3300025924 Bacteria 2176
161 Ga0207694_10254175 3300025924 Bacteria 1438
162 Ga0207687_10002337 3300025927 Bacteria 12915
163 Ga0207687_10004407 3300025927 Bacteria 9395
164 Ga0207687_10056833 3300025927 Bacteria 2746
165 Ga0207700_10854196 3300025928 Bacteria 814
166 Ga0207644_10122505 3300025931 Bacteria 1981
167 Ga0207690_10000170 3300025932 Bacteria 50577
168 Ga0207686_10001499 3300025934 Bacteria 13161
169 Ga0207709_10002960 3300025935 Bacteria 10354
170 Ga0207709_11116090 3300025935 Bacteria 648
171 Ga0207670_10049076 3300025936 Bacteria 2821
172 Ga0207669_10140828 3300025937 Bacteria 1674
173 Ga0207704_10000327 3300025938 Bacteria 22154
174 Ga0207711_11300478 3300025941 Bacteria 669
175 Ga0207689_10000426 3300025942 Bacteria 39509
176 Ga0207679_12045983 3300025945 Bacteria 521
177 Ga0207651_10030247 3300025960 Bacteria 3445
178 Ga0207651_10036321 3300025960 Bacteria 3215
179 Ga0207712_10004361 3300025961 Bacteria 8937
180 Ga0207712_10031874 3300025961 Bacteria 3553
181 Ga0207677_10000264 3300026023 Bacteria 39747
182 Ga0207708_10000231 3300026075 Bacteria 44046
183 Ga0207641_10407969 3300026088 Bacteria 1306
184 Ga0207675_100001410 3300026118 Bacteria 24039
185 Ga0207683_11407698 3300026121 Bacteria 645
186 Ga0207698_10104063 3300026142 Bacteria 2361
187 Ga0268264_10013432 3300028381 Bacteria 6743
188 Ga0265326_10000049 3300028558 Archaea 68293
189 Ga0265334_10002115 3300028573 Archaea 9387
190 Ga0265322_10000178 3300028654 Archaea 29214
191 Ga0265336_10000009 3300028666 Archaea 307432
192 Ga0307515_10519055 3300028794 Bacteria 801
193 Ga0265338_10000020 3300028800 Archaea 329350
194 Ga0265338_10006742 3300028800 Bacteria 14503
195 Ga0265338_10316381 3300028800 Bacteria 1131
196 Ga0265324_10000105 3300029957 Archaea 66830
197 Ga0265332_10003283 3300031238 Archaea 7853
198 Ga0265328_10003035 3300031239 Bacteria 7494
199 Ga0265328_10019528 3300031239 Archaea 2601
200 Ga0265320_10014298 3300031240 Bacteria 4523
201 Ga0265325_10000040 3300031241 Archaea 92655
202 Ga0265325_10396437 3300031241 Bacteria 605
203 Ga0265340_10000050 3300031247 Archaea 54683
204 Ga0265339_10000072 3300031249 Archaea 88405
205 Ga0265339_10001745 3300031249 Bacteria 16003
206 Ga0265339_10459976 3300031249 Bacteria 590
207 Ga0265331_10000226 3300031250 Archaea 67836
208 Ga0265331_10001734 3300031250 Bacteria 15694
209 Ga0265331_10275352 3300031250 Bacteria 754
210 Ga0265316_10002693 3300031344 Archaea 18293
211 Ga0265316_10039444 3300031344 Bacteria 3793
212 Ga0265313_10002250 3300031595 Bacteria 16969
213 Ga0265314_10025148 3300031711 Bacteria 4498
214 Ga0265342_10003509 3300031712 Bacteria 12829
215 Ga0265342_10011625 3300031712 Archaea 6009
216 Ga0265342_10101606 3300031712 Bacteria 1637
217 Ga0307405_10037064 3300031731 Bacteria 2928
218 Ga0307410_10901820 3300031852 Bacteria 757
219 Ga0307412_10238045 3300031911 Bacteria 1406
220 Ga0307416_100146926 3300032002 Bacteria 2154
221 Ga0307416_101788046 3300032002 Bacteria 719
222 Ga0307415_101075336 3300032126 Bacteria 752
223 Ga0373932_0270238 3300035112 Bacteria 626
224 Ga0373936_0096858 3300035113 Bacteria 1242
225 Ga0373931_0065293 3300035691 Bacteria 1972
226 Ga0395905_0560599 3300037471 Bacteria 1044
227 Ga0436365_0258210 3300039437 Bacteria 648
228 Ga0436365_0750887 3300039437 Bacteria 5964
229 Ga0436363_1567009 3300039450 Bacteria 755
230 Ga0439438_008500 3300041405 Bacteria 3395
231 Ga0439447_005383 3300041407 Bacteria 4265
232 Ga0439466_0012460 3300041411 Bacteria 3131
233 Ga0439432_004548 3300042006 Bacteria 5059
234 Ga0439451_014103 3300042009 Bacteria 1612
235 Ga0439452_007931 3300042010 Bacteria 3217
236 Ga0439456_079388 3300042013 Bacteria 731
237 Ga0450907_000146 3300042146 Bacteria 26937
238 Ga0439446_0014497 3300042156 Bacteria 2176
239 Ga0450909_000154 3300042185 Bacteria 7356
240 Ga0439434_0000153 3300042435 Bacteria 18390
241 Ga0439440_0002964 3300042993 Bacteria 3234
242 Ga0453683_0002353 3300044673 Bacteria 14796
243 Ga0451576_0025180 3300045051 Bacteria 6414
244 Ga0451576_0406813 3300045051 Bacteria 1427
245 Ga0495638_0013926 3300046460 Bacteria 5454
246 Ga0495580_0152679 3300046472 Bacteria 1600
247 Ga0495639_0033090 3300046475 Unclassified 2308
248 Ga0495584_0000038 3300046491 Bacteria 93590
249 Ga0495585_0224017 3300046492 Bacteria 948
250 Ga0495583_0007952 3300046506 Bacteria 6565
251 Ga0495644_0070212 3300046523 Bacteria 1316
252 Ga0495586_0030203 3300046535 Unclassified 2900
253 Ga0495621_0014688 3300046539 Bacteria 2483
254 Ga0495633_0233796 3300046558 Bacteria 840
255 Ga0495611_0267870 3300046648 Bacteria 790
256 Ga0495625_0110620 3300046660 Bacteria 1878
257 Ga0495635_0289351 3300046663 Bacteria 1100
258 Ga0495635_0294270 3300046663 Bacteria 1089
259 Ga0495599_0176331 3300046678 Bacteria 1318
260 Ga0495613_1123734 3300046689 Bacteria 501
261 Ga0495670_0329683 3300046691 Bacteria 820
262 Ga0495600_0420223 3300046809 Bacteria 830
263 Ga0495581_0760866 3300047315 Bacteria 557
264 Ga0495672_0114545 3300047320 Bacteria 1442
265 Ga0495673_0000407 3300047469 Bacteria 50254
266 Ga0496102_0848278 3300048905 Bacteria 836
267 Ga0496102_0934102 3300048905 Bacteria 789
268 Ga0496105_0115131 3300048908 Bacteria 2218
269 Ga0496105_0375091 3300048908 Bacteria 1133
270 Ga0496108_0329272 3300048911 Bacteria 1332
271 Ga0496109_0227595 3300048912 Bacteria 1754
272 Ga0496110_0180590 3300048913 Bacteria 1916
273 Ga0496110_0228662 3300048913 Bacteria 1691
274 Ga0496114_0216474 3300048917 Bacteria 1681
275 Ga0496115_0321235 3300048918 Bacteria 1266
276 Ga0496119_0597686 3300048922 Bacteria 502
277 Ga0496121_0023373 3300048924 Bacteria 5956
278 Ga0496122_0003518 3300048925 Bacteria 20558
279 Ga0496123_0017999 3300048926 Bacteria 5652
280 Ga0496124_0020056 3300048927 Bacteria 6192
281 Ga0496124_0034307 3300048927 Bacteria 4455
282 Ga0496124_0753231 3300048927 Bacteria 610
283 Ga0496125_0000425 3300048928 Bacteria 78294
284 Ga0496126_0035909 3300048929 Bacteria 4640
285 Ga0501298_027616 3300049521 Bacteria 1098
286 Ga0501207_136571 3300049654 Bacteria 519
287 Ga0501235_070298 3300049669 Bacteria 828
288 Ga0501251_037619 3300049681 Bacteria 719
289 Ga0501253_049969 3300049683 Bacteria 872
290 Ga0501225_0172003 3300049705 Bacteria 672
291 Ga0501264_014283 3300049761 Bacteria 793
292 Ga0501283_081825 3300049779 Bacteria 608
293 nmdc:mga03683_389485_c1 3300050489 Bacteria 664
294 nmdc:mga00v17_31739_c1 3300050491 Bacteria 3117
295 nmdc:mga06z11_211107_c1 3300050494 Bacteria 1131
296 nmdc:mga07m45_203287_c1 3300050496 Bacteria 1152
297 nmdc:mga05p37_40599_c1 3300050507 Bacteria 5714
298 nmdc:mga06r32_1167015_c1 3300050510 Bacteria 717
299 nmdc:mga0n895_135161_c1 3300050512 Bacteria 2492
300 nmdc:mga0rr50_192720_c1 3300050513 Bacteria 1671
301 nmdc:mga0a205_534447_c1 3300050515 Bacteria 1028
302 nmdc:mga0a205_81141_c1 3300050515 Bacteria 3133
303 Ga0500650_0023768 3300053098 Bacteria 2726
304 Ga0500611_000532 3300053727 Bacteria 3864
305 Ga0500661_009590 3300055283 Bacteria 1770
306 2511246985 2511231002 Bacteria 5042903
307 2511268980 2511231006 Bacteria 6794709
308 2512328670 2512047018 Bacteria 6663241
309 2583793387 2582580891 Bacteria 6800976
310 2597857359 2597489887 Bacteria 6666321
311 2599802029 2599185257 Bacteria 6492581
312 2600813326 2600255067 Bacteria 6795583
313 2671768977 2671180172 Bacteria 6495783
314 2743736784 2740892503 Bacteria 6855563
315 2835314450 2835312727 Bacteria 7413381
316 2847420660 2847417321 Bacteria 6913799
317 2848995491 2848992105 Bacteria 6810864
318 2855878019 2855872281 Bacteria 6964271
319 2923155802 2923153595 Bacteria 6870622
320 2984290231 2984286254 Bacteria 6702062
321 8015690049 8015687852 Bacteria 6613826
322 8054560721 8054558443 Bacteria 5204801
323 8055773157 8055770955 Bacteria 6827675
324 Ga0105249_10960052
325 JGI24738J21930_10081331
326 JGI25159J45721_1000180
327 JGI25151J46595_10000191
328 JGI25406J46586_10026018
329 rootH2_10059834
330 rootH1_10182940
331 JGI25160J50197_1000145
332 JGI25161J50226_1000064
333 Ga0055526_1000957
334 Ga0055524_1000068
335 Ga0055536_1000028
336 Ga0055534_1035443
337 Ga0055530_10000443
338 Ga0055530_10025979
339 Ga0055540_1000496
340 Ga0055543_1004455
341 Ga0065165_1016640
342 Ga0065704_10217709
343 Ga0065715_10161232
344 Ga0070676_11458433
345 Ga0070690_100011203
346 Ga0068869_100000262
347 Ga0070666_10152607
348 Ga0070680_100204025
349 Ga0070680_100386217
350 Ga0068868_100000778
351 Ga0068868_100003406
352 Ga0070660_100038377
353 Ga0070660_100190605
354 Ga0070689_100041734
355 Ga0070691_10019533
356 Ga0070687_100005885
357 Ga0070692_10172229
358 Ga0070671_100050731
359 Ga0070674_100322422
360 Ga0070673_100014563
361 Ga0070673_100029668
362 Ga0070659_100001158
363 Ga0070703_10105324
364 Ga0070701_10004284
365 Ga0070705_100000307
366 Ga0070700_100000145
367 Ga0070694_100014092
368 Ga0070678_101588299
369 Ga0070681_10031969
370 Ga0070681_10105587
371 Ga0070681_10969116
372 Ga0068867_100082781
373 Ga0068867_100116203
374 Ga0070706_101249322
375 Ga0070699_100328087
376 Ga0070679_100028908
377 Ga0070679_100084423
378 Ga0070679_100335196
379 Ga0070672_101410849
380 Ga0070695_100000365
381 Ga0070696_100000248
382 Ga0070696_100096013
383 Ga0070693_100000311
384 Ga0070693_100665330
385 Ga0070704_100009465
386 Ga0070704_100063892
387 Ga0068855_101272255
388 Ga0068855_101752457
389 Ga0068854_100005409
390 Ga0070702_100000014
391 Ga0068852_100124932
392 Ga0068859_100147748
393 Ga0068858_100206640
394 Ga0068858_100215939
395 Ga0068862_100002480
396 Ga0081455_10515561
397 Ga0081539_10001847
398 Ga0075367_10258917
399 Ga0097621_100002188
400 Ga0075370_10383583
401 Ga0068871_100015650
402 Ga0068871_100724472
403 Ga0068871_101198224
404 Ga0075433_10323921
405 Ga0075433_10965010
406 Ga0068865_100010886
407 Ga0097620_100147752
408 Ga0075435_100061559
409 Ga0105251_10015904
410 Ga0105240_10093354
411 Ga0105245_10004168
412 Ga0105245_10015409
413 Ga0114129_10105484
414 Ga0105243_10001207
415 Ga0105243_10063942
416 Ga0105241_10073428
417 Ga0105241_11033743
418 Ga0105242_10018837
419 Ga0105242_10052058
420 Ga0105248_10115534
421 Ga0105248_10846346
422 Ga0105237_11076206
423 Ga0105238_10221420
424 Ga0105249_10102782
425 Ga0105239_10013196
426 Ga0105239_10021973
427 Ga0105239_10123585
428 Ga0105239_11419352
429 Ga0105239_12082091
430 Ga0157371_10165646
431 Ga0157378_10158405
432 Ga0163162_10011756
433 Ga0163162_10853451
434 Ga0163162_10876947
435 Ga0157375_11223993
436 Ga0157380_10045025
437 Ga0157380_12933650
438 Ga0182008_10024204
439 Ga0157379_10257343
440 Ga0157379_10614927
441 Ga0157376_10003855
442 Ga0157376_10018773
443 Ga0157376_10298492
444 Ga0163161_10101420
445 Ga0209436_104892
446 Ga0207425_1000827
447 Ga0209129_1011420
448 Ga0209129_1020355
449 Ga0209565_1001101
450 Ga0209130_1000094
451 Ga0209675_1000988
452 Ga0209675_1002022
453 Ga0209676_1000062
454 Ga0209676_1003643
455 Ga0209025_1000008
456 Ga0209025_1028611
457 Ga0209025_1030562
458 Ga0209564_1000041
459 Ga0209758_1024813
460 Ga0209758_1030322
461 Ga0209050_1000150
462 Ga0209050_1009876
463 Ga0209256_1000014
464 Ga0209256_1023330
465 Ga0207426_1000025
466 Ga0209051_1000695
467 Ga0207713_1009868
468 Ga0207653_10054468
469 Ga0207642_10030168
470 Ga0207642_10237723
471 Ga0207684_10886270
472 Ga0207654_10093939
473 Ga0207707_10107527
474 Ga0207695_10102530
475 Ga0207695_10151897
476 Ga0207695_10961242
477 Ga0207663_11022972
478 Ga0207660_10005717
479 Ga0207660_10298176
480 Ga0207657_10041992
481 Ga0207652_10100501
482 Ga0207652_10507791
483 Ga0207694_10111531
484 Ga0207694_10254175
485 Ga0207687_10002337
486 Ga0207687_10004407
487 Ga0207687_10056833
488 Ga0207700_10854196
489 Ga0207644_10122505
490 Ga0207690_10000170
491 Ga0207686_10001499
492 Ga0207709_10002960
493 Ga0207709_11116090
494 Ga0207670_10049076
495 Ga0207669_10140828
496 Ga0207704_10000327
497 Ga0207711_11300478
498 Ga0207689_10000426
499 Ga0207679_12045983
500 Ga0207651_10030247
501 Ga0207651_10036321
502 Ga0207712_10004361
503 Ga0207712_10031874
504 Ga0207677_10000264
505 Ga0207708_10000231
506 Ga0207641_10407969
507 Ga0207675_100001410
508 Ga0207683_11407698
509 Ga0207698_10104063
510 Ga0268264_10013432
511 Ga0265326_10000049
512 Ga0265334_10002115
513 Ga0265322_10000178
514 Ga0265336_10000009
515 Ga0307515_10519055
516 Ga0265338_10000020
517 Ga0265338_10006742
518 Ga0265338_10316381
519 Ga0265324_10000105
520 Ga0265332_10003283
521 Ga0265328_10003035
522 Ga0265328_10019528
523 Ga0265320_10014298
524 Ga0265325_10000040
525 Ga0265325_10396437
526 Ga0265340_10000050
527 Ga0265339_10000072
528 Ga0265339_10001745
529 Ga0265339_10459976
530 Ga0265331_10000226
531 Ga0265331_10001734
532 Ga0265331_10275352
533 Ga0265316_10002693
534 Ga0265316_10039444
535 Ga0265313_10002250
536 Ga0265314_10025148
537 Ga0265342_10003509
538 Ga0265342_10011625
539 Ga0265342_10101606
540 Ga0307405_10037064
541 Ga0307410_10901820
542 Ga0307412_10238045
543 Ga0307416_100146926
544 Ga0307416_101788046
545 Ga0307415_101075336
546 Ga0373932_0270238
547 Ga0373936_0096858
548 Ga0373931_0065293
549 Ga0395905_0560599
550 Ga0436365_0258210
551 Ga0436365_0750887
552 Ga0436363_1567009
553 Ga0439438_008500
554 Ga0439447_005383
555 Ga0439466_0012460
556 Ga0439432_004548
557 Ga0439451_014103
558 Ga0439452_007931
559 Ga0439456_079388
560 Ga0450907_000146
561 Ga0439446_0014497
562 Ga0450909_000154
563 Ga0439434_0000153
564 Ga0439440_0002964
565 Ga0453683_0002353
566 Ga0451576_0025180
567 Ga0451576_0406813
568 Ga0495638_0013926
569 Ga0495580_0152679
570 Ga0495639_0033090
571 Ga0495584_0000038
572 Ga0495585_0224017
573 Ga0495583_0007952
574 Ga0495644_0070212
575 Ga0495586_0030203
576 Ga0495621_0014688
577 Ga0495633_0233796
578 Ga0495611_0267870
579 Ga0495625_0110620
580 Ga0495635_0289351
581 Ga0495635_0294270
582 Ga0495599_0176331
583 Ga0495613_1123734
584 Ga0495670_0329683
585 Ga0495600_0420223
586 Ga0495581_0760866
587 Ga0495672_0114545
588 Ga0495673_0000407
589 Ga0496102_0848278
590 Ga0496102_0934102
591 Ga0496105_0115131
592 Ga0496105_0375091
593 Ga0496108_0329272
594 Ga0496109_0227595
595 Ga0496110_0180590
596 Ga0496110_0228662
597 Ga0496114_0216474
598 Ga0496115_0321235
599 Ga0496119_0597686
600 Ga0496121_0023373
601 Ga0496122_0003518
602 Ga0496123_0017999
603 Ga0496124_0020056
604 Ga0496124_0034307
605 Ga0496124_0753231
606 Ga0496125_0000425
607 Ga0496126_0035909
608 Ga0501298_027616
609 Ga0501207_136571
610 Ga0501235_070298
611 Ga0501251_037619
612 Ga0501253_049969
613 Ga0501225_0172003
614 Ga0501264_014283
615 Ga0501283_081825
616 nmdc:mga03683_389485_c1
617 nmdc:mga00v17_31739_c1
618 nmdc:mga06z11_211107_c1
619 nmdc:mga07m45_203287_c1
620 nmdc:mga05p37_40599_c1
621 nmdc:mga06r32_1167015_c1
622 nmdc:mga0n895_135161_c1
623 nmdc:mga0rr50_192720_c1
624 nmdc:mga0a205_534447_c1
625 nmdc:mga0a205_81141_c1
626 Ga0500650_0023768
627 Ga0500611_000532
628 Ga0500661_009590
629 2511246985
630 2511268980
631 2512328670
632 2583793387
633 2597857359
634 2599802029
635 2600813326
636 2671768977
637 2743736784
638 2835314450
639 2847420660
640 2848995491
641 2855878019
642 2923155802
643 2984290231
644 8015690049
645 8054560721
646 8055773157

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

47

143

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7674 14 127
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7075 14 127
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6888 27 131
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.6512 33 126
3nk3-assembly1.cif.gz_B crystal structure of full-length sperm receptor zp3 at 2.6 a resolution 0.6138 64 108
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8064 16 123 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7635 16 123 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7183 14 130 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7022 14 130 3.90.1150.200
af_Q9VWM0_17_126_1.10.238.20 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;Pheromone/general odorant binding protein domain 0.6869 106 130 1.10.238.20
ID Description Score Start End GO Terms
AF-A0A7V9TMV2-F1-model_v4 DUF1801 domain-containing protein 0.9939 12 130
AF-A0A370D3G0-F1-model_v4 deleted 0.9923 12 127
AF-I4W4N0-F1-model_v4 YdhG-like domain-containing protein 0.9909 3 129
AF-A0A3N5PFV0-F1-model_v4 DUF1801 domain-containing protein 0.9881 12 130
AF-A0A1W9I9P2-F1-model_v4 deleted 0.9866 25 126

Map