F406684

General Info

Members Datasets Scaffolds Average Seq Length
322 209 644 206

Family's Representative Sequence

Representative Sequence 3300059421|Ga0590071_012521|Ga0590071_012521_799_1524
Length 241
Sequence MTVRSSPDVKSLCLRGITRWVQEIRSTKGETKVAYELPQLPYGYDDLEPTIDEQTMHLHHEKHHNTYVNNLNRALERHPEADPGSLEELLANLDSVPENIRRAVRNNGGGHSNHSMFWQIMGPSGQGGGEPTGELASAIDSTFGSFDDFKEEWASMGAPGSVFGSGWVWLIAAPDGSLTLEKTANQDSPLMEGKTPVIGLDVWEHAYYLKYQNRRPEYINAWWEVVNWDEAERRYQAARNA

Samples

Sample ID Description Type Environment
1 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
108 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
109 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
110 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
111 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
197 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
198 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
200 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
209 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.27
Metatranscriptomes 3.42
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.04
Nodule 0
Rhizoplane 5.59
Rhizosphere 89.44
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0590071_012521 3300059421 Bacteria 1987
2 JGI25406J46586_10011358 3300003203 Bacteria 3910
3 JGI25406J46586_10014308 3300003203 Bacteria 3378
4 Ga0065715_10202236 3300005293 Bacteria 1355
5 Ga0070689_100244185 3300005340 Bacteria 1480
6 Ga0070675_100066708 3300005354 Bacteria 2977
7 Ga0070675_100274898 3300005354 Bacteria 1479
8 Ga0070674_100279522 3300005356 Bacteria 1322
9 Ga0070713_100269068 3300005436 Bacteria 1560
10 Ga0070711_100529769 3300005439 Bacteria 975
11 Ga0070711_100912052 3300005439 Bacteria 750
12 Ga0070700_100008525 3300005441 Bacteria 5582
13 Ga0070694_100003820 3300005444 Bacteria 8995
14 Ga0070694_100212069 3300005444 Bacteria 1449
15 Ga0070708_100048679 3300005445 Bacteria 3748
16 Ga0070708_100554875 3300005445 Bacteria 1083
17 Ga0070708_100892051 3300005445 Bacteria 835
18 Ga0070678_100051737 3300005456 Bacteria 2979
19 Ga0070706_100154849 3300005467 Bacteria 2140
20 Ga0070706_100213918 3300005467 Bacteria 1799
21 Ga0070706_100408146 3300005467 Bacteria 1265
22 Ga0070706_100798140 3300005467 Unclassified 874
23 Ga0070706_100988861 3300005467 Bacteria 776
24 Ga0070707_100063616 3300005468 Bacteria 3540
25 Ga0070707_100272066 3300005468 Bacteria 1647
26 Ga0070707_100290337 3300005468 Bacteria 1589
27 Ga0070707_100347910 3300005468 Bacteria 1440
28 Ga0070707_100485732 3300005468 Bacteria 1197
29 Ga0070698_100142141 3300005471 Bacteria 2351
30 Ga0070698_100149214 3300005471 Bacteria 2286
31 Ga0070698_100404509 3300005471 Bacteria 1298
32 Ga0070698_100897457 3300005471 Bacteria 832
33 Ga0070697_100127770 3300005536 Bacteria 2130
34 Ga0070697_100258372 3300005536 Bacteria 1491
35 Ga0070697_100410685 3300005536 Bacteria 1176
36 Ga0070697_100586839 3300005536 Bacteria 979
37 Ga0068853_101380546 3300005539 Bacteria 681
38 Ga0070686_100228406 3300005544 Bacteria 1349
39 Ga0070704_100005484 3300005549 Bacteria 7395
40 Ga0070704_100059175 3300005549 Bacteria 2732
41 Ga0068859_100159407 3300005617 Bacteria 2335
42 Ga0068864_100806009 3300005618 Bacteria 923
43 Ga0068861_100139731 3300005719 Bacteria 1976
44 Ga0068858_100258518 3300005842 Bacteria 1655
45 Ga0068858_100350527 3300005842 Bacteria 1414
46 Ga0068858_100785142 3300005842 Bacteria 929
47 Ga0068860_100559934 3300005843 Bacteria 1146
48 Ga0068862_100189208 3300005844 Bacteria 1851
49 Ga0068862_100267022 3300005844 Bacteria 1564
50 Ga0068862_100281280 3300005844 Bacteria 1525
51 Ga0068862_100713092 3300005844 Bacteria 973
52 Ga0081455_10002992 3300005937 Bacteria 19712
53 Ga0081538_10005591 3300005981 Bacteria 11281
54 Ga0081539_10001009 3300005985 Bacteria 52009
55 Ga0081539_10008357 3300005985 Bacteria 9045
56 Ga0081539_10008433 3300005985 Bacteria 8988
57 Ga0075365_10015547 3300006038 Bacteria 4606
58 Ga0075363_100360746 3300006048 Bacteria 850
59 Ga0075364_10038630 3300006051 Bacteria 3092
60 Ga0070716_100085015 3300006173 Bacteria 1899
61 Ga0070716_100169724 3300006173 Bacteria 1423
62 Ga0070712_100227430 3300006175 Bacteria 1480
63 Ga0075362_10172155 3300006177 Bacteria 1047
64 Ga0075366_10217111 3300006195 Bacteria 1165
65 Ga0075428_100029686 3300006844 Bacteria 6050
66 Ga0075428_100217958 3300006844 Bacteria 2061
67 Ga0075428_101110024 3300006844 Bacteria 835
68 Ga0075430_100533939 3300006846 Bacteria 967
69 Ga0075430_100960254 3300006846 Bacteria 704
70 Ga0075433_10380978 3300006852 Bacteria 1245
71 Ga0075434_100171372 3300006871 Bacteria 2190
72 Ga0075434_100421990 3300006871 Bacteria 1355
73 Ga0075436_100117067 3300006914 Bacteria 1863
74 Ga0097620_100073470 3300006931 Bacteria 3458
75 Ga0097620_100159407 3300006931 Bacteria 2335
76 Ga0097620_100714773 3300006931 Bacteria 1092
77 Ga0075435_100565079 3300007076 Bacteria 986
78 Ga0099794_10169702 3300007265 Bacteria 1112
79 Ga0111539_10003508 3300009094 Bacteria 20684
80 Ga0111539_10010929 3300009094 Bacteria 11426
81 Ga0111539_10103088 3300009094 Bacteria 3348
82 Ga0111539_10478939 3300009094 Bacteria 1450
83 Ga0111539_10783685 3300009094 Bacteria 1109
84 Ga0111539_10965832 3300009094 Bacteria 991
85 Ga0105245_10009496 3300009098 Bacteria 8484
86 Ga0105245_10183638 3300009098 Bacteria 2000
87 Ga0105247_10344098 3300009101 Bacteria 1047
88 Ga0114129_10002291 3300009147 Bacteria 26502
89 Ga0114129_10027900 3300009147 Bacteria 7995
90 Ga0114129_10069000 3300009147 Bacteria 4928
91 Ga0114129_11538786 3300009147 Bacteria 816
92 Ga0105243_10077698 3300009148 Bacteria 2700
93 Ga0105241_10137753 3300009174 Bacteria 1984
94 Ga0105242_10188176 3300009176 Bacteria 1826
95 Ga0105242_10625639 3300009176 Bacteria 1043
96 Ga0105248_10831052 3300009177 Bacteria 1042
97 Ga0105238_11221341 3300009551 Bacteria 776
98 Ga0105249_10667359 3300009553 Bacteria 1098
99 Ga0105239_10322640 3300010375 Bacteria 1742
100 Ga0105246_10552862 3300011119 Bacteria 987
101 Ga0157338_1007472 3300012515 Bacteria 1037
102 Ga0157378_10046384 3300013297 Bacteria 3863
103 Ga0157378_10158871 3300013297 Bacteria 2112
104 Ga0157378_10526496 3300013297 Bacteria 1184
105 Ga0157378_10583562 3300013297 Bacteria 1127
106 Ga0157378_11321140 3300013297 Unclassified 763
107 Ga0163162_10046057 3300013306 Bacteria 4372
108 Ga0163162_10378400 3300013306 Unclassified 1549
109 Ga0163163_10593391 3300014325 Bacteria 1171
110 Ga0157380_10041164 3300014326 Bacteria 3604
111 Ga0182008_10045108 3300014497 Bacteria 2192
112 Ga0157379_10386463 3300014968 Bacteria 1285
113 Ga0157376_10094340 3300014969 Bacteria 2600
114 Ga0157376_10558849 3300014969 Bacteria 1133
115 Ga0163161_10544949 3300017792 Bacteria 950
116 Ga0197907_10634431 3300020069 Bacteria 1099
117 Ga0206356_11684794 3300020070 Bacteria 1050
118 Ga0206354_10973730 3300020081 Bacteria 836
119 Ga0206353_11638296 3300020082 Bacteria 736
120 Ga0224712_10312114 3300022467 Bacteria 737
121 Ga0207692_10405049 3300025898 Bacteria 851
122 Ga0207705_10468041 3300025909 Bacteria 978
123 Ga0207684_10104765 3300025910 Bacteria 2419
124 Ga0207684_10306271 3300025910 Bacteria 1369
125 Ga0207707_10227604 3300025912 Bacteria 1623
126 Ga0207693_10017523 3300025915 Bacteria 5711
127 Ga0207663_10969700 3300025916 Bacteria 681
128 Ga0207646_10025829 3300025922 Bacteria 5370
129 Ga0207646_10281235 3300025922 Bacteria 1504
130 Ga0207650_10332785 3300025925 Bacteria 1246
131 Ga0207687_10802145 3300025927 Bacteria 803
132 Ga0207706_10556092 3300025933 Bacteria 988
133 Ga0207706_10604061 3300025933 Bacteria 942
134 Ga0207706_10642377 3300025933 Bacteria 909
135 Ga0207686_10763397 3300025934 Bacteria 773
136 Ga0207709_10239395 3300025935 Bacteria 1319
137 Ga0207709_10709982 3300025935 Bacteria 805
138 Ga0207670_10234793 3300025936 Bacteria 1410
139 Ga0207669_10205461 3300025937 Bacteria 1433
140 Ga0207665_10305945 3300025939 Bacteria 1189
141 Ga0207711_10565886 3300025941 Bacteria 1060
142 Ga0207703_11116052 3300026035 Bacteria 758
143 Ga0207708_10009920 3300026075 Bacteria 7070
144 Ga0207641_10730809 3300026088 Bacteria 976
145 Ga0207676_11392483 3300026095 Bacteria 697
146 Ga0207675_100671464 3300026118 Bacteria 1043
147 Ga0207675_100892695 3300026118 Bacteria 905
148 Ga0207683_10122916 3300026121 Bacteria 2331
149 Ga0207428_10077272 3300027907 Bacteria 2606
150 Ga0207428_10077883 3300027907 Bacteria 2595
151 Ga0207428_10417186 3300027907 Bacteria 981
152 Ga0268265_10015483 3300028380 Bacteria 5220
153 Ga0268265_10105356 3300028380 Bacteria 2288
154 Ga0268265_10114727 3300028380 Bacteria 2207
155 Ga0268265_10496029 3300028380 Bacteria 1150
156 Ga0268265_10517651 3300028380 Bacteria 1127
157 Ga0268265_10730755 3300028380 Bacteria 959
158 Ga0268264_10195753 3300028381 Bacteria 1845
159 Ga0268264_10779567 3300028381 Bacteria 954
160 Ga0265330_10008239 3300031235 Bacteria 5028
161 Ga0265332_10000042 3300031238 Bacteria 117639
162 Ga0265332_10033632 3300031238 Bacteria 2231
163 Ga0265328_10000897 3300031239 Bacteria 13767
164 Ga0265320_10034831 3300031240 Bacteria 2557
165 Ga0265329_10003840 3300031242 Bacteria 6445
166 Ga0265329_10010539 3300031242 Bacteria 3387
167 Ga0265339_10000138 3300031249 Bacteria 60256
168 Ga0265339_10122909 3300031249 Bacteria 1332
169 Ga0265331_10000022 3300031250 Bacteria 240970
170 Ga0265327_10014321 3300031251 Bacteria 5195
171 Ga0265327_10020893 3300031251 Bacteria 3970
172 Ga0265327_10124078 3300031251 Bacteria 1221
173 Ga0265316_10000400 3300031344 Bacteria 49416
174 Ga0265313_10115887 3300031595 Bacteria 1173
175 Ga0265314_10001515 3300031711 Bacteria 25724
176 Ga0265342_10003012 3300031712 Bacteria 14124
177 Ga0316577_10211711 3300031733 Bacteria 1096
178 Ga0373930_0016024 3300034816 Bacteria 1413
179 Ga0373928_0000344 3300035084 Bacteria 9307
180 Ga0373929_0008280 3300035085 Bacteria 1914
181 Ga0373934_0047089 3300035086 Bacteria 1706
182 Ga0373923_0038462 3300035111 Bacteria 1961
183 Ga0373932_0103180 3300035112 Bacteria 931
184 Ga0373946_0075057 3300035171 Bacteria 1469
185 Ga0373955_0091624 3300035172 Bacteria 1733
186 Ga0316574_0157070 3300035398 Bacteria 1465
187 Ga0373931_0000003 3300035691 Bacteria 560286
188 Ga0373931_0776665 3300035691 Bacteria 637
189 Ga0373927_0083435 3300035695 Bacteria 2072
190 Ga0373927_0088585 3300035695 Bacteria 2009
191 Ga0373937_0119787 3300036401 Bacteria 2452
192 Ga0373937_0206982 3300036401 Bacteria 1845
193 Ga0373937_0335301 3300036401 Bacteria 1432
194 Ga0373925_0028231 3300037068 Bacteria 4110
195 Ga0436365_1310946 3300039437 Bacteria 922
196 Ga0466965_0192561 3300044683 Bacteria 1079
197 Ga0466960_0131106 3300044901 Bacteria 1323
198 Ga0495592_0132761 3300046454 Bacteria 1740
199 Ga0495592_0188720 3300046454 Bacteria 1398
200 Ga0495603_0313017 3300046455 Bacteria 902
201 Ga0495651_0136826 3300046462 Bacteria 1781
202 Ga0495651_0200312 3300046462 Bacteria 1398
203 Ga0495653_0048240 3300046463 Bacteria 3289
204 Ga0495580_0159566 3300046472 Bacteria 1561
205 Ga0495580_0204178 3300046472 Unclassified 1361
206 Ga0495582_0137729 3300046473 Bacteria 1382
207 Ga0495639_0338842 3300046475 Bacteria 754
208 Ga0495608_0039856 3300046511 Bacteria 3148
209 Ga0495618_0164140 3300046514 Bacteria 1415
210 Ga0495618_0239324 3300046514 Bacteria 1141
211 Ga0495628_0015656 3300046516 Bacteria 6332
212 Ga0495628_0027282 3300046516 Bacteria 4648
213 Ga0495630_0105739 3300046517 Bacteria 2131
214 Ga0495630_0447905 3300046517 Bacteria 989
215 Ga0495630_0486792 3300046517 Bacteria 946
216 Ga0495630_0522750 3300046517 Bacteria 910
217 Ga0495652_0169166 3300046529 Bacteria 1689
218 Ga0495652_0250824 3300046529 Bacteria 1312
219 Ga0495652_0560291 3300046529 Bacteria 785
220 Ga0495640_0053723 3300046533 Bacteria 2761
221 Ga0495586_0182132 3300046535 Bacteria 1188
222 Ga0495621_0070244 3300046539 Bacteria 1289
223 Ga0495645_0282095 3300046543 Bacteria 1092
224 Ga0495645_0511939 3300046543 Bacteria 749
225 Ga0495667_0178664 3300046559 Bacteria 1363
226 Ga0495634_0011942 3300046642 Bacteria 6303
227 Ga0495634_0026996 3300046642 Bacteria 4001
228 Ga0495669_0114234 3300046684 Bacteria 1263
229 Ga0495613_0001988 3300046689 Bacteria 15516
230 Ga0495589_0177223 3300046794 Bacteria 1012
231 Ga0495600_0343467 3300046809 Bacteria 936
232 Ga0495674_0020587 3300047319 Bacteria 6106
233 Ga0495672_0363031 3300047320 Bacteria 670
234 Ga0495680_0025484 3300047322 Bacteria 4893
235 Ga0495680_0273519 3300047322 Bacteria 1192
236 Ga0495675_0372946 3300047444 Bacteria 836
237 Ga0495593_0102979 3300047673 Bacteria 1463
238 Ga0496100_0020267 3300048903 Bacteria 3984
239 Ga0496100_0051419 3300048903 Bacteria 2675
240 Ga0496101_0017231 3300048904 Bacteria 4896
241 Ga0496101_0790691 3300048904 Bacteria 748
242 Ga0496101_0869920 3300048904 Bacteria 710
243 Ga0496102_0010928 3300048905 Bacteria 7820
244 Ga0496102_0247067 3300048905 Bacteria 1682
245 Ga0496104_0037403 3300048907 Bacteria 4539
246 Ga0496104_0048016 3300048907 Bacteria 4025
247 Ga0496105_0082090 3300048908 Bacteria 2662
248 Ga0496106_0034159 3300048909 Bacteria 3798
249 Ga0496108_0107287 3300048911 Bacteria 2385
250 Ga0496109_0151679 3300048912 Bacteria 2170
251 Ga0496109_0235013 3300048912 Bacteria 1725
252 Ga0496109_0345127 3300048912 Bacteria 1406
253 Ga0496111_0090175 3300048914 Bacteria 2246
254 Ga0496115_0007334 3300048918 Bacteria 8111
255 Ga0496115_0905581 3300048918 Bacteria 680
256 Ga0496122_0021860 3300048925 Bacteria 5707
257 Ga0501032_0177378 3300049569 Bacteria 1396
258 Ga0501033_0026983 3300049570 Bacteria 4320
259 Ga0501034_0007778 3300049571 Bacteria 11404
260 Ga0501034_0007866 3300049571 Bacteria 11331
261 Ga0501036_0047071 3300049572 Bacteria 3653
262 Ga0501036_0274804 3300049572 Bacteria 1410
263 Ga0501037_0490007 3300049573 Bacteria 835
264 Ga0501039_0361952 3300049575 Bacteria 1140
265 Ga0501040_0038321 3300049576 Bacteria 3259
266 Ga0501040_0128221 3300049576 Bacteria 1783
267 Ga0501041_0584401 3300049577 Bacteria 713
268 Ga0501046_0021041 3300049580 Bacteria 5387
269 Ga0501047_0068442 3300049581 Bacteria 3419
270 Ga0501047_0072159 3300049581 Bacteria 3323
271 Ga0501068_0306107 3300049584 Bacteria 1018
272 Ga0501069_0030616 3300049585 Bacteria 2956
273 Ga0501070_0006794 3300049586 Bacteria 9737
274 Ga0501071_0158721 3300049587 Bacteria 1689
275 Ga0501072_0938541 3300049588 Bacteria 675
276 Ga0501074_0300250 3300049590 Bacteria 1141
277 Ga0501075_0150212 3300049591 Bacteria 1776
278 Ga0501076_0168157 3300049592 Bacteria 1787
279 Ga0501077_0460352 3300049593 Bacteria 815
280 Ga0501080_0117931 3300049742 Bacteria 2460
281 Ga0501080_0201624 3300049742 Bacteria 1827
282 Ga0501080_0483904 3300049742 Bacteria 1107
283 Ga0501044_0001341 3300049823 Bacteria 28925
284 nmdc:mga03n38_350244_c1 3300050490 Bacteria 803
285 nmdc:mga00v17_332856_c1 3300050491 Bacteria 987
286 nmdc:mga0yw44_11249_c1 3300050492 Bacteria 4609
287 nmdc:mga05p37_73829_c1 3300050507 Bacteria 4198
288 nmdc:mga05p37_953016_c1 3300050507 Bacteria 918
289 nmdc:mga09592_10750_c1 3300050508 Bacteria 7442
290 nmdc:mga0qj67_312006_c1 3300050509 Bacteria 1273
291 nmdc:mga0qj67_511060_c1 3300050509 Bacteria 965
292 nmdc:mga06r32_1004293_c1 3300050510 Bacteria 787
293 nmdc:mga06r32_880993_c1 3300050510 Bacteria 852
294 nmdc:mga08y16_103637_c1 3300050511 Bacteria 2962
295 nmdc:mga08y16_196762_c1 3300050511 Bacteria 2089
296 nmdc:mga08y16_209676_c1 3300050511 Bacteria 2018
297 nmdc:mga08y16_72795_c1 3300050511 Bacteria 3581
298 nmdc:mga08y16_842851_c1 3300050511 Bacteria 906
299 nmdc:mga0n895_105713_c1 3300050512 Bacteria 2827
300 nmdc:mga0n895_498596_c1 3300050512 Bacteria 1227
301 nmdc:mga0rr50_146341_c1 3300050513 Bacteria 1905
302 nmdc:mga0a205_156717_c1 3300050515 Bacteria 2175
303 Ga0495601_0028384 3300053077 Bacteria 3466
304 Ga0495601_0110757 3300053077 Bacteria 1778
305 Ga0495619_0013118 3300053085 Bacteria 5222
306 Ga0495619_0088549 3300053085 Bacteria 2094
307 Ga0495619_0319550 3300053085 Bacteria 1075
308 Ga0500566_0007438 3300053094 Bacteria 6490
309 Ga0500641_0000667 3300053096 Bacteria 12369
310 Ga0500641_0006445 3300053096 Bacteria 4167
311 Ga0500593_029759 3300053117 Bacteria 2440
312 Ga0500568_0000135 3300053139 Bacteria 66519
313 Ga0590075_001477 3300059424 Bacteria 5871
314 Ga0590077_001835 3300059426 Bacteria 4722
315 Ga0587091_039554 3300059511 Bacteria 924
316 Ga0587113_006364 3300059625 Bacteria 1002
317 Ga0587122_010362 3300059628 Bacteria 878
318 Ga0587072_052994 3300059643 Bacteria 818
319 Ga0587107_024532 3300059652 Bacteria 870
320 Ga0587114_004354 3300059655 Bacteria 1471
321 Ga0530510_0464281 3300061734 Bacteria 958
322 8007379423 8007375930 Bacteria 4080554
323 Ga0590071_012521
324 JGI25406J46586_10011358
325 JGI25406J46586_10014308
326 Ga0065715_10202236
327 Ga0070689_100244185
328 Ga0070675_100066708
329 Ga0070675_100274898
330 Ga0070674_100279522
331 Ga0070713_100269068
332 Ga0070711_100529769
333 Ga0070711_100912052
334 Ga0070700_100008525
335 Ga0070694_100003820
336 Ga0070694_100212069
337 Ga0070708_100048679
338 Ga0070708_100554875
339 Ga0070708_100892051
340 Ga0070678_100051737
341 Ga0070706_100154849
342 Ga0070706_100213918
343 Ga0070706_100408146
344 Ga0070706_100798140
345 Ga0070706_100988861
346 Ga0070707_100063616
347 Ga0070707_100272066
348 Ga0070707_100290337
349 Ga0070707_100347910
350 Ga0070707_100485732
351 Ga0070698_100142141
352 Ga0070698_100149214
353 Ga0070698_100404509
354 Ga0070698_100897457
355 Ga0070697_100127770
356 Ga0070697_100258372
357 Ga0070697_100410685
358 Ga0070697_100586839
359 Ga0068853_101380546
360 Ga0070686_100228406
361 Ga0070704_100005484
362 Ga0070704_100059175
363 Ga0068859_100159407
364 Ga0068864_100806009
365 Ga0068861_100139731
366 Ga0068858_100258518
367 Ga0068858_100350527
368 Ga0068858_100785142
369 Ga0068860_100559934
370 Ga0068862_100189208
371 Ga0068862_100267022
372 Ga0068862_100281280
373 Ga0068862_100713092
374 Ga0081455_10002992
375 Ga0081538_10005591
376 Ga0081539_10001009
377 Ga0081539_10008357
378 Ga0081539_10008433
379 Ga0075365_10015547
380 Ga0075363_100360746
381 Ga0075364_10038630
382 Ga0070716_100085015
383 Ga0070716_100169724
384 Ga0070712_100227430
385 Ga0075362_10172155
386 Ga0075366_10217111
387 Ga0075428_100029686
388 Ga0075428_100217958
389 Ga0075428_101110024
390 Ga0075430_100533939
391 Ga0075430_100960254
392 Ga0075433_10380978
393 Ga0075434_100171372
394 Ga0075434_100421990
395 Ga0075436_100117067
396 Ga0097620_100073470
397 Ga0097620_100159407
398 Ga0097620_100714773
399 Ga0075435_100565079
400 Ga0099794_10169702
401 Ga0111539_10003508
402 Ga0111539_10010929
403 Ga0111539_10103088
404 Ga0111539_10478939
405 Ga0111539_10783685
406 Ga0111539_10965832
407 Ga0105245_10009496
408 Ga0105245_10183638
409 Ga0105247_10344098
410 Ga0114129_10002291
411 Ga0114129_10027900
412 Ga0114129_10069000
413 Ga0114129_11538786
414 Ga0105243_10077698
415 Ga0105241_10137753
416 Ga0105242_10188176
417 Ga0105242_10625639
418 Ga0105248_10831052
419 Ga0105238_11221341
420 Ga0105249_10667359
421 Ga0105239_10322640
422 Ga0105246_10552862
423 Ga0157338_1007472
424 Ga0157378_10046384
425 Ga0157378_10158871
426 Ga0157378_10526496
427 Ga0157378_10583562
428 Ga0157378_11321140
429 Ga0163162_10046057
430 Ga0163162_10378400
431 Ga0163163_10593391
432 Ga0157380_10041164
433 Ga0182008_10045108
434 Ga0157379_10386463
435 Ga0157376_10094340
436 Ga0157376_10558849
437 Ga0163161_10544949
438 Ga0197907_10634431
439 Ga0206356_11684794
440 Ga0206354_10973730
441 Ga0206353_11638296
442 Ga0224712_10312114
443 Ga0207692_10405049
444 Ga0207705_10468041
445 Ga0207684_10104765
446 Ga0207684_10306271
447 Ga0207707_10227604
448 Ga0207693_10017523
449 Ga0207663_10969700
450 Ga0207646_10025829
451 Ga0207646_10281235
452 Ga0207650_10332785
453 Ga0207687_10802145
454 Ga0207706_10556092
455 Ga0207706_10604061
456 Ga0207706_10642377
457 Ga0207686_10763397
458 Ga0207709_10239395
459 Ga0207709_10709982
460 Ga0207670_10234793
461 Ga0207669_10205461
462 Ga0207665_10305945
463 Ga0207711_10565886
464 Ga0207703_11116052
465 Ga0207708_10009920
466 Ga0207641_10730809
467 Ga0207676_11392483
468 Ga0207675_100671464
469 Ga0207675_100892695
470 Ga0207683_10122916
471 Ga0207428_10077272
472 Ga0207428_10077883
473 Ga0207428_10417186
474 Ga0268265_10015483
475 Ga0268265_10105356
476 Ga0268265_10114727
477 Ga0268265_10496029
478 Ga0268265_10517651
479 Ga0268265_10730755
480 Ga0268264_10195753
481 Ga0268264_10779567
482 Ga0265330_10008239
483 Ga0265332_10000042
484 Ga0265332_10033632
485 Ga0265328_10000897
486 Ga0265320_10034831
487 Ga0265329_10003840
488 Ga0265329_10010539
489 Ga0265339_10000138
490 Ga0265339_10122909
491 Ga0265331_10000022
492 Ga0265327_10014321
493 Ga0265327_10020893
494 Ga0265327_10124078
495 Ga0265316_10000400
496 Ga0265313_10115887
497 Ga0265314_10001515
498 Ga0265342_10003012
499 Ga0316577_10211711
500 Ga0373930_0016024
501 Ga0373928_0000344
502 Ga0373929_0008280
503 Ga0373934_0047089
504 Ga0373923_0038462
505 Ga0373932_0103180
506 Ga0373946_0075057
507 Ga0373955_0091624
508 Ga0316574_0157070
509 Ga0373931_0000003
510 Ga0373931_0776665
511 Ga0373927_0083435
512 Ga0373927_0088585
513 Ga0373937_0119787
514 Ga0373937_0206982
515 Ga0373937_0335301
516 Ga0373925_0028231
517 Ga0436365_1310946
518 Ga0466965_0192561
519 Ga0466960_0131106
520 Ga0495592_0132761
521 Ga0495592_0188720
522 Ga0495603_0313017
523 Ga0495651_0136826
524 Ga0495651_0200312
525 Ga0495653_0048240
526 Ga0495580_0159566
527 Ga0495580_0204178
528 Ga0495582_0137729
529 Ga0495639_0338842
530 Ga0495608_0039856
531 Ga0495618_0164140
532 Ga0495618_0239324
533 Ga0495628_0015656
534 Ga0495628_0027282
535 Ga0495630_0105739
536 Ga0495630_0447905
537 Ga0495630_0486792
538 Ga0495630_0522750
539 Ga0495652_0169166
540 Ga0495652_0250824
541 Ga0495652_0560291
542 Ga0495640_0053723
543 Ga0495586_0182132
544 Ga0495621_0070244
545 Ga0495645_0282095
546 Ga0495645_0511939
547 Ga0495667_0178664
548 Ga0495634_0011942
549 Ga0495634_0026996
550 Ga0495669_0114234
551 Ga0495613_0001988
552 Ga0495589_0177223
553 Ga0495600_0343467
554 Ga0495674_0020587
555 Ga0495672_0363031
556 Ga0495680_0025484
557 Ga0495680_0273519
558 Ga0495675_0372946
559 Ga0495593_0102979
560 Ga0496100_0020267
561 Ga0496100_0051419
562 Ga0496101_0017231
563 Ga0496101_0790691
564 Ga0496101_0869920
565 Ga0496102_0010928
566 Ga0496102_0247067
567 Ga0496104_0037403
568 Ga0496104_0048016
569 Ga0496105_0082090
570 Ga0496106_0034159
571 Ga0496108_0107287
572 Ga0496109_0151679
573 Ga0496109_0235013
574 Ga0496109_0345127
575 Ga0496111_0090175
576 Ga0496115_0007334
577 Ga0496115_0905581
578 Ga0496122_0021860
579 Ga0501032_0177378
580 Ga0501033_0026983
581 Ga0501034_0007778
582 Ga0501034_0007866
583 Ga0501036_0047071
584 Ga0501036_0274804
585 Ga0501037_0490007
586 Ga0501039_0361952
587 Ga0501040_0038321
588 Ga0501040_0128221
589 Ga0501041_0584401
590 Ga0501046_0021041
591 Ga0501047_0068442
592 Ga0501047_0072159
593 Ga0501068_0306107
594 Ga0501069_0030616
595 Ga0501070_0006794
596 Ga0501071_0158721
597 Ga0501072_0938541
598 Ga0501074_0300250
599 Ga0501075_0150212
600 Ga0501076_0168157
601 Ga0501077_0460352
602 Ga0501080_0117931
603 Ga0501080_0201624
604 Ga0501080_0483904
605 Ga0501044_0001341
606 nmdc:mga03n38_350244_c1
607 nmdc:mga00v17_332856_c1
608 nmdc:mga0yw44_11249_c1
609 nmdc:mga05p37_73829_c1
610 nmdc:mga05p37_953016_c1
611 nmdc:mga09592_10750_c1
612 nmdc:mga0qj67_312006_c1
613 nmdc:mga0qj67_511060_c1
614 nmdc:mga06r32_1004293_c1
615 nmdc:mga06r32_880993_c1
616 nmdc:mga08y16_103637_c1
617 nmdc:mga08y16_196762_c1
618 nmdc:mga08y16_209676_c1
619 nmdc:mga08y16_72795_c1
620 nmdc:mga08y16_842851_c1
621 nmdc:mga0n895_105713_c1
622 nmdc:mga0n895_498596_c1
623 nmdc:mga0rr50_146341_c1
624 nmdc:mga0a205_156717_c1
625 Ga0495601_0028384
626 Ga0495601_0110757
627 Ga0495619_0013118
628 Ga0495619_0088549
629 Ga0495619_0319550
630 Ga0500566_0007438
631 Ga0500641_0000667
632 Ga0500641_0006445
633 Ga0500593_029759
634 Ga0500568_0000135
635 Ga0590075_001477
636 Ga0590077_001835
637 Ga0587091_039554
638 Ga0587113_006364
639 Ga0587122_010362
640 Ga0587072_052994
641 Ga0587107_024532
642 Ga0587114_004354
643 Ga0530510_0464281
644 8007379423

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02777

Sod_Fe_C

Iron/manganese superoxide dismutases, C-terminal domain

131

234

0.97

PF00081

Sod_Fe_N

Iron/manganese superoxide dismutases, alpha-hairpin domain

34

122

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rcv-assembly3.cif.gz_D crystal structure of the bacillus subtilis superoxide dismutase 0.9829 2 205
2rcv-assembly4.cif.gz_F crystal structure of the bacillus subtilis superoxide dismutase 0.9827 2 205
1jr9-assembly1.cif.gz_A-2 crystal structure of manganese superoxide dismutases from bacillus halodenitrificans 0.9811 3 206
1xuq-assembly1.cif.gz_B crystal structure of soda-1 (ba4499) from bacillus anthracis at 1.8a resolution. 0.9806 3 206
6pro-assembly1.cif.gz_B mnsod from geobacillus stearothermophilus 0.9761 3 208
ID Description Score Start End Superfamily
2rcvB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9712 20 90 1.10.287.990
2rcvD01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9711 20 90 1.10.287.990
1xuqA02 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.9701 95 206 3.55.40.20
1xuqB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.97 20 90 1.10.287.990
1xuqA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9682 20 90 1.10.287.990
ID Description Score Start End GO Terms
AF-A0A4R5XUA2-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9864 1 206 GO:0004784
GO:0005737
GO:0046872
AF-A0A1V9WAJ6-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9856 3 206 GO:0004784
GO:0005737
GO:0046872
AF-R8CZH4-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9853 3 206 GO:0004784
GO:0005737
GO:0046872
AF-Q7SIC3-F1-model_v4 Superoxide dismutase [Mn] (EC 1.15.1.1) 0.9851 1 206 GO:0004784
GO:0005737
GO:0046872
AF-A0A838SZ06-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9842 1 204 GO:0004784
GO:0005737
GO:0046872

Map