F406640

General Info

Members Datasets Scaffolds Average Seq Length
322 251 644 135

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0106805|Ga0501032_0106805_337_816
Length 159
Sequence MDEEQMAAHLQPVPAPAAYGRGVRVILNLIWLVLCGFWMFLAYLVFGVTCCVLIITIPFGLAAFRIATFALWPFGRTIVRRPDAGAPSLIGNVVWFVFAGLWLALGHLATGIALCLTIIGIPLGLADFKLIPVSLTPLGRVIVSTEQAAAMRLAGGATF

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
74 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
130 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
141 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
142 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
220 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
221 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
222 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
223 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
224 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
225 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
226 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
227 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
247 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
248 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
249 2867369537 Streptomyces sp. Z26 Isolate Unclassified
250 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
251 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.27
Metatranscriptomes 10.87
Isolates 1.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.73
Nodule 0.31
Rhizoplane 3.11
Rhizosphere 84.16
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0106805 3300049569 Bacteria 1854
2 JGI24740J21852_10016290 3300001979 Bacteria 2689
3 JGI24739J22299_10005131 3300001989 Bacteria 4987
4 JGI24737J22298_10004759 3300001990 Bacteria 4713
5 JGI24735J21928_10025202 3300002067 Bacteria 1796
6 JGI25406J46586_10030143 3300003203 Bacteria 2044
7 rootH2_10046505 3300003320 Bacteria 7865
8 JGI25160J50197_1025089 3300003354 Bacteria 1675
9 Ga0058860_11437374 3300004801 Bacteria 518
10 Ga0070683_100118044 3300005329 Bacteria 2505
11 Ga0070683_100671350 3300005329 Bacteria 992
12 Ga0070683_101317685 3300005329 Bacteria 694
13 Ga0070690_100971963 3300005330 Bacteria 668
14 Ga0070680_100101655 3300005336 Bacteria 2386
15 Ga0070682_100173867 3300005337 Bacteria 1499
16 Ga0070689_100977745 3300005340 Bacteria 752
17 Ga0070661_100299210 3300005344 Bacteria 1252
18 Ga0070669_100928571 3300005353 Bacteria 744
19 Ga0070675_100496837 3300005354 Bacteria 1099
20 Ga0070674_100175105 3300005356 Bacteria 1639
21 Ga0070667_100042818 3300005367 Bacteria 3799
22 Ga0070714_100464683 3300005435 Bacteria 1203
23 Ga0070713_100019405 3300005436 Bacteria 5189
24 Ga0070713_100052698 3300005436 Bacteria 3369
25 Ga0070701_10694481 3300005438 Bacteria 684
26 Ga0070663_100425556 3300005455 Bacteria 1090
27 Ga0070663_101222184 3300005455 Bacteria 661
28 Ga0070662_100635970 3300005457 Bacteria 899
29 Ga0070681_10030466 3300005458 Bacteria 5413
30 Ga0068867_100755959 3300005459 Bacteria 863
31 Ga0070685_10347470 3300005466 Bacteria 1013
32 Ga0070706_100394494 3300005467 Bacteria 1288
33 Ga0070698_101227972 3300005471 Bacteria 699
34 Ga0070679_100430809 3300005530 Bacteria 1264
35 Ga0070684_100804967 3300005535 Bacteria 878
36 Ga0068853_100933908 3300005539 Bacteria 834
37 Ga0070672_100623574 3300005543 Bacteria 940
38 Ga0070665_100367621 3300005548 Bacteria 1445
39 Ga0070664_100425869 3300005564 Bacteria 1216
40 Ga0068857_100058451 3300005577 Bacteria 3424
41 Ga0068857_100108044 3300005577 Bacteria 2500
42 Ga0068857_100305694 3300005577 Bacteria 1466
43 Ga0068857_100751305 3300005577 Bacteria 929
44 Ga0068856_100295302 3300005614 Bacteria 1637
45 Ga0070702_100034815 3300005615 Bacteria 2778
46 Ga0068852_100114757 3300005616 Bacteria 2455
47 Ga0068852_100307274 3300005616 Bacteria 1537
48 Ga0068859_100513835 3300005617 Bacteria 1293
49 Ga0068870_10256068 3300005840 Bacteria 1087
50 Ga0068858_101235549 3300005842 Bacteria 735
51 Ga0068860_100471624 3300005843 Bacteria 1250
52 Ga0068862_100287402 3300005844 Bacteria 1509
53 Ga0081455_10064205 3300005937 Bacteria 3076
54 Ga0081455_10129489 3300005937 Bacteria 1975
55 Ga0081538_10124098 3300005981 Bacteria 1233
56 Ga0081539_10003649 3300005985 Bacteria 18523
57 Ga0070717_10182698 3300006028 Bacteria 1829
58 Ga0075364_10149863 3300006051 Bacteria 1572
59 Ga0070716_100699435 3300006173 Bacteria 774
60 Ga0097620_100513913 3300006931 Bacteria 1293
61 Ga0075435_100229318 3300007076 Bacteria 1578
62 Ga0105245_10335410 3300009098 Bacteria 1494
63 Ga0105243_10739880 3300009148 Bacteria 963
64 Ga0105241_12018689 3300009174 Bacteria 568
65 Ga0105238_10210576 3300009551 Bacteria 1920
66 Ga0105238_11051733 3300009551 Bacteria 836
67 Ga0105249_10538992 3300009553 Bacteria 1216
68 Ga0105028_111504 3300009993 Bacteria 933
69 Ga0105239_12116576 3300010375 Bacteria 654
70 Ga0157373_11087062 3300013100 Bacteria 600
71 Ga0157370_10077537 3300013104 Bacteria 3130
72 Ga0157369_10069055 3300013105 Bacteria 3796
73 Ga0157369_10409953 3300013105 Bacteria 1405
74 Ga0157374_11302038 3300013296 Bacteria 749
75 Ga0163162_10915100 3300013306 Bacteria 990
76 Ga0163162_12843530 3300013306 Bacteria 557
77 Ga0157372_10872339 3300013307 Bacteria 1044
78 Ga0157375_10058285 3300013308 Bacteria 3820
79 Ga0157375_10263441 3300013308 Bacteria 1885
80 Ga0163163_10045762 3300014325 Bacteria 4297
81 Ga0157377_10225879 3300014745 Bacteria 1201
82 Ga0157376_11567207 3300014969 Bacteria 693
83 Ga0157376_11713818 3300014969 Bacteria 664
84 Ga0163161_10180351 3300017792 Bacteria 1619
85 Ga0197907_10658965 3300020069 Bacteria 1145
86 Ga0197907_10970547 3300020069 Bacteria 1718
87 Ga0206349_1097799 3300020075 Bacteria 1706
88 Ga0206355_1004149 3300020076 Bacteria 1721
89 Ga0206355_1065561 3300020076 Bacteria 960
90 Ga0206351_10008641 3300020077 Bacteria 728
91 Ga0206351_10599543 3300020077 Bacteria 1896
92 Ga0206352_10413973 3300020078 Bacteria 923
93 Ga0206350_10600997 3300020080 Bacteria 965
94 Ga0206350_11158399 3300020080 Bacteria 986
95 Ga0206354_10509507 3300020081 Bacteria 1683
96 Ga0206353_11319838 3300020082 Bacteria 5305
97 Ga0154015_1472925 3300020610 Bacteria 1051
98 Ga0213876_10006166 3300021384 Bacteria 6542
99 Ga0224712_10026256 3300022467 Bacteria 2057
100 Ga0224712_10037100 3300022467 Bacteria 1812
101 Ga0207426_1007691 3300025302 Bacteria 4475
102 Ga0207656_10430403 3300025321 Bacteria 665
103 Ga0207647_10014986 3300025904 Bacteria 5328
104 Ga0207699_10424475 3300025906 Bacteria 950
105 Ga0207705_10151678 3300025909 Bacteria 1737
106 Ga0207684_10138659 3300025910 Bacteria 2090
107 Ga0207707_10057074 3300025912 Bacteria 3398
108 Ga0207671_10410561 3300025914 Bacteria 1077
109 Ga0207693_10274976 3300025915 Bacteria 1320
110 Ga0207663_11556671 3300025916 Bacteria 532
111 Ga0207660_10124894 3300025917 Bacteria 1953
112 Ga0207652_10024750 3300025921 Bacteria 4982
113 Ga0207646_10096800 3300025922 Bacteria 2644
114 Ga0207694_10685201 3300025924 Bacteria 864
115 Ga0207687_10781275 3300025927 Bacteria 814
116 Ga0207700_10003401 3300025928 Bacteria 9241
117 Ga0207700_10655663 3300025928 Bacteria 936
118 Ga0207664_10559639 3300025929 Bacteria 1026
119 Ga0207664_10969590 3300025929 Bacteria 762
120 Ga0207690_10915493 3300025932 Bacteria 728
121 Ga0207669_10866304 3300025937 Bacteria 753
122 Ga0207704_10527098 3300025938 Bacteria 956
123 Ga0207665_10251744 3300025939 Bacteria 1305
124 Ga0207668_10024688 3300025972 Bacteria 3882
125 Ga0207658_10436152 3300025986 Bacteria 1158
126 Ga0207658_10526420 3300025986 Bacteria 1055
127 Ga0207703_10687171 3300026035 Bacteria 973
128 Ga0207639_10269752 3300026041 Bacteria 1492
129 Ga0207678_10104687 3300026067 Bacteria 2415
130 Ga0207702_10144153 3300026078 Bacteria 2159
131 Ga0207702_10229881 3300026078 Bacteria 1733
132 Ga0207674_10093535 3300026116 Bacteria 2994
133 Ga0207674_10237439 3300026116 Bacteria 1770
134 Ga0207674_10263659 3300026116 Bacteria 1670
135 Ga0207675_100415407 3300026118 Bacteria 1328
136 Ga0207698_10043384 3300026142 Bacteria 3369
137 Ga0268266_10481817 3300028379 Bacteria 1183
138 Ga0268265_10033961 3300028380 Bacteria 3714
139 Ga0268265_12491358 3300028380 Bacteria 523
140 Ga0268264_10611632 3300028381 Bacteria 1075
141 Ga0307515_10000941 3300028794 Bacteria 66641
142 Ga0307512_10005227 3300030522 Bacteria 13662
143 Ga0307513_10009272 3300031456 Bacteria 12458
144 Ga0307513_10253718 3300031456 Bacteria 1553
145 Ga0307509_10099471 3300031507 Bacteria 2950
146 Ga0307508_10019089 3300031616 Bacteria 6230
147 Ga0307508_10535919 3300031616 Bacteria 768
148 Ga0307516_10003156 3300031730 Bacteria 21453
149 Ga0307413_10021439 3300031824 Bacteria 3460
150 Ga0307406_11787351 3300031901 Bacteria 546
151 Ga0307407_10377856 3300031903 Unclassified 1011
152 Ga0307409_100930483 3300031995 Unclassified 884
153 Ga0307409_101142437 3300031995 Bacteria 801
154 Ga0307409_101225566 3300031995 Bacteria 774
155 Ga0307416_100960259 3300032002 Bacteria 957
156 Ga0307416_101095931 3300032002 Bacteria 901
157 Ga0307415_100230253 3300032126 Bacteria 1492
158 Ga0307415_100444997 3300032126 Bacteria 1119
159 Ga0307507_10000110 3300033179 Bacteria 135506
160 Ga0307510_10196944 3300033180 Bacteria 1555
161 Ga0316212_1004426 3300033547 Bacteria 2042
162 Ga0373923_0013448 3300035111 Bacteria 3051
163 Ga0373953_0014372 3300035117 Bacteria 2846
164 Ga0373955_0042838 3300035172 Bacteria 2432
165 Ga0373931_0464330 3300035691 Bacteria 811
166 Ga0373933_0103791 3300035724 Bacteria 1766
167 Ga0373937_0093899 3300036401 Bacteria 2781
168 Ga0372808_006611 3300036459 Bacteria 1566
169 Ga0395898_0175169 3300037466 Bacteria 2050
170 Ga0436364_0396086 3300037853 Unclassified 565
171 Ga0436365_0399554 3300039437 Bacteria 7909
172 Ga0436365_0662351 3300039437 Bacteria 16992
173 Ga0451807_0477504 3300041486 Bacteria 590
174 Ga0439442_065125 3300042002 Bacteria 774
175 Ga0439440_0261922 3300042993 Bacteria 529
176 Ga0466961_0028489 3300044693 Bacteria 3591
177 Ga0466970_0440197 3300044765 Bacteria 746
178 Ga0466959_0362154 3300045049 Bacteria 988
179 Ga0466958_0122775 3300045836 Bacteria 1627
180 Ga0466967_0080047 3300045976 Bacteria 2947
181 Ga0466967_1164428 3300045976 Bacteria 768
182 Ga0495651_0100772 3300046462 Bacteria 2151
183 Ga0495651_0959219 3300046462 Bacteria 520
184 Ga0495653_0006341 3300046463 Bacteria 9706
185 Ga0495653_0091900 3300046463 Bacteria 2217
186 Ga0495582_0085202 3300046473 Bacteria 1758
187 Ga0495662_0010512 3300046476 Bacteria 4528
188 Ga0495664_0002935 3300046477 Bacteria 9208
189 Ga0495608_0007219 3300046511 Bacteria 7859
190 Ga0495608_0030315 3300046511 Bacteria 3662
191 Ga0495618_0110923 3300046514 Bacteria 1756
192 Ga0495620_0288705 3300046515 Bacteria 624
193 Ga0495628_0116439 3300046516 Bacteria 2052
194 Ga0495630_0340409 3300046517 Bacteria 1147
195 Ga0495632_0078434 3300046519 Bacteria 1578
196 Ga0495666_0001400 3300046526 Bacteria 11696
197 Ga0495652_0306571 3300046529 Bacteria 1152
198 Ga0495640_0026127 3300046533 Bacteria 4223
199 Ga0495586_0009854 3300046535 Bacteria 5087
200 Ga0495587_0029701 3300046536 Bacteria 3317
201 Ga0495587_0072833 3300046536 Bacteria 1996
202 Ga0495645_0005258 3300046543 Bacteria 8864
203 Ga0495645_0007826 3300046543 Bacteria 7437
204 Ga0495667_0067256 3300046559 Bacteria 2341
205 Ga0495634_0079104 3300046642 Bacteria 2153
206 Ga0495635_0150593 3300046663 Bacteria 1584
207 Ga0495657_0122628 3300046675 Bacteria 1635
208 Ga0495599_0031694 3300046678 Bacteria 3317
209 Ga0495623_0064683 3300046679 Bacteria 2288
210 Ga0495646_0051143 3300046680 Bacteria 2501
211 Ga0495646_0336910 3300046680 Bacteria 792
212 Ga0495613_0015392 3300046689 Bacteria 5687
213 Ga0495613_0939890 3300046689 Bacteria 558
214 Ga0495670_0332171 3300046691 Bacteria 817
215 Ga0495600_0046903 3300046809 Bacteria 2818
216 Ga0495600_0620721 3300046809 Bacteria 655
217 Ga0495674_0100001 3300047319 Bacteria 2468
218 Ga0495680_0088460 3300047322 Bacteria 2327
219 Ga0495675_0012466 3300047444 Bacteria 5351
220 Ga0495675_0101505 3300047444 Bacteria 1800
221 Ga0495593_0006366 3300047673 Bacteria 6924
222 Ga0495602_0054407 3300048088 Bacteria 3533
223 Ga0495602_1007378 3300048088 Bacteria 549
224 Ga0496101_1348790 3300048904 Bacteria 557
225 Ga0496108_0358366 3300048911 Bacteria 1273
226 Ga0496109_0453006 3300048912 Bacteria 1212
227 Ga0496109_0532558 3300048912 Bacteria 1108
228 Ga0496110_0247108 3300048913 Bacteria 1624
229 Ga0496110_1694503 3300048913 Bacteria 542
230 Ga0496112_1936540 3300048915 Bacteria 501
231 Ga0496113_0402089 3300048916 Bacteria 1100
232 Ga0496114_0065894 3300048917 Bacteria 3035
233 Ga0496117_0129423 3300048920 Bacteria 1533
234 Ga0496118_0034347 3300048921 Bacteria 4140
235 Ga0496125_0076206 3300048928 Bacteria 2591
236 Ga0496126_0030218 3300048929 Bacteria 5136
237 Ga0496126_0430329 3300048929 Bacteria 1065
238 Ga0501031_0117538 3300049568 Bacteria 1737
239 Ga0501032_0073770 3300049569 Bacteria 2273
240 Ga0501032_0103923 3300049569 Bacteria 1882
241 Ga0501033_0082929 3300049570 Bacteria 2350
242 Ga0501033_0093490 3300049570 Bacteria 2199
243 Ga0501034_0007817 3300049571 Bacteria 11375
244 Ga0501034_0009485 3300049571 Bacteria 10187
245 Ga0501034_0026852 3300049571 Bacteria 5858
246 Ga0501034_0587901 3300049571 Bacteria 1020
247 Ga0501036_0002213 3300049572 Bacteria 15207
248 Ga0501036_0028785 3300049572 Bacteria 4695
249 Ga0501037_0013637 3300049573 Bacteria 5987
250 Ga0501037_0447005 3300049573 Bacteria 882
251 Ga0501037_0661857 3300049573 Bacteria 697
252 Ga0501038_0004434 3300049574 Bacteria 13055
253 Ga0501038_0008097 3300049574 Bacteria 9672
254 Ga0501038_0076344 3300049574 Bacteria 2830
255 Ga0501038_0230807 3300049574 Bacteria 1473
256 Ga0501039_0761259 3300049575 Bacteria 756
257 Ga0501042_0007781 3300049578 Bacteria 7042
258 Ga0501043_0003260 3300049579 Bacteria 13377
259 Ga0501043_0020543 3300049579 Bacteria 5180
260 Ga0501043_0284306 3300049579 Bacteria 1267
261 Ga0501046_0104564 3300049580 Bacteria 2170
262 Ga0501047_0023313 3300049581 Bacteria 5943
263 Ga0501047_0071104 3300049581 Bacteria 3349
264 Ga0501047_0081469 3300049581 Bacteria 3111
265 Ga0501048_0000555 3300049582 Bacteria 26420
266 Ga0501048_0173907 3300049582 Bacteria 1526
267 Ga0501070_0949422 3300049586 Bacteria 669
268 Ga0501073_0008054 3300049589 Bacteria 7822
269 Ga0501073_0309676 3300049589 Bacteria 1089
270 Ga0501074_0001146 3300049590 Bacteria 17328
271 Ga0501076_0662844 3300049592 Bacteria 861
272 Ga0501077_0177079 3300049593 Bacteria 1355
273 Ga0501080_1687668 3300049742 Bacteria 535
274 Ga0501035_0014684 3300049822 Bacteria 7230
275 Ga0501035_0526534 3300049822 Bacteria 970
276 Ga0501044_0024545 3300049823 Bacteria 6396
277 Ga0501044_0027494 3300049823 Bacteria 6010
278 Ga0501044_1008179 3300049823 Bacteria 704
279 Ga0501045_0408414 3300049824 Bacteria 1010
280 Ga0501045_0704606 3300049824 Bacteria 745
281 nmdc:mga00v17_369510_c1 3300050491 Bacteria 932
282 nmdc:mga0rr50_235098_c1 3300050513 Bacteria 1517
283 Ga0495601_0002765 3300053077 Bacteria 9962
284 Ga0495601_0072581 3300053077 Bacteria 2199
285 Ga0495612_0241864 3300053078 Bacteria 802
286 Ga0495612_0362788 3300053078 Bacteria 655
287 Ga0495655_0021491 3300053083 Bacteria 1461
288 Ga0495595_0304159 3300053084 Bacteria 802
289 Ga0495619_0010667 3300053085 Bacteria 5784
290 Ga0500644_0012103 3300053088 Bacteria 2377
291 Ga0500651_0175650 3300053093 Bacteria 1274
292 Ga0500650_0028659 3300053098 Bacteria 2516
293 Ga0500593_000158 3300053117 Bacteria 27194
294 Ga0500594_0055234 3300053118 Bacteria 1129
295 Ga0500652_030480 3300053131 Bacteria 2109
296 Ga0500573_0344706 3300053140 Bacteria 726
297 Ga0500588_0079246 3300053146 Bacteria 1095
298 Ga0587084_069626 3300059477 Bacteria 662
299 Ga0587066_096512 3300059490 Bacteria 665
300 Ga0587070_169253 3300059491 Bacteria 561
301 Ga0587077_206305 3300059493 Bacteria 547
302 Ga0587080_026839 3300059503 Bacteria 980
303 Ga0587083_0166367 3300059505 Bacteria 607
304 Ga0587089_018644 3300059509 Bacteria 943
305 Ga0587090_107820 3300059510 Bacteria 590
306 Ga0587092_122302 3300059512 Bacteria 557
307 Ga0587094_018654 3300059513 Bacteria 989
308 Ga0587097_08178 3300059603 Bacteria 535
309 Ga0587098_057339 3300059604 Bacteria 604
310 Ga0587109_126732 3300059624 Bacteria 611
311 Ga0587128_178744 3300059630 Bacteria 500
312 Ga0587067_132291 3300059640 Bacteria 610
313 Ga0587072_054426 3300059643 Bacteria 810
314 Ga0587076_080228 3300059645 Bacteria 695
315 Ga0587114_045487 3300059655 Bacteria 726
316 Ga0501082_1624851 3300060353 Bacteria 564
317 2644014536 2643221601 Bacteria 7493239
318 2644175973 2643221631 Bacteria 8168043
319 2842139583 2842134933 Bacteria 5847019
320 2867373153 2867369537 Bacteria 6501581
321 2891331128 2891326441 Bacteria 6439512
322 3006427257 3006425503 Bacteria 6491253
323 Ga0501032_0106805
324 JGI24740J21852_10016290
325 JGI24739J22299_10005131
326 JGI24737J22298_10004759
327 JGI24735J21928_10025202
328 JGI25406J46586_10030143
329 rootH2_10046505
330 JGI25160J50197_1025089
331 Ga0058860_11437374
332 Ga0070683_100118044
333 Ga0070683_100671350
334 Ga0070683_101317685
335 Ga0070690_100971963
336 Ga0070680_100101655
337 Ga0070682_100173867
338 Ga0070689_100977745
339 Ga0070661_100299210
340 Ga0070669_100928571
341 Ga0070675_100496837
342 Ga0070674_100175105
343 Ga0070667_100042818
344 Ga0070714_100464683
345 Ga0070713_100019405
346 Ga0070713_100052698
347 Ga0070701_10694481
348 Ga0070663_100425556
349 Ga0070663_101222184
350 Ga0070662_100635970
351 Ga0070681_10030466
352 Ga0068867_100755959
353 Ga0070685_10347470
354 Ga0070706_100394494
355 Ga0070698_101227972
356 Ga0070679_100430809
357 Ga0070684_100804967
358 Ga0068853_100933908
359 Ga0070672_100623574
360 Ga0070665_100367621
361 Ga0070664_100425869
362 Ga0068857_100058451
363 Ga0068857_100108044
364 Ga0068857_100305694
365 Ga0068857_100751305
366 Ga0068856_100295302
367 Ga0070702_100034815
368 Ga0068852_100114757
369 Ga0068852_100307274
370 Ga0068859_100513835
371 Ga0068870_10256068
372 Ga0068858_101235549
373 Ga0068860_100471624
374 Ga0068862_100287402
375 Ga0081455_10064205
376 Ga0081455_10129489
377 Ga0081538_10124098
378 Ga0081539_10003649
379 Ga0070717_10182698
380 Ga0075364_10149863
381 Ga0070716_100699435
382 Ga0097620_100513913
383 Ga0075435_100229318
384 Ga0105245_10335410
385 Ga0105243_10739880
386 Ga0105241_12018689
387 Ga0105238_10210576
388 Ga0105238_11051733
389 Ga0105249_10538992
390 Ga0105028_111504
391 Ga0105239_12116576
392 Ga0157373_11087062
393 Ga0157370_10077537
394 Ga0157369_10069055
395 Ga0157369_10409953
396 Ga0157374_11302038
397 Ga0163162_10915100
398 Ga0163162_12843530
399 Ga0157372_10872339
400 Ga0157375_10058285
401 Ga0157375_10263441
402 Ga0163163_10045762
403 Ga0157377_10225879
404 Ga0157376_11567207
405 Ga0157376_11713818
406 Ga0163161_10180351
407 Ga0197907_10658965
408 Ga0197907_10970547
409 Ga0206349_1097799
410 Ga0206355_1004149
411 Ga0206355_1065561
412 Ga0206351_10008641
413 Ga0206351_10599543
414 Ga0206352_10413973
415 Ga0206350_10600997
416 Ga0206350_11158399
417 Ga0206354_10509507
418 Ga0206353_11319838
419 Ga0154015_1472925
420 Ga0213876_10006166
421 Ga0224712_10026256
422 Ga0224712_10037100
423 Ga0207426_1007691
424 Ga0207656_10430403
425 Ga0207647_10014986
426 Ga0207699_10424475
427 Ga0207705_10151678
428 Ga0207684_10138659
429 Ga0207707_10057074
430 Ga0207671_10410561
431 Ga0207693_10274976
432 Ga0207663_11556671
433 Ga0207660_10124894
434 Ga0207652_10024750
435 Ga0207646_10096800
436 Ga0207694_10685201
437 Ga0207687_10781275
438 Ga0207700_10003401
439 Ga0207700_10655663
440 Ga0207664_10559639
441 Ga0207664_10969590
442 Ga0207690_10915493
443 Ga0207669_10866304
444 Ga0207704_10527098
445 Ga0207665_10251744
446 Ga0207668_10024688
447 Ga0207658_10436152
448 Ga0207658_10526420
449 Ga0207703_10687171
450 Ga0207639_10269752
451 Ga0207678_10104687
452 Ga0207702_10144153
453 Ga0207702_10229881
454 Ga0207674_10093535
455 Ga0207674_10237439
456 Ga0207674_10263659
457 Ga0207675_100415407
458 Ga0207698_10043384
459 Ga0268266_10481817
460 Ga0268265_10033961
461 Ga0268265_12491358
462 Ga0268264_10611632
463 Ga0307515_10000941
464 Ga0307512_10005227
465 Ga0307513_10009272
466 Ga0307513_10253718
467 Ga0307509_10099471
468 Ga0307508_10019089
469 Ga0307508_10535919
470 Ga0307516_10003156
471 Ga0307413_10021439
472 Ga0307406_11787351
473 Ga0307407_10377856
474 Ga0307409_100930483
475 Ga0307409_101142437
476 Ga0307409_101225566
477 Ga0307416_100960259
478 Ga0307416_101095931
479 Ga0307415_100230253
480 Ga0307415_100444997
481 Ga0307507_10000110
482 Ga0307510_10196944
483 Ga0316212_1004426
484 Ga0373923_0013448
485 Ga0373953_0014372
486 Ga0373955_0042838
487 Ga0373931_0464330
488 Ga0373933_0103791
489 Ga0373937_0093899
490 Ga0372808_006611
491 Ga0395898_0175169
492 Ga0436364_0396086
493 Ga0436365_0399554
494 Ga0436365_0662351
495 Ga0451807_0477504
496 Ga0439442_065125
497 Ga0439440_0261922
498 Ga0466961_0028489
499 Ga0466970_0440197
500 Ga0466959_0362154
501 Ga0466958_0122775
502 Ga0466967_0080047
503 Ga0466967_1164428
504 Ga0495651_0100772
505 Ga0495651_0959219
506 Ga0495653_0006341
507 Ga0495653_0091900
508 Ga0495582_0085202
509 Ga0495662_0010512
510 Ga0495664_0002935
511 Ga0495608_0007219
512 Ga0495608_0030315
513 Ga0495618_0110923
514 Ga0495620_0288705
515 Ga0495628_0116439
516 Ga0495630_0340409
517 Ga0495632_0078434
518 Ga0495666_0001400
519 Ga0495652_0306571
520 Ga0495640_0026127
521 Ga0495586_0009854
522 Ga0495587_0029701
523 Ga0495587_0072833
524 Ga0495645_0005258
525 Ga0495645_0007826
526 Ga0495667_0067256
527 Ga0495634_0079104
528 Ga0495635_0150593
529 Ga0495657_0122628
530 Ga0495599_0031694
531 Ga0495623_0064683
532 Ga0495646_0051143
533 Ga0495646_0336910
534 Ga0495613_0015392
535 Ga0495613_0939890
536 Ga0495670_0332171
537 Ga0495600_0046903
538 Ga0495600_0620721
539 Ga0495674_0100001
540 Ga0495680_0088460
541 Ga0495675_0012466
542 Ga0495675_0101505
543 Ga0495593_0006366
544 Ga0495602_0054407
545 Ga0495602_1007378
546 Ga0496101_1348790
547 Ga0496108_0358366
548 Ga0496109_0453006
549 Ga0496109_0532558
550 Ga0496110_0247108
551 Ga0496110_1694503
552 Ga0496112_1936540
553 Ga0496113_0402089
554 Ga0496114_0065894
555 Ga0496117_0129423
556 Ga0496118_0034347
557 Ga0496125_0076206
558 Ga0496126_0030218
559 Ga0496126_0430329
560 Ga0501031_0117538
561 Ga0501032_0073770
562 Ga0501032_0103923
563 Ga0501033_0082929
564 Ga0501033_0093490
565 Ga0501034_0007817
566 Ga0501034_0009485
567 Ga0501034_0026852
568 Ga0501034_0587901
569 Ga0501036_0002213
570 Ga0501036_0028785
571 Ga0501037_0013637
572 Ga0501037_0447005
573 Ga0501037_0661857
574 Ga0501038_0004434
575 Ga0501038_0008097
576 Ga0501038_0076344
577 Ga0501038_0230807
578 Ga0501039_0761259
579 Ga0501042_0007781
580 Ga0501043_0003260
581 Ga0501043_0020543
582 Ga0501043_0284306
583 Ga0501046_0104564
584 Ga0501047_0023313
585 Ga0501047_0071104
586 Ga0501047_0081469
587 Ga0501048_0000555
588 Ga0501048_0173907
589 Ga0501070_0949422
590 Ga0501073_0008054
591 Ga0501073_0309676
592 Ga0501074_0001146
593 Ga0501076_0662844
594 Ga0501077_0177079
595 Ga0501080_1687668
596 Ga0501035_0014684
597 Ga0501035_0526534
598 Ga0501044_0024545
599 Ga0501044_0027494
600 Ga0501044_1008179
601 Ga0501045_0408414
602 Ga0501045_0704606
603 nmdc:mga00v17_369510_c1
604 nmdc:mga0rr50_235098_c1
605 Ga0495601_0002765
606 Ga0495601_0072581
607 Ga0495612_0241864
608 Ga0495612_0362788
609 Ga0495655_0021491
610 Ga0495595_0304159
611 Ga0495619_0010667
612 Ga0500644_0012103
613 Ga0500651_0175650
614 Ga0500650_0028659
615 Ga0500593_000158
616 Ga0500594_0055234
617 Ga0500652_030480
618 Ga0500573_0344706
619 Ga0500588_0079246
620 Ga0587084_069626
621 Ga0587066_096512
622 Ga0587070_169253
623 Ga0587077_206305
624 Ga0587080_026839
625 Ga0587083_0166367
626 Ga0587089_018644
627 Ga0587090_107820
628 Ga0587092_122302
629 Ga0587094_018654
630 Ga0587097_08178
631 Ga0587098_057339
632 Ga0587109_126732
633 Ga0587128_178744
634 Ga0587067_132291
635 Ga0587072_054426
636 Ga0587076_080228
637 Ga0587114_045487
638 Ga0501082_1624851
639 2644014536
640 2644175973
641 2842139583
642 2867373153
643 2891331128
644 3006427257

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03733

YccF

Inner membrane component domain

26

76

0.98

PF03733

YccF

Inner membrane component domain

90

140

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xk8-assembly1.cif.gz_R cryo-em structure of the neuromedin u receptor 2 (nmur2) in complex with g protein and its endogeneous peptide-agonist nmu25 0.3399 30 113
6ibb-assembly2.cif.gz_C crystal structure of the rat isoform of the succinate receptor sucnr1 (gpr91) in complex with a nanobody 0.3336 1 111
6q58-assembly1.cif.gz_A copper loading to a cytosolic copper storage protein from streptomyces lividans (five coppers) 0.3028 6 113
6ibb-assembly2.cif.gz_C crystal structure of the rat isoform of the succinate receptor sucnr1 (gpr91) in complex with a nanobody 0.298 1 111
5arm-assembly1.cif.gz_A apo-csp3 (copper storage protein 3) from methylosinus 0.2951 6 113
ID Description Score Start End Superfamily
af_Q3UWK9_9_163_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.3851 2 112 1.20.1260.10
af_E7F8C4_71_358_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3534 5 111 1.20.1070.10
af_Q3UWK9_9_163_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.3393 2 112 1.20.1260.10
af_D4A879_3_173_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.3241 10 112 1.20.1260.10
af_A0A0B4JCU6_1_139_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3233 4 113 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2Y8ZVB7-F1-model_v4 Uncharacterized membrane protein YccF, DUF307 family 1.002 1 125 GO:0005886
AF-A0A1H1M998-F1-model_v4 Uncharacterized membrane protein YccF, DUF307 family 1.001 2 122 GO:0005886
AF-F4D1P3-F1-model_v4 Inner membrane component domain-containing protein 0.9998 1 122 GO:0005886
AF-A0A495WT89-F1-model_v4 deleted 0.9997 1 122
AF-A0A6J4RQB3-F1-model_v4 Integral membrane protein 0.9994 1 123 GO:0005886

Map