F406595

General Info

Members Datasets Scaffolds Average Seq Length
322 217 644 309

Family's Representative Sequence

Representative Sequence 3300046557|Ga0495622_0004071|Ga0495622_0004071_5791_6783
Length 330
Sequence MAGTSPAMTSKLNFLRTIQFMPLRLIFMGTPDFAVPTLLELVAHGHEVVAVYTRVAKPAGRGMKLQPTPVEVEARRLGIPVFTPATLKTPEALAAFRTHNADAAVVVAYGMILPQAILDAPKLGCFNLHGSLLPRWRGAAPINRAIMVGDAETGVMVMKMDAGLDTGDVAMAERLAITDTMTAADLHDALAPLGADLMVRAIGALERGKLQLTKQSDQGVTYAAKIEKAEARIDWSKSAHEVLRHIHGLSPFPGAWCEMVIEGEAVRVKILRCAIVDGSGAPGDLIDDRLTIACRDGALRIVQLQRAGKAPMKADVFLRGTPLKPPMRLN

Samples

Sample ID Description Type Environment
1 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
98 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
99 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
100 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
205 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
206 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
207 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
208 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
209 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
210 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
213 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
214 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
215 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
216 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
217 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.31
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.83
Nodule 0.31
Rhizoplane 0.93
Rhizosphere 85.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495622_0004071 3300046557 Bacteria 6826
2 JGI25406J46586_10010355 3300003203 Bacteria 4138
3 JGI25404J52841_10006551 3300003659 Bacteria 2442
4 Ga0070658_10156904 3300005327 Bacteria 1908
5 Ga0070683_100029226 3300005329 Bacteria 4988
6 Ga0070670_100075400 3300005331 Bacteria 2898
7 Ga0068869_100052543 3300005334 Bacteria 2959
8 Ga0070666_10000686 3300005335 Bacteria 20544
9 Ga0070661_100022011 3300005344 Bacteria 4560
10 Ga0070661_100309792 3300005344 Bacteria 1231
11 Ga0070668_100185678 3300005347 Bacteria 1700
12 Ga0070675_100277603 3300005354 Bacteria 1472
13 Ga0070674_100090970 3300005356 Bacteria 2202
14 Ga0070667_100221915 3300005367 Bacteria 1682
15 Ga0070713_100027426 3300005436 Bacteria 4484
16 Ga0070678_100002862 3300005456 Bacteria 9557
17 Ga0070678_100279579 3300005456 Bacteria 1411
18 Ga0070681_10010553 3300005458 Bacteria 9123
19 Ga0070681_10116046 3300005458 Bacteria 2614
20 Ga0070679_100010782 3300005530 Bacteria 8677
21 Ga0070679_100051194 3300005530 Bacteria 4113
22 Ga0070684_100006146 3300005535 Bacteria 9257
23 Ga0070684_100074214 3300005535 Bacteria 2998
24 Ga0068853_100002247 3300005539 Bacteria 14434
25 Ga0068853_100084410 3300005539 Bacteria 2782
26 Ga0070665_100475238 3300005548 Bacteria 1261
27 Ga0068855_100147390 3300005563 Bacteria 2678
28 Ga0068854_100169847 3300005578 Bacteria 1696
29 Ga0068856_100003436 3300005614 Bacteria 16012
30 Ga0068856_100167230 3300005614 Bacteria 2210
31 Ga0068856_100175538 3300005614 Bacteria 2155
32 Ga0068852_100040831 3300005616 Bacteria 3917
33 Ga0068852_100060087 3300005616 Bacteria 3299
34 Ga0068859_100272861 3300005617 Bacteria 1783
35 Ga0068864_100185351 3300005618 Bacteria 1905
36 Ga0068861_100432230 3300005719 Bacteria 1175
37 Ga0068858_100217005 3300005842 Bacteria 1811
38 Ga0068858_100385324 3300005842 Bacteria 1345
39 Ga0068860_100252623 3300005843 Bacteria 1717
40 Ga0068862_100144896 3300005844 Bacteria 2111
41 Ga0068862_100332877 3300005844 Bacteria 1404
42 Ga0081455_10007751 3300005937 Bacteria 11258
43 Ga0081455_10049210 3300005937 Bacteria 3635
44 Ga0081455_10154918 3300005937 Bacteria 1763
45 Ga0081455_10170723 3300005937 Bacteria 1657
46 Ga0081540_1002275 3300005983 Bacteria 15781
47 Ga0081540_1003256 3300005983 Bacteria 12900
48 Ga0081540_1005790 3300005983 Bacteria 9146
49 Ga0081540_1015306 3300005983 Bacteria 4861
50 Ga0081540_1024106 3300005983 Bacteria 3539
51 Ga0081540_1060308 3300005983 Bacteria 1816
52 Ga0081539_10001394 3300005985 Bacteria 41637
53 Ga0081539_10089319 3300005985 Bacteria 1596
54 Ga0075365_10039804 3300006038 Bacteria 3063
55 Ga0075364_10047455 3300006051 Bacteria 2797
56 Ga0070712_100123554 3300006175 Bacteria 1951
57 Ga0097621_100083837 3300006237 Bacteria 2656
58 Ga0068871_100079595 3300006358 Bacteria 2712
59 Ga0075428_100220908 3300006844 Bacteria 2046
60 Ga0075428_100306584 3300006844 Bacteria 1707
61 Ga0068865_100031007 3300006881 Bacteria 3560
62 Ga0097620_100272862 3300006931 Bacteria 1783
63 Ga0105240_10026834 3300009093 Bacteria 7553
64 Ga0105240_10094353 3300009093 Bacteria 3650
65 Ga0105240_10126917 3300009093 Bacteria 3064
66 Ga0105240_10147991 3300009093 Bacteria 2800
67 Ga0105247_10042593 3300009101 Bacteria 2781
68 Ga0105247_10157271 3300009101 Bacteria 1502
69 Ga0114129_10021026 3300009147 Bacteria 9268
70 Ga0105243_10360041 3300009148 Bacteria 1339
71 Ga0105248_10000001 3300009177 Bacteria 1881304
72 Ga0105248_10864905 3300009177 Bacteria 1021
73 Ga0105237_10092641 3300009545 Bacteria 3011
74 Ga0105237_10579894 3300009545 Bacteria 1128
75 Ga0105238_10089475 3300009551 Bacteria 3065
76 Ga0105249_10302642 3300009553 Bacteria 1604
77 Ga0105239_10106057 3300010375 Bacteria 3112
78 Ga0105239_10358511 3300010375 Bacteria 1647
79 Ga0105246_10000812 3300011119 Bacteria 17771
80 Ga0105246_10035713 3300011119 Bacteria 3324
81 Ga0157370_10117175 3300013104 Bacteria 2488
82 Ga0157369_10005581 3300013105 Bacteria 14608
83 Ga0157369_10042419 3300013105 Bacteria 4963
84 Ga0163162_10837412 3300013306 Bacteria 1036
85 Ga0157372_10078034 3300013307 Bacteria 3741
86 Ga0157375_10528389 3300013308 Bacteria 1342
87 Ga0157380_10329138 3300014326 Bacteria 1420
88 Ga0163161_10411228 3300017792 Bacteria 1087
89 Ga0206353_11969449 3300020082 Bacteria 1171
90 Ga0207710_10063487 3300025900 Bacteria 1680
91 Ga0207654_10102499 3300025911 Bacteria 1766
92 Ga0207707_10002360 3300025912 Bacteria 17009
93 Ga0207695_10116633 3300025913 Bacteria 2644
94 Ga0207693_10092144 3300025915 Bacteria 2375
95 Ga0207693_10113495 3300025915 Bacteria 2126
96 Ga0207660_10062150 3300025917 Bacteria 2690
97 Ga0207657_10126875 3300025919 Bacteria 2095
98 Ga0207657_10139699 3300025919 Bacteria 1980
99 Ga0207652_10084520 3300025921 Bacteria 2780
100 Ga0207652_10174937 3300025921 Bacteria 1927
101 Ga0207694_10356392 3300025924 Bacteria 1211
102 Ga0207650_10114953 3300025925 Bacteria 2088
103 Ga0207700_10058846 3300025928 Bacteria 2905
104 Ga0207700_10271544 3300025928 Bacteria 1456
105 Ga0207709_10135693 3300025935 Bacteria 1684
106 Ga0207669_10184402 3300025937 Bacteria 1499
107 Ga0207704_10097534 3300025938 Bacteria 1950
108 Ga0207691_10086622 3300025940 Bacteria 2810
109 Ga0207691_10227750 3300025940 Bacteria 1615
110 Ga0207711_10000001 3300025941 Bacteria 1325674
111 Ga0207661_10054902 3300025944 Bacteria 3192
112 Ga0207661_10120643 3300025944 Bacteria 2231
113 Ga0207667_10086709 3300025949 Bacteria 3239
114 Ga0207651_10008084 3300025960 Bacteria 5651
115 Ga0207712_10282269 3300025961 Bacteria 1356
116 Ga0207668_10037595 3300025972 Bacteria 3241
117 Ga0207658_10275067 3300025986 Bacteria 1441
118 Ga0207678_10054131 3300026067 Bacteria 3456
119 Ga0207678_10282323 3300026067 Bacteria 1425
120 Ga0207702_10000101 3300026078 Bacteria 99845
121 Ga0207702_10098226 3300026078 Bacteria 2579
122 Ga0207702_10124701 3300026078 Bacteria 2310
123 Ga0207702_10421584 3300026078 Bacteria 1291
124 Ga0207676_10184296 3300026095 Bacteria 1831
125 Ga0207674_10094915 3300026116 Bacteria 2969
126 Ga0207675_100509084 3300026118 Bacteria 1199
127 Ga0207683_10065809 3300026121 Bacteria 3196
128 Ga0207698_10088447 3300026142 Bacteria 2526
129 Ga0209588_1002374 3300027671 Bacteria 5099
130 Ga0268265_10085645 3300028380 Bacteria 2502
131 Ga0268264_10057918 3300028381 Bacteria 3242
132 Ga0307517_10084126 3300028786 Bacteria 2681
133 Ga0265332_10047870 3300031238 Bacteria 1839
134 Ga0307508_10001545 3300031616 Bacteria 25766
135 Ga0265314_10003805 3300031711 Bacteria 14416
136 Ga0265314_10013954 3300031711 Bacteria 6462
137 Ga0265314_10089657 3300031711 Bacteria 2005
138 Ga0265342_10007707 3300031712 Bacteria 7840
139 Ga0307516_10010638 3300031730 Bacteria 10093
140 Ga0307507_10159881 3300033179 Bacteria 1667
141 Ga0373944_0026553 3300035089 Bacteria 1711
142 Ga0373923_0008950 3300035111 Bacteria 3593
143 Ga0373923_0010631 3300035111 Bacteria 3354
144 Ga0373936_0003417 3300035113 Bacteria 5953
145 Ga0373945_0031494 3300035116 Bacteria 1874
146 Ga0373953_0062702 3300035117 Bacteria 1522
147 Ga0373954_0095858 3300035118 Bacteria 1428
148 Ga0373957_0021843 3300035120 Bacteria 2276
149 Ga0373943_0135310 3300035170 Bacteria 1323
150 Ga0373946_0055577 3300035171 Bacteria 1669
151 Ga0373946_0068296 3300035171 Bacteria 1528
152 Ga0373924_0042294 3300035410 Bacteria 1869
153 Ga0373935_0000128 3300035692 Bacteria 34347
154 Ga0373935_0028842 3300035692 Bacteria 3430
155 Ga0373927_0000496 3300035695 Bacteria 29963
156 Ga0373927_0056268 3300035695 Bacteria 2542
157 Ga0373927_0057339 3300035695 Bacteria 2519
158 Ga0373933_0035639 3300035724 Bacteria 2907
159 Ga0373947_0001955 3300035725 Bacteria 12612
160 Ga0373947_0046795 3300035725 Bacteria 2591
161 Ga0373937_0020378 3300036401 Bacteria 5946
162 Ga0373937_0070290 3300036401 Bacteria 3229
163 Ga0373925_0006551 3300037068 Bacteria 8561
164 Ga0373925_0157410 3300037068 Bacteria 1787
165 Ga0395900_0021332 3300037418 Bacteria 6622
166 Ga0395898_0021596 3300037466 Bacteria 6524
167 Ga0395898_0107991 3300037466 Bacteria 2669
168 Ga0395905_0305919 3300037471 Bacteria 1478
169 Ga0436364_0088187 3300037853 Bacteria 5856
170 Ga0395901_0002873 3300038443 Bacteria 17387
171 Ga0395901_0328658 3300038443 Bacteria 1581
172 Ga0436365_0173471 3300039437 Bacteria 110650
173 Ga0436365_0291695 3300039437 Bacteria 1894
174 Ga0466966_0114197 3300044684 Bacteria 1663
175 Ga0466957_0174437 3300044842 Bacteria 1402
176 Ga0466959_0019384 3300045049 Bacteria 5003
177 Ga0466967_0241889 3300045976 Bacteria 1722
178 Ga0495617_014085 3300046452 Bacteria 2718
179 Ga0495592_0020114 3300046454 Bacteria 5076
180 Ga0495592_0025246 3300046454 Bacteria 4512
181 Ga0495603_0000104 3300046455 Bacteria 39821
182 Ga0495603_0036176 3300046455 Bacteria 2964
183 Ga0495603_0081787 3300046455 Bacteria 1892
184 Ga0495603_0149049 3300046455 Bacteria 1359
185 Ga0495629_0006415 3300046459 Bacteria 8719
186 Ga0495629_0008475 3300046459 Bacteria 7569
187 Ga0495638_0082602 3300046460 Bacteria 1948
188 Ga0495641_0000402 3300046461 Bacteria 36037
189 Ga0495641_0136650 3300046461 Bacteria 1095
190 Ga0495651_0069504 3300046462 Bacteria 2682
191 Ga0495653_0127629 3300046463 Bacteria 1804
192 Ga0495580_0003617 3300046472 Bacteria 13095
193 Ga0495580_0035135 3300046472 Bacteria 3604
194 Ga0495582_0000063 3300046473 Bacteria 54381
195 Ga0495582_0048475 3300046473 Bacteria 2339
196 Ga0495639_0000224 3300046475 Bacteria 28629
197 Ga0495639_0014175 3300046475 Bacteria 3450
198 Ga0495639_0027127 3300046475 Bacteria 2534
199 Ga0495662_0000297 3300046476 Bacteria 21564
200 Ga0495664_0008319 3300046477 Bacteria 5783
201 Ga0495584_0233219 3300046491 Bacteria 936
202 Ga0495584_0234702 3300046491 Bacteria 932
203 Ga0495594_0001344 3300046499 Bacteria 12765
204 Ga0495594_0073230 3300046499 Bacteria 1906
205 Ga0495594_0109790 3300046499 Bacteria 1555
206 Ga0495596_0053329 3300046500 Bacteria 1582
207 Ga0495608_0130300 3300046511 Bacteria 1610
208 Ga0495610_0150149 3300046512 Bacteria 995
209 Ga0495628_0019566 3300046516 Bacteria 5595
210 Ga0495628_0073206 3300046516 Bacteria 2670
211 Ga0495630_0003717 3300046517 Bacteria 10637
212 Ga0495648_0001804 3300046524 Bacteria 20615
213 Ga0495648_0013652 3300046524 Bacteria 5990
214 Ga0495666_0003431 3300046526 Bacteria 7991
215 Ga0495652_0111606 3300046529 Bacteria 2198
216 Ga0495652_0164674 3300046529 Bacteria 1717
217 Ga0495665_0000290 3300046531 Bacteria 25439
218 Ga0495665_0020154 3300046531 Bacteria 3583
219 Ga0495640_0005621 3300046533 Bacteria 9972
220 Ga0495586_0046760 3300046535 Bacteria 2334
221 Ga0495645_0083912 3300046543 Bacteria 2283
222 Ga0495622_0109280 3300046557 Bacteria 1266
223 Ga0495633_0105769 3300046558 Bacteria 1305
224 Ga0495667_0039095 3300046559 Bacteria 3157
225 Ga0495668_0237458 3300046616 Bacteria 998
226 Ga0495668_0240126 3300046616 Bacteria 992
227 Ga0495634_0000645 3300046642 Bacteria 33906
228 Ga0495634_0031148 3300046642 Bacteria 3675
229 Ga0495635_0007816 3300046663 Bacteria 7465
230 Ga0495599_0101318 3300046678 Bacteria 1795
231 Ga0495599_0248842 3300046678 Bacteria 1082
232 Ga0495647_0008159 3300046681 Bacteria 3520
233 Ga0495647_0023505 3300046681 Bacteria 2235
234 Ga0495658_0000702 3300046683 Bacteria 18142
235 Ga0495658_0010450 3300046683 Bacteria 4644
236 Ga0495613_0000449 3300046689 Bacteria 35095
237 Ga0495624_0000224 3300046690 Bacteria 44228
238 Ga0495624_0026428 3300046690 Bacteria 3804
239 Ga0495671_0092867 3300046692 Bacteria 1477
240 Ga0495600_0239213 3300046809 Bacteria 1157
241 Ga0495581_0000168 3300047315 Bacteria 29532
242 Ga0495581_0068429 3300047315 Bacteria 2053
243 Ga0495581_0170397 3300047315 Bacteria 1273
244 Ga0495604_0079624 3300047317 Bacteria 2457
245 Ga0495636_0171045 3300047318 Bacteria 982
246 Ga0495674_0005032 3300047319 Bacteria 12712
247 Ga0495672_0033619 3300047320 Bacteria 3175
248 Ga0495676_0011951 3300047321 Bacteria 7832
249 Ga0495676_0031024 3300047321 Bacteria 4527
250 Ga0495684_0017497 3300047471 Bacteria 5519
251 Ga0495684_0202497 3300047471 Bacteria 1463
252 Ga0495684_0212511 3300047471 Bacteria 1422
253 Ga0495684_0281609 3300047471 Bacteria 1199
254 Ga0495593_0000150 3300047673 Bacteria 34569
255 Ga0495593_0084122 3300047673 Bacteria 1642
256 Ga0495614_0021011 3300048089 Bacteria 2822
257 Ga0495614_0033944 3300048089 Bacteria 2194
258 Ga0496100_0226838 3300048903 Bacteria 1373
259 Ga0496101_0327235 3300048904 Bacteria 1203
260 Ga0496109_0183506 3300048912 Bacteria 1966
261 Ga0496121_0000154 3300048924 Bacteria 150013
262 Ga0496121_0000596 3300048924 Bacteria 67893
263 Ga0496121_0012048 3300048924 Bacteria 9499
264 Ga0496122_0133229 3300048925 Bacteria 1573
265 Ga0496125_0000595 3300048928 Bacteria 61641
266 Ga0496125_0016728 3300048928 Bacteria 7033
267 Ga0496126_0006769 3300048929 Bacteria 12718
268 Ga0496126_0032266 3300048929 Bacteria 4935
269 Ga0496126_0081009 3300048929 Bacteria 2871
270 Ga0496126_0096597 3300048929 Bacteria 2590
271 Ga0496126_0113508 3300048929 Bacteria 2358
272 Ga0496126_0113703 3300048929 Bacteria 2356
273 Ga0496126_0264046 3300048929 Bacteria 1431
274 Ga0501032_0003836 3300049569 Bacteria 11418
275 Ga0501033_0017983 3300049570 Bacteria 5337
276 Ga0501033_0063051 3300049570 Bacteria 2729
277 Ga0501034_0014046 3300049571 Bacteria 8248
278 Ga0501034_0072804 3300049571 Bacteria 3445
279 Ga0501036_0020722 3300049572 Bacteria 5522
280 Ga0501037_0020020 3300049573 Bacteria 4940
281 Ga0501038_0046870 3300049574 Bacteria 3746
282 Ga0501039_0191876 3300049575 Bacteria 1606
283 Ga0501043_0006408 3300049579 Bacteria 9455
284 Ga0501046_0004930 3300049580 Bacteria 12008
285 Ga0501047_0061951 3300049581 Bacteria 3609
286 Ga0501047_0515843 3300049581 Bacteria 1021
287 Ga0501048_0103100 3300049582 Bacteria 2013
288 Ga0501067_0028724 3300049583 Bacteria 3082
289 Ga0501070_0121335 3300049586 Bacteria 2160
290 Ga0501073_0115404 3300049589 Bacteria 1861
291 Ga0501074_0077598 3300049590 Bacteria 2384
292 Ga0501080_0033508 3300049742 Bacteria 4794
293 Ga0501083_0148834 3300049744 Bacteria 1533
294 Ga0501035_0007549 3300049822 Bacteria 10162
295 Ga0501044_0018129 3300049823 Bacteria 7549
296 nmdc:mga05p37_47709_c1 3300050507 Bacteria 5267
297 Ga0495601_0053863 3300053077 Bacteria 2544
298 Ga0495612_0019488 3300053078 Bacteria 2716
299 Ga0495612_0049147 3300053078 Bacteria 1730
300 Ga0500635_0041084 3300053080 Bacteria 1545
301 Ga0495619_0081004 3300053085 Bacteria 2186
302 Ga0500647_0065610 3300053091 Bacteria 1746
303 Ga0500566_0008620 3300053094 Bacteria 6027
304 Ga0500566_0173084 3300053094 Bacteria 1114
305 Ga0500641_0091785 3300053096 Bacteria 1296
306 Ga0500554_005170 3300053102 Bacteria 2822
307 Ga0500595_005128 3300053119 Bacteria 5748
308 Ga0500658_0016145 3300053134 Bacteria 2780
309 Ga0500603_000894 3300053150 Bacteria 7080
310 Ga0500616_0000038 3300053153 Bacteria 386801
311 Ga0500616_0004848 3300053153 Bacteria 9392
312 Ga0500638_033694 3300053162 Bacteria 2476
313 Ga0500638_110766 3300053162 Bacteria 1268
314 Ga0500638_156443 3300053162 Bacteria 1008
315 Ga0500636_0012016 3300053177 Bacteria 5072
316 Ga0500636_0150925 3300053177 Bacteria 1276
317 Ga0500637_0000172 3300053178 Bacteria 24102
318 Ga0500637_0007964 3300053178 Bacteria 5321
319 Ga0500637_0031274 3300053178 Bacteria 2965
320 Ga0500661_000719 3300055283 Bacteria 6184
321 2922364533 2922361189 Bacteria 7436256
322 8006992655 8006984368 Bacteria 9651211
323 Ga0495622_0004071
324 JGI25406J46586_10010355
325 JGI25404J52841_10006551
326 Ga0070658_10156904
327 Ga0070683_100029226
328 Ga0070670_100075400
329 Ga0068869_100052543
330 Ga0070666_10000686
331 Ga0070661_100022011
332 Ga0070661_100309792
333 Ga0070668_100185678
334 Ga0070675_100277603
335 Ga0070674_100090970
336 Ga0070667_100221915
337 Ga0070713_100027426
338 Ga0070678_100002862
339 Ga0070678_100279579
340 Ga0070681_10010553
341 Ga0070681_10116046
342 Ga0070679_100010782
343 Ga0070679_100051194
344 Ga0070684_100006146
345 Ga0070684_100074214
346 Ga0068853_100002247
347 Ga0068853_100084410
348 Ga0070665_100475238
349 Ga0068855_100147390
350 Ga0068854_100169847
351 Ga0068856_100003436
352 Ga0068856_100167230
353 Ga0068856_100175538
354 Ga0068852_100040831
355 Ga0068852_100060087
356 Ga0068859_100272861
357 Ga0068864_100185351
358 Ga0068861_100432230
359 Ga0068858_100217005
360 Ga0068858_100385324
361 Ga0068860_100252623
362 Ga0068862_100144896
363 Ga0068862_100332877
364 Ga0081455_10007751
365 Ga0081455_10049210
366 Ga0081455_10154918
367 Ga0081455_10170723
368 Ga0081540_1002275
369 Ga0081540_1003256
370 Ga0081540_1005790
371 Ga0081540_1015306
372 Ga0081540_1024106
373 Ga0081540_1060308
374 Ga0081539_10001394
375 Ga0081539_10089319
376 Ga0075365_10039804
377 Ga0075364_10047455
378 Ga0070712_100123554
379 Ga0097621_100083837
380 Ga0068871_100079595
381 Ga0075428_100220908
382 Ga0075428_100306584
383 Ga0068865_100031007
384 Ga0097620_100272862
385 Ga0105240_10026834
386 Ga0105240_10094353
387 Ga0105240_10126917
388 Ga0105240_10147991
389 Ga0105247_10042593
390 Ga0105247_10157271
391 Ga0114129_10021026
392 Ga0105243_10360041
393 Ga0105248_10000001
394 Ga0105248_10864905
395 Ga0105237_10092641
396 Ga0105237_10579894
397 Ga0105238_10089475
398 Ga0105249_10302642
399 Ga0105239_10106057
400 Ga0105239_10358511
401 Ga0105246_10000812
402 Ga0105246_10035713
403 Ga0157370_10117175
404 Ga0157369_10005581
405 Ga0157369_10042419
406 Ga0163162_10837412
407 Ga0157372_10078034
408 Ga0157375_10528389
409 Ga0157380_10329138
410 Ga0163161_10411228
411 Ga0206353_11969449
412 Ga0207710_10063487
413 Ga0207654_10102499
414 Ga0207707_10002360
415 Ga0207695_10116633
416 Ga0207693_10092144
417 Ga0207693_10113495
418 Ga0207660_10062150
419 Ga0207657_10126875
420 Ga0207657_10139699
421 Ga0207652_10084520
422 Ga0207652_10174937
423 Ga0207694_10356392
424 Ga0207650_10114953
425 Ga0207700_10058846
426 Ga0207700_10271544
427 Ga0207709_10135693
428 Ga0207669_10184402
429 Ga0207704_10097534
430 Ga0207691_10086622
431 Ga0207691_10227750
432 Ga0207711_10000001
433 Ga0207661_10054902
434 Ga0207661_10120643
435 Ga0207667_10086709
436 Ga0207651_10008084
437 Ga0207712_10282269
438 Ga0207668_10037595
439 Ga0207658_10275067
440 Ga0207678_10054131
441 Ga0207678_10282323
442 Ga0207702_10000101
443 Ga0207702_10098226
444 Ga0207702_10124701
445 Ga0207702_10421584
446 Ga0207676_10184296
447 Ga0207674_10094915
448 Ga0207675_100509084
449 Ga0207683_10065809
450 Ga0207698_10088447
451 Ga0209588_1002374
452 Ga0268265_10085645
453 Ga0268264_10057918
454 Ga0307517_10084126
455 Ga0265332_10047870
456 Ga0307508_10001545
457 Ga0265314_10003805
458 Ga0265314_10013954
459 Ga0265314_10089657
460 Ga0265342_10007707
461 Ga0307516_10010638
462 Ga0307507_10159881
463 Ga0373944_0026553
464 Ga0373923_0008950
465 Ga0373923_0010631
466 Ga0373936_0003417
467 Ga0373945_0031494
468 Ga0373953_0062702
469 Ga0373954_0095858
470 Ga0373957_0021843
471 Ga0373943_0135310
472 Ga0373946_0055577
473 Ga0373946_0068296
474 Ga0373924_0042294
475 Ga0373935_0000128
476 Ga0373935_0028842
477 Ga0373927_0000496
478 Ga0373927_0056268
479 Ga0373927_0057339
480 Ga0373933_0035639
481 Ga0373947_0001955
482 Ga0373947_0046795
483 Ga0373937_0020378
484 Ga0373937_0070290
485 Ga0373925_0006551
486 Ga0373925_0157410
487 Ga0395900_0021332
488 Ga0395898_0021596
489 Ga0395898_0107991
490 Ga0395905_0305919
491 Ga0436364_0088187
492 Ga0395901_0002873
493 Ga0395901_0328658
494 Ga0436365_0173471
495 Ga0436365_0291695
496 Ga0466966_0114197
497 Ga0466957_0174437
498 Ga0466959_0019384
499 Ga0466967_0241889
500 Ga0495617_014085
501 Ga0495592_0020114
502 Ga0495592_0025246
503 Ga0495603_0000104
504 Ga0495603_0036176
505 Ga0495603_0081787
506 Ga0495603_0149049
507 Ga0495629_0006415
508 Ga0495629_0008475
509 Ga0495638_0082602
510 Ga0495641_0000402
511 Ga0495641_0136650
512 Ga0495651_0069504
513 Ga0495653_0127629
514 Ga0495580_0003617
515 Ga0495580_0035135
516 Ga0495582_0000063
517 Ga0495582_0048475
518 Ga0495639_0000224
519 Ga0495639_0014175
520 Ga0495639_0027127
521 Ga0495662_0000297
522 Ga0495664_0008319
523 Ga0495584_0233219
524 Ga0495584_0234702
525 Ga0495594_0001344
526 Ga0495594_0073230
527 Ga0495594_0109790
528 Ga0495596_0053329
529 Ga0495608_0130300
530 Ga0495610_0150149
531 Ga0495628_0019566
532 Ga0495628_0073206
533 Ga0495630_0003717
534 Ga0495648_0001804
535 Ga0495648_0013652
536 Ga0495666_0003431
537 Ga0495652_0111606
538 Ga0495652_0164674
539 Ga0495665_0000290
540 Ga0495665_0020154
541 Ga0495640_0005621
542 Ga0495586_0046760
543 Ga0495645_0083912
544 Ga0495622_0109280
545 Ga0495633_0105769
546 Ga0495667_0039095
547 Ga0495668_0237458
548 Ga0495668_0240126
549 Ga0495634_0000645
550 Ga0495634_0031148
551 Ga0495635_0007816
552 Ga0495599_0101318
553 Ga0495599_0248842
554 Ga0495647_0008159
555 Ga0495647_0023505
556 Ga0495658_0000702
557 Ga0495658_0010450
558 Ga0495613_0000449
559 Ga0495624_0000224
560 Ga0495624_0026428
561 Ga0495671_0092867
562 Ga0495600_0239213
563 Ga0495581_0000168
564 Ga0495581_0068429
565 Ga0495581_0170397
566 Ga0495604_0079624
567 Ga0495636_0171045
568 Ga0495674_0005032
569 Ga0495672_0033619
570 Ga0495676_0011951
571 Ga0495676_0031024
572 Ga0495684_0017497
573 Ga0495684_0202497
574 Ga0495684_0212511
575 Ga0495684_0281609
576 Ga0495593_0000150
577 Ga0495593_0084122
578 Ga0495614_0021011
579 Ga0495614_0033944
580 Ga0496100_0226838
581 Ga0496101_0327235
582 Ga0496109_0183506
583 Ga0496121_0000154
584 Ga0496121_0000596
585 Ga0496121_0012048
586 Ga0496122_0133229
587 Ga0496125_0000595
588 Ga0496125_0016728
589 Ga0496126_0006769
590 Ga0496126_0032266
591 Ga0496126_0081009
592 Ga0496126_0096597
593 Ga0496126_0113508
594 Ga0496126_0113703
595 Ga0496126_0264046
596 Ga0501032_0003836
597 Ga0501033_0017983
598 Ga0501033_0063051
599 Ga0501034_0014046
600 Ga0501034_0072804
601 Ga0501036_0020722
602 Ga0501037_0020020
603 Ga0501038_0046870
604 Ga0501039_0191876
605 Ga0501043_0006408
606 Ga0501046_0004930
607 Ga0501047_0061951
608 Ga0501047_0515843
609 Ga0501048_0103100
610 Ga0501067_0028724
611 Ga0501070_0121335
612 Ga0501073_0115404
613 Ga0501074_0077598
614 Ga0501080_0033508
615 Ga0501083_0148834
616 Ga0501035_0007549
617 Ga0501044_0018129
618 nmdc:mga05p37_47709_c1
619 Ga0495601_0053863
620 Ga0495612_0019488
621 Ga0495612_0049147
622 Ga0500635_0041084
623 Ga0495619_0081004
624 Ga0500647_0065610
625 Ga0500566_0008620
626 Ga0500566_0173084
627 Ga0500641_0091785
628 Ga0500554_005170
629 Ga0500595_005128
630 Ga0500658_0016145
631 Ga0500603_000894
632 Ga0500616_0000038
633 Ga0500616_0004848
634 Ga0500638_033694
635 Ga0500638_110766
636 Ga0500638_156443
637 Ga0500636_0012016
638 Ga0500636_0150925
639 Ga0500637_0000172
640 Ga0500637_0007964
641 Ga0500637_0031274
642 Ga0500661_000719
643 2922364533
644 8006992655

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

23

202

0.96

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

225

322

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqq-assembly1.cif.gz_A structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii 0.9077 1 310
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9051 3 310
3tqq-assembly1.cif.gz_A structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii 0.9048 1 310
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.8969 3 310
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.8947 3 310
ID Description Score Start End Superfamily
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9649 3 207 3.40.50.170
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9551 3 207 3.40.50.170
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9354 5 207 3.40.50.170
af_B4FRN6_28_246_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9294 1 207 3.40.50.170
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9135 5 207 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A8A8PN39-F1-model_v4 deleted 0.9611 203 310
AF-A0A376FF32-F1-model_v4 Methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9588 1 208 GO:0004479
GO:0005829
AF-A0A382L434-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9565 23 204 GO:0004479
GO:0005829
AF-A0A7Y2FY03-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9547 8 204 GO:0004479
GO:0005829
AF-A0A2V7K666-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9526 4 126 GO:0004479
GO:0005829

Map