F406574

General Info

Members Datasets Scaffolds Average Seq Length
322 178 644 144

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0381913|Ga0495592_0381913_374_859
Length 161
Sequence MTMSTREAFERGTDTFNAHDIDGFAEVLADEVVFEAPGGMRGEGKEACAGFYGSWFAAFPDAHVDVHSVHIIDDVAVEEGTFTGTHDGVLHAPTGDIPPTGRPVKLDYIQVLRFRDGKHASFHLIFDRLEMLEQLGLIPAPPTASASPVARAEGESGSPVA

Samples

Sample ID Description Type Environment
1 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 16.46
Rhizosphere 76.71
Stem 0
Stem Tuber 0
Unclassified 22.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495592_0381913 3300046454 Unclassified 896
2 JGI24752J21851_1053889 3300001976 Unclassified 549
3 Ga0065712_10070103 3300005290 Bacteria 6322
4 Ga0065715_10000211 3300005293 Bacteria 37064
5 Ga0070683_100700545 3300005329 Bacteria 970
6 Ga0070670_100024504 3300005331 Bacteria 5189
7 Ga0068869_100526213 3300005334 Bacteria 990
8 Ga0070689_100744010 3300005340 Bacteria 859
9 Ga0070687_100263066 3300005343 Bacteria 1078
10 Ga0070687_101392469 3300005343 Unclassified 524
11 Ga0070675_100037945 3300005354 Bacteria 3926
12 Ga0070671_100446947 3300005355 Bacteria 1109
13 Ga0070673_100145996 3300005364 Bacteria 2000
14 Ga0070688_100806619 3300005365 Bacteria 734
15 Ga0070659_100213085 3300005366 Bacteria 1592
16 Ga0070667_100593378 3300005367 Unclassified 1020
17 Ga0070709_10000218 3300005434 Bacteria 37188
18 Ga0070714_100173578 3300005435 Bacteria 1958
19 Ga0070714_100211526 3300005435 Bacteria 1778
20 Ga0070714_100645336 3300005435 Bacteria 1019
21 Ga0070714_100769909 3300005435 Bacteria 931
22 Ga0070713_100002009 3300005436 Bacteria 13137
23 Ga0070713_100117911 3300005436 Unclassified 2323
24 Ga0070713_100464441 3300005436 Bacteria 1190
25 Ga0070713_100782343 3300005436 Unclassified 914
26 Ga0070710_10136934 3300005437 Bacteria 1498
27 Ga0070701_10180503 3300005438 Bacteria 1235
28 Ga0070701_10524043 3300005438 Unclassified 773
29 Ga0070694_100853313 3300005444 Bacteria 749
30 Ga0070678_100216382 3300005456 Bacteria 1590
31 Ga0070678_100632771 3300005456 Bacteria 958
32 Ga0070662_100163809 3300005457 Bacteria 1741
33 Ga0068867_100035013 3300005459 Bacteria 3640
34 Ga0070685_10020578 3300005466 Bacteria 3571
35 Ga0070672_100300914 3300005543 Bacteria 1360
36 Ga0070686_100564326 3300005544 Unclassified 892
37 Ga0070696_100799539 3300005546 Bacteria 776
38 Ga0070665_100838876 3300005548 Bacteria 932
39 Ga0070665_101524468 3300005548 Unclassified 677
40 Ga0070704_101052673 3300005549 Bacteria 737
41 Ga0068855_102267153 3300005563 Unclassified 544
42 Ga0070664_102097405 3300005564 Unclassified 536
43 Ga0070664_102343061 3300005564 Unclassified 506
44 Ga0068854_100064143 3300005578 Bacteria 2669
45 Ga0068856_100072103 3300005614 Bacteria 3420
46 Ga0068856_100168882 3300005614 Bacteria 2199
47 Ga0068856_101174713 3300005614 Unclassified 784
48 Ga0070702_100107635 3300005615 Bacteria 1722
49 Ga0068852_100418804 3300005616 Bacteria 1321
50 Ga0068852_100533101 3300005616 Bacteria 1173
51 Ga0068864_100001127 3300005618 Bacteria 22319
52 Ga0068864_100097795 3300005618 Unclassified 2599
53 Ga0068861_102577995 3300005719 Unclassified 512
54 Ga0068870_10570391 3300005840 Bacteria 765
55 Ga0068863_100794029 3300005841 Unclassified 944
56 Ga0068863_100991669 3300005841 Bacteria 842
57 Ga0068858_100463652 3300005842 Bacteria 1222
58 Ga0068860_100421467 3300005843 Bacteria 1323
59 Ga0068862_100134023 3300005844 Bacteria 2194
60 Ga0081455_10726686 3300005937 Unclassified 630
61 Ga0081540_1001285 3300005983 Bacteria 21919
62 Ga0070717_10328115 3300006028 Bacteria 1365
63 Ga0070717_10344363 3300006028 Bacteria 1331
64 Ga0070717_10607088 3300006028 Bacteria 992
65 Ga0070715_10349215 3300006163 Bacteria 807
66 Ga0070716_100031929 3300006173 Bacteria 2868
67 Ga0070716_100148874 3300006173 Bacteria 1503
68 Ga0070712_100012217 3300006175 Bacteria 5458
69 Ga0070712_101344894 3300006175 Unclassified 623
70 Ga0068871_100533170 3300006358 Bacteria 1061
71 Ga0075434_100688598 3300006871 Unclassified 1040
72 Ga0068865_100161092 3300006881 Bacteria 1711
73 Ga0068865_100614159 3300006881 Bacteria 920
74 Ga0075435_100363161 3300007076 Bacteria 1242
75 Ga0105251_10159703 3300009011 Bacteria 1016
76 Ga0111539_10117238 3300009094 Bacteria 3121
77 Ga0105245_10085427 3300009098 Bacteria 2892
78 Ga0105243_10040267 3300009148 Bacteria 3647
79 Ga0105243_10073613 3300009148 Bacteria 2768
80 Ga0105243_10081610 3300009148 Bacteria 2641
81 Ga0105243_11169114 3300009148 Bacteria 781
82 Ga0105241_10275823 3300009174 Bacteria 1434
83 Ga0105248_10004918 3300009177 Bacteria 14760
84 Ga0105238_10843568 3300009551 Bacteria 933
85 Ga0105249_10027461 3300009553 Bacteria 5135
86 Ga0105249_11558808 3300009553 Bacteria 733
87 Ga0105239_10073786 3300010375 Bacteria 3751
88 Ga0105239_10321945 3300010375 Bacteria 1743
89 Ga0105239_10662017 3300010375 Bacteria 1193
90 Ga0105239_13210749 3300010375 Unclassified 532
91 Ga0105246_10263377 3300011119 Unclassified 1374
92 Ga0105246_10577856 3300011119 Unclassified 967
93 Ga0157374_10207308 3300013296 Bacteria 1921
94 Ga0157374_11470783 3300013296 Bacteria 704
95 Ga0163162_10053804 3300013306 Bacteria 4046
96 Ga0163162_11005540 3300013306 Bacteria 943
97 Ga0157375_10132994 3300013308 Plasmid 2608
98 Ga0163163_10016353 3300014325 Bacteria 6890
99 Ga0163163_10252623 3300014325 Unclassified 1814
100 Ga0182008_10347710 3300014497 Bacteria 786
101 Ga0157377_10280640 3300014745 Bacteria 1092
102 Ga0157376_10131548 3300014969 Bacteria 2233
103 Ga0157376_10378515 3300014969 Bacteria 1363
104 Ga0206356_11807111 3300020070 Bacteria 1837
105 Ga0206354_10038879 3300020081 Bacteria 547
106 Ga0206353_11189269 3300020082 Unclassified 851
107 Ga0213876_10007431 3300021384 Bacteria 5958
108 Ga0213876_10026847 3300021384 Bacteria 3038
109 Ga0213876_10219073 3300021384 Bacteria 1012
110 Ga0213876_10357877 3300021384 Unclassified 776
111 Ga0207697_10110867 3300025315 Bacteria 1175
112 Ga0207692_10145803 3300025898 Unclassified 1351
113 Ga0207642_10394927 3300025899 Bacteria 826
114 Ga0207685_10336245 3300025905 Bacteria 757
115 Ga0207699_10000077 3300025906 Bacteria 78246
116 Ga0207699_11170300 3300025906 Bacteria 569
117 Ga0207693_10427823 3300025915 Bacteria 1035
118 Ga0207663_10066492 3300025916 Bacteria 2308
119 Ga0207663_11392259 3300025916 Bacteria 565
120 Ga0207662_10214868 3300025918 Bacteria 1250
121 Ga0207681_10530066 3300025923 Unclassified 967
122 Ga0207694_10742314 3300025924 Bacteria 828
123 Ga0207650_10016334 3300025925 Bacteria 5188
124 Ga0207659_10014958 3300025926 Bacteria 5017
125 Ga0207687_10043498 3300025927 Bacteria 3095
126 Ga0207700_10000661 3300025928 Bacteria 20160
127 Ga0207700_10222160 3300025928 Bacteria 1602
128 Ga0207700_10236751 3300025928 Unclassified 1555
129 Ga0207664_10078629 3300025929 Bacteria 2675
130 Ga0207664_10209104 3300025929 Bacteria 1687
131 Ga0207690_10575344 3300025932 Bacteria 918
132 Ga0207706_10193904 3300025933 Bacteria 1782
133 Ga0207706_10620638 3300025933 Unclassified 927
134 Ga0207709_10046742 3300025935 Bacteria 2628
135 Ga0207670_10943004 3300025936 Bacteria 724
136 Ga0207669_10308430 3300025937 Bacteria 1206
137 Ga0207704_10523467 3300025938 Unclassified 959
138 Ga0207665_10042333 3300025939 Bacteria 3044
139 Ga0207665_10454840 3300025939 Unclassified 983
140 Ga0207691_10125597 3300025940 Bacteria 2270
141 Ga0207711_10063963 3300025941 Bacteria 3177
142 Ga0207661_11193321 3300025944 Bacteria 700
143 Ga0207679_11142136 3300025945 Bacteria 715
144 Ga0207712_10419503 3300025961 Bacteria 1129
145 Ga0207640_10727579 3300025981 Bacteria 853
146 Ga0207677_10329413 3300026023 Bacteria 1272
147 Ga0207708_10072483 3300026075 Bacteria 2639
148 Ga0207702_10048068 3300026078 Bacteria 3597
149 Ga0207702_11508697 3300026078 Bacteria 666
150 Ga0207641_10157781 3300026088 Bacteria 2060
151 Ga0207641_10658948 3300026088 Bacteria 1029
152 Ga0207648_10039226 3300026089 Bacteria 4164
153 Ga0207648_10142929 3300026089 Bacteria 2110
154 Ga0207676_10009260 3300026095 Bacteria 7006
155 Ga0207676_10051668 3300026095 Unclassified 3210
156 Ga0207676_10408468 3300026095 Bacteria 1271
157 Ga0207675_100676271 3300026118 Bacteria 1040
158 Ga0207683_10074185 3300026121 Bacteria 3010
159 Ga0207698_10057993 3300026142 Bacteria 2998
160 Ga0207698_11345121 3300026142 Unclassified 729
161 Ga0268266_10016328 3300028379 Bacteria 6347
162 Ga0268265_10047776 3300028380 Bacteria 3209
163 Ga0373957_0186406 3300035120 Unclassified 861
164 Ga0373937_0016141 3300036401 Bacteria 6625
165 Ga0436364_0167045 3300037853 Unclassified 886
166 Ga0436364_0204504 3300037853 Unclassified 1382
167 Ga0436364_0307695 3300037853 Unclassified 1211
168 Ga0436364_0471166 3300037853 Bacteria 1621
169 Ga0395901_0679854 3300038443 Bacteria 1029
170 Ga0436365_0223221 3300039437 Bacteria 10202
171 Ga0436365_0593075 3300039437 Bacteria 3143
172 Ga0436365_0834326 3300039437 Unclassified 849
173 Ga0436365_1083798 3300039437 Bacteria 866
174 Ga0436365_1136970 3300039437 Unclassified 751
175 Ga0436365_1246897 3300039437 Bacteria 947
176 Ga0436365_1603077 3300039437 Bacteria 1218
177 Ga0436365_1683968 3300039437 Unclassified 2475
178 Ga0436365_1788154 3300039437 Bacteria 22043
179 Ga0436363_0094230 3300039450 Unclassified 601
180 Ga0436363_0637168 3300039450 Bacteria 10374
181 Ga0436363_0849083 3300039450 Unclassified 1047
182 Ga0436363_1078684 3300039450 Unclassified 580
183 Ga0436363_1440869 3300039450 Bacteria 1624
184 Ga0436362_0070292 3300039453 Bacteria 847
185 Ga0436362_0522025 3300039453 Bacteria 2155
186 Ga0436362_0543810 3300039453 Unclassified 791
187 Ga0436362_1181565 3300039453 Unclassified 811
188 Ga0436362_1301785 3300039453 Bacteria 1551
189 Ga0466972_0288665 3300044658 Unclassified 767
190 Ga0466965_0035487 3300044683 Bacteria 2443
191 Ga0466966_0015795 3300044684 Bacteria 4990
192 Ga0466961_0002474 3300044693 Bacteria 11458
193 Ga0466963_0000578 3300044694 Bacteria 17370
194 Ga0466963_0218826 3300044694 Bacteria 1334
195 Ga0466963_0307970 3300044694 Bacteria 1114
196 Ga0466963_0425207 3300044694 Unclassified 937
197 Ga0466963_0657295 3300044694 Bacteria 740
198 Ga0466964_0487864 3300044706 Bacteria 660
199 Ga0466971_0011908 3300044719 Unclassified 3811
200 Ga0466971_0019881 3300044719 Bacteria 2983
201 Ga0466971_0131325 3300044719 Bacteria 1163
202 Ga0466968_0198072 3300044735 Bacteria 940
203 Ga0466968_0306749 3300044735 Unclassified 764
204 Ga0466970_0055336 3300044765 Unclassified 2119
205 Ga0466957_0008417 3300044842 Bacteria 5867
206 Ga0466957_0055260 3300044842 Bacteria 2426
207 Ga0466957_0219270 3300044842 Unclassified 1255
208 Ga0466959_0076140 3300045049 Unclassified 2423
209 Ga0466959_0211270 3300045049 Bacteria 1348
210 Ga0466959_0303357 3300045049 Bacteria 1093
211 Ga0466959_0514273 3300045049 Unclassified 809
212 Ga0466958_0023616 3300045836 Bacteria 3612
213 Ga0466958_0035701 3300045836 Bacteria 2970
214 Ga0466958_0052616 3300045836 Unclassified 2468
215 Ga0466958_0060516 3300045836 Bacteria 2305
216 Ga0466958_0067548 3300045836 Bacteria 2184
217 Ga0466958_0164086 3300045836 Bacteria 1405
218 Ga0466958_0176929 3300045836 Unclassified 1353
219 Ga0466958_0796728 3300045836 Bacteria 616
220 Ga0466967_0013676 3300045976 Bacteria 6285
221 Ga0466967_0051282 3300045976 Unclassified 3615
222 Ga0466967_0055903 3300045976 Unclassified 3478
223 Ga0466967_0409085 3300045976 Bacteria 1321
224 Ga0466967_0810909 3300045976 Bacteria 929
225 Ga0495592_0266532 3300046454 Bacteria 1125
226 Ga0495651_0015537 3300046462 Bacteria 5890
227 Ga0495653_0043395 3300046463 Bacteria 3496
228 Ga0495653_0146717 3300046463 Bacteria 1652
229 Ga0495664_0241431 3300046477 Bacteria 1093
230 Ga0495594_0636028 3300046499 Bacteria 604
231 Ga0495608_0010549 3300046511 Bacteria 6445
232 Ga0495618_0428268 3300046514 Unclassified 806
233 Ga0495628_0028742 3300046516 Bacteria 4515
234 Ga0495628_0165766 3300046516 Unclassified 1677
235 Ga0495652_0014681 3300046529 Bacteria 7023
236 Ga0495640_0122941 3300046533 Bacteria 1685
237 Ga0495640_0599135 3300046533 Unclassified 666
238 Ga0495587_0077963 3300046536 Bacteria 1923
239 Ga0495645_0216069 3300046543 Unclassified 1292
240 Ga0495667_0008562 3300046559 Bacteria 6944
241 Ga0495667_0292895 3300046559 Bacteria 1032
242 Ga0495667_0515767 3300046559 Unclassified 748
243 Ga0495634_0292532 3300046642 Bacteria 986
244 Ga0495634_0384708 3300046642 Bacteria 836
245 Ga0495635_0064644 3300046663 Bacteria 2511
246 Ga0495635_0263156 3300046663 Bacteria 1161
247 Ga0495657_0008649 3300046675 Bacteria 7768
248 Ga0495646_0041969 3300046680 Bacteria 2809
249 Ga0495646_0210271 3300046680 Bacteria 1056
250 Ga0495658_0753332 3300046683 Bacteria 624
251 Ga0495613_0180652 3300046689 Bacteria 1494
252 Ga0495581_0669220 3300047315 Unclassified 599
253 Ga0495604_0012058 3300047317 Bacteria 6872
254 Ga0495674_0192310 3300047319 Unclassified 1695
255 Ga0495674_0251695 3300047319 Bacteria 1454
256 Ga0495674_0737384 3300047319 Unclassified 771
257 Ga0495675_0094922 3300047444 Bacteria 1870
258 Ga0495684_0016576 3300047471 Bacteria 5676
259 Ga0495602_0007774 3300048088 Bacteria 11206
260 Ga0495602_0186996 3300048088 Bacteria 1592
261 Ga0496100_0448761 3300048903 Bacteria 988
262 Ga0496100_0616371 3300048903 Bacteria 843
263 Ga0496101_0070659 3300048904 Bacteria 2557
264 Ga0496101_0312891 3300048904 Bacteria 1231
265 Ga0496101_0475631 3300048904 Bacteria 986
266 Ga0496101_0908787 3300048904 Unclassified 693
267 Ga0496102_0046290 3300048905 Bacteria 3951
268 Ga0496102_0403047 3300048905 Bacteria 1286
269 Ga0496102_0713766 3300048905 Bacteria 925
270 Ga0496102_1696397 3300048905 Bacteria 550
271 Ga0496103_0247480 3300048906 Bacteria 1147
272 Ga0496104_0062433 3300048907 Bacteria 3532
273 Ga0496104_0067347 3300048907 Plasmid 3401
274 Ga0496104_0071220 3300048907 Unclassified 3305
275 Ga0496104_0102746 3300048907 Bacteria 2738
276 Ga0496104_0943893 3300048907 Unclassified 767
277 Ga0496105_0033936 3300048908 Bacteria 4195
278 Ga0496105_0099789 3300048908 Bacteria 2398
279 Ga0496105_0157633 3300048908 Unclassified 1864
280 Ga0496105_0849017 3300048908 Bacteria 691
281 Ga0496106_0006793 3300048909 Bacteria 8471
282 Ga0496106_0633298 3300048909 Bacteria 855
283 Ga0496107_0045556 3300048910 Bacteria 3155
284 Ga0496107_0169741 3300048910 Bacteria 1618
285 Ga0496108_0004158 3300048911 Bacteria 11645
286 Ga0496108_0012794 3300048911 Bacteria 6832
287 Ga0496108_0029510 3300048911 Plasmid 4543
288 Ga0496109_0004890 3300048912 Bacteria 11190
289 Ga0496109_0008364 3300048912 Bacteria 8791
290 Ga0496109_0049577 3300048912 Bacteria 3823
291 Ga0496109_0150707 3300048912 Unclassified 2177
292 Ga0496109_0166393 3300048912 Bacteria 2067
293 Ga0496110_0005541 3300048913 Bacteria 9911
294 Ga0496110_0050511 3300048913 Bacteria 3651
295 Ga0496110_0051942 3300048913 Bacteria 3602
296 Ga0496110_0178209 3300048913 Unclassified 1929
297 Ga0496110_0480169 3300048913 Bacteria 1132
298 Ga0496111_0011555 3300048914 Bacteria 5954
299 Ga0496111_0052465 3300048914 Bacteria 2945
300 Ga0496111_0197585 3300048914 Bacteria 1495
301 Ga0496111_0205266 3300048914 Bacteria 1464
302 Ga0496111_0210951 3300048914 Bacteria 1442
303 Ga0496112_0016353 3300048915 Bacteria 6947
304 Ga0496112_0042096 3300048915 Bacteria 4469
305 Ga0496112_0213059 3300048915 Bacteria 1889
306 Ga0496112_0502091 3300048915 Bacteria 1148
307 Ga0496112_0554040 3300048915 Bacteria 1083
308 Ga0496113_0018567 3300048916 Bacteria 4846
309 Ga0496113_0037993 3300048916 Bacteria 3537
310 Ga0496113_0095136 3300048916 Unclassified 2302
311 Ga0496113_0096048 3300048916 Bacteria 2291
312 Ga0496115_0196716 3300048918 Bacteria 1666
313 Ga0496115_0393852 3300048918 Bacteria 1125
314 nmdc:mga08y16_100860_c1 3300050511 Bacteria 3005
315 Ga0495601_0486246 3300053077 Unclassified 797
316 Ga0495612_0029967 3300053078 Unclassified 2192
317 Ga0495595_0005826 3300053084 Bacteria 4990
318 Ga0495595_0011303 3300053084 Bacteria 3729
319 Ga0495619_0015281 3300053085 Bacteria 4855
320 Ga0495619_0026142 3300053085 Bacteria 3754
321 Ga0466962_0003456 3300061719 Bacteria 7532
322 Ga0466962_0018507 3300061719 Bacteria 3351
323 Ga0495592_0381913
324 JGI24752J21851_1053889
325 Ga0065712_10070103
326 Ga0065715_10000211
327 Ga0070683_100700545
328 Ga0070670_100024504
329 Ga0068869_100526213
330 Ga0070689_100744010
331 Ga0070687_100263066
332 Ga0070687_101392469
333 Ga0070675_100037945
334 Ga0070671_100446947
335 Ga0070673_100145996
336 Ga0070688_100806619
337 Ga0070659_100213085
338 Ga0070667_100593378
339 Ga0070709_10000218
340 Ga0070714_100173578
341 Ga0070714_100211526
342 Ga0070714_100645336
343 Ga0070714_100769909
344 Ga0070713_100002009
345 Ga0070713_100117911
346 Ga0070713_100464441
347 Ga0070713_100782343
348 Ga0070710_10136934
349 Ga0070701_10180503
350 Ga0070701_10524043
351 Ga0070694_100853313
352 Ga0070678_100216382
353 Ga0070678_100632771
354 Ga0070662_100163809
355 Ga0068867_100035013
356 Ga0070685_10020578
357 Ga0070672_100300914
358 Ga0070686_100564326
359 Ga0070696_100799539
360 Ga0070665_100838876
361 Ga0070665_101524468
362 Ga0070704_101052673
363 Ga0068855_102267153
364 Ga0070664_102097405
365 Ga0070664_102343061
366 Ga0068854_100064143
367 Ga0068856_100072103
368 Ga0068856_100168882
369 Ga0068856_101174713
370 Ga0070702_100107635
371 Ga0068852_100418804
372 Ga0068852_100533101
373 Ga0068864_100001127
374 Ga0068864_100097795
375 Ga0068861_102577995
376 Ga0068870_10570391
377 Ga0068863_100794029
378 Ga0068863_100991669
379 Ga0068858_100463652
380 Ga0068860_100421467
381 Ga0068862_100134023
382 Ga0081455_10726686
383 Ga0081540_1001285
384 Ga0070717_10328115
385 Ga0070717_10344363
386 Ga0070717_10607088
387 Ga0070715_10349215
388 Ga0070716_100031929
389 Ga0070716_100148874
390 Ga0070712_100012217
391 Ga0070712_101344894
392 Ga0068871_100533170
393 Ga0075434_100688598
394 Ga0068865_100161092
395 Ga0068865_100614159
396 Ga0075435_100363161
397 Ga0105251_10159703
398 Ga0111539_10117238
399 Ga0105245_10085427
400 Ga0105243_10040267
401 Ga0105243_10073613
402 Ga0105243_10081610
403 Ga0105243_11169114
404 Ga0105241_10275823
405 Ga0105248_10004918
406 Ga0105238_10843568
407 Ga0105249_10027461
408 Ga0105249_11558808
409 Ga0105239_10073786
410 Ga0105239_10321945
411 Ga0105239_10662017
412 Ga0105239_13210749
413 Ga0105246_10263377
414 Ga0105246_10577856
415 Ga0157374_10207308
416 Ga0157374_11470783
417 Ga0163162_10053804
418 Ga0163162_11005540
419 Ga0157375_10132994
420 Ga0163163_10016353
421 Ga0163163_10252623
422 Ga0182008_10347710
423 Ga0157377_10280640
424 Ga0157376_10131548
425 Ga0157376_10378515
426 Ga0206356_11807111
427 Ga0206354_10038879
428 Ga0206353_11189269
429 Ga0213876_10007431
430 Ga0213876_10026847
431 Ga0213876_10219073
432 Ga0213876_10357877
433 Ga0207697_10110867
434 Ga0207692_10145803
435 Ga0207642_10394927
436 Ga0207685_10336245
437 Ga0207699_10000077
438 Ga0207699_11170300
439 Ga0207693_10427823
440 Ga0207663_10066492
441 Ga0207663_11392259
442 Ga0207662_10214868
443 Ga0207681_10530066
444 Ga0207694_10742314
445 Ga0207650_10016334
446 Ga0207659_10014958
447 Ga0207687_10043498
448 Ga0207700_10000661
449 Ga0207700_10222160
450 Ga0207700_10236751
451 Ga0207664_10078629
452 Ga0207664_10209104
453 Ga0207690_10575344
454 Ga0207706_10193904
455 Ga0207706_10620638
456 Ga0207709_10046742
457 Ga0207670_10943004
458 Ga0207669_10308430
459 Ga0207704_10523467
460 Ga0207665_10042333
461 Ga0207665_10454840
462 Ga0207691_10125597
463 Ga0207711_10063963
464 Ga0207661_11193321
465 Ga0207679_11142136
466 Ga0207712_10419503
467 Ga0207640_10727579
468 Ga0207677_10329413
469 Ga0207708_10072483
470 Ga0207702_10048068
471 Ga0207702_11508697
472 Ga0207641_10157781
473 Ga0207641_10658948
474 Ga0207648_10039226
475 Ga0207648_10142929
476 Ga0207676_10009260
477 Ga0207676_10051668
478 Ga0207676_10408468
479 Ga0207675_100676271
480 Ga0207683_10074185
481 Ga0207698_10057993
482 Ga0207698_11345121
483 Ga0268266_10016328
484 Ga0268265_10047776
485 Ga0373957_0186406
486 Ga0373937_0016141
487 Ga0436364_0167045
488 Ga0436364_0204504
489 Ga0436364_0307695
490 Ga0436364_0471166
491 Ga0395901_0679854
492 Ga0436365_0223221
493 Ga0436365_0593075
494 Ga0436365_0834326
495 Ga0436365_1083798
496 Ga0436365_1136970
497 Ga0436365_1246897
498 Ga0436365_1603077
499 Ga0436365_1683968
500 Ga0436365_1788154
501 Ga0436363_0094230
502 Ga0436363_0637168
503 Ga0436363_0849083
504 Ga0436363_1078684
505 Ga0436363_1440869
506 Ga0436362_0070292
507 Ga0436362_0522025
508 Ga0436362_0543810
509 Ga0436362_1181565
510 Ga0436362_1301785
511 Ga0466972_0288665
512 Ga0466965_0035487
513 Ga0466966_0015795
514 Ga0466961_0002474
515 Ga0466963_0000578
516 Ga0466963_0218826
517 Ga0466963_0307970
518 Ga0466963_0425207
519 Ga0466963_0657295
520 Ga0466964_0487864
521 Ga0466971_0011908
522 Ga0466971_0019881
523 Ga0466971_0131325
524 Ga0466968_0198072
525 Ga0466968_0306749
526 Ga0466970_0055336
527 Ga0466957_0008417
528 Ga0466957_0055260
529 Ga0466957_0219270
530 Ga0466959_0076140
531 Ga0466959_0211270
532 Ga0466959_0303357
533 Ga0466959_0514273
534 Ga0466958_0023616
535 Ga0466958_0035701
536 Ga0466958_0052616
537 Ga0466958_0060516
538 Ga0466958_0067548
539 Ga0466958_0164086
540 Ga0466958_0176929
541 Ga0466958_0796728
542 Ga0466967_0013676
543 Ga0466967_0051282
544 Ga0466967_0055903
545 Ga0466967_0409085
546 Ga0466967_0810909
547 Ga0495592_0266532
548 Ga0495651_0015537
549 Ga0495653_0043395
550 Ga0495653_0146717
551 Ga0495664_0241431
552 Ga0495594_0636028
553 Ga0495608_0010549
554 Ga0495618_0428268
555 Ga0495628_0028742
556 Ga0495628_0165766
557 Ga0495652_0014681
558 Ga0495640_0122941
559 Ga0495640_0599135
560 Ga0495587_0077963
561 Ga0495645_0216069
562 Ga0495667_0008562
563 Ga0495667_0292895
564 Ga0495667_0515767
565 Ga0495634_0292532
566 Ga0495634_0384708
567 Ga0495635_0064644
568 Ga0495635_0263156
569 Ga0495657_0008649
570 Ga0495646_0041969
571 Ga0495646_0210271
572 Ga0495658_0753332
573 Ga0495613_0180652
574 Ga0495581_0669220
575 Ga0495604_0012058
576 Ga0495674_0192310
577 Ga0495674_0251695
578 Ga0495674_0737384
579 Ga0495675_0094922
580 Ga0495684_0016576
581 Ga0495602_0007774
582 Ga0495602_0186996
583 Ga0496100_0448761
584 Ga0496100_0616371
585 Ga0496101_0070659
586 Ga0496101_0312891
587 Ga0496101_0475631
588 Ga0496101_0908787
589 Ga0496102_0046290
590 Ga0496102_0403047
591 Ga0496102_0713766
592 Ga0496102_1696397
593 Ga0496103_0247480
594 Ga0496104_0062433
595 Ga0496104_0067347
596 Ga0496104_0071220
597 Ga0496104_0102746
598 Ga0496104_0943893
599 Ga0496105_0033936
600 Ga0496105_0099789
601 Ga0496105_0157633
602 Ga0496105_0849017
603 Ga0496106_0006793
604 Ga0496106_0633298
605 Ga0496107_0045556
606 Ga0496107_0169741
607 Ga0496108_0004158
608 Ga0496108_0012794
609 Ga0496108_0029510
610 Ga0496109_0004890
611 Ga0496109_0008364
612 Ga0496109_0049577
613 Ga0496109_0150707
614 Ga0496109_0166393
615 Ga0496110_0005541
616 Ga0496110_0050511
617 Ga0496110_0051942
618 Ga0496110_0178209
619 Ga0496110_0480169
620 Ga0496111_0011555
621 Ga0496111_0052465
622 Ga0496111_0197585
623 Ga0496111_0205266
624 Ga0496111_0210951
625 Ga0496112_0016353
626 Ga0496112_0042096
627 Ga0496112_0213059
628 Ga0496112_0502091
629 Ga0496112_0554040
630 Ga0496113_0018567
631 Ga0496113_0037993
632 Ga0496113_0095136
633 Ga0496113_0096048
634 Ga0496115_0196716
635 Ga0496115_0393852
636 nmdc:mga08y16_100860_c1
637 Ga0495601_0486246
638 Ga0495612_0029967
639 Ga0495595_0005826
640 Ga0495595_0011303
641 Ga0495619_0015281
642 Ga0495619_0026142
643 Ga0466962_0003456
644 Ga0466962_0018507

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

9

122

0.95

PF07366

SnoaL

SnoaL-like polyketide cyclase

6

135

0.94

PF14534

DUF4440

Domain of unknown function (DUF4440)

5

120

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f40-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function (yp_677363.1) from cytophaga hutchinsonii atcc 33406 at 1.27 a resolution 0.9094 1 131
4lmi-assembly1.cif.gz_A crystal structure of putative ketosteroid isomerase from kribbella flavida dsm 17836 0.9047 3 125
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.9015 5 128
3ov4-assembly2.cif.gz_C crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin 0.8913 5 128
5aig-assembly2.cif.gz_B discovery and characterization of thermophilic limonene-1,2-epoxide hydrolases from hot spring metagenomic libraries. tomsk-sample- valpromide complex 0.8877 1 132
ID Description Score Start End Superfamily
4lmiA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9047 3 125 3.10.450.50
5aigB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8879 1 132 3.10.450.50
af_Q10083_1_118_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8838 4 125 3.10.450.50
5cxoA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8815 3 128 3.10.450.50
3f40A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8809 2 131 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A535M8X2-F1-model_v4 Ester cyclase 0.9921 1 141 GO:0030638
AF-A0A535M6I8-F1-model_v4 Ester cyclase 0.9885 3 141 GO:0030638
AF-A0A535M8X2-F1-model_v4 Ester cyclase 0.9852 1 141 GO:0030638
AF-A0A535U5Q9-F1-model_v4 Ester cyclase 0.9843 15 141 GO:0030638
AF-A0A538L3D2-F1-model_v4 Ester cyclase 0.9838 1 141 GO:0030638

Map