F406454

General Info

Members Datasets Scaffolds Average Seq Length
322 195 319 244

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10361016|Ga0163163_103610161
Length 275
Sequence MQRRTDIDQLDIQRDHVMSDTTLFADATFGHSATLPHAEDHAVPHYLRAHYWWAYIHPEAVRLFERQWLVNLILWGNYAQLRDAALAELGDSLPGRTLQVACVYGDLTGRLCQQVASGGGTIDIVDILPIQLGNLRAKLPKDAPARLMAMDSSEMRLPDASYERVLLFFLLHEQPRRYREWTLREALRVVKPGGKIVIVDYAMPRWWHPLRYLWRPLLAKLEPFALDLWREEIADLLPPLQVGTTLQKQSFFGGLYQKVVVTGARMGGKHHCLLD

Samples

Sample ID Description Type Environment
1 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
2 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
3 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
92 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
93 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
94 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
104 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
105 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
191 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.65
Metatranscriptomes 3.42
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.86
Rhizosphere 97.2
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10163368 3300005290 Bacteria 1288
2 Ga0065715_10156130 3300005293 Bacteria 1675
3 Ga0070676_10051593 3300005328 Bacteria 2416
4 Ga0070690_100120751 3300005330 Unclassified 1758
5 Ga0070690_100137881 3300005330 Bacteria 1654
6 Ga0070670_100068046 3300005331 Bacteria 3056
7 Ga0068869_100057140 3300005334 Bacteria 2848
8 Ga0070666_10058728 3300005335 Bacteria 2601
9 Ga0068868_100280503 3300005338 Bacteria 1410
10 Ga0070669_100636739 3300005353 Bacteria 896
11 Ga0070675_100109431 3300005354 Bacteria 2335
12 Ga0070674_100148190 3300005356 Unclassified 1768
13 Ga0070673_100231771 3300005364 Bacteria 1602
14 Ga0070713_100651561 3300005436 Bacteria 1003
15 Ga0070700_100102347 3300005441 Unclassified 1889
16 Ga0070708_100000095 3300005445 Bacteria 58224
17 Ga0070708_100006049 3300005445 Bacteria 9624
18 Ga0070678_100068642 3300005456 Bacteria 2644
19 Ga0070662_100010070 3300005457 Bacteria 6195
20 Ga0068867_100023259 3300005459 Bacteria 4436
21 Ga0068867_100070440 3300005459 Bacteria 2614
22 Ga0070685_10367314 3300005466 Bacteria 988
23 Ga0070707_100119532 3300005468 Bacteria 2558
24 Ga0070698_100011325 3300005471 Bacteria 9471
25 Ga0070698_100228027 3300005471 Unclassified 1796
26 Ga0070672_100029108 3300005543 Bacteria 4139
27 Ga0070686_100565026 3300005544 Unclassified 892
28 Ga0070664_100033850 3300005564 Bacteria 4283
29 Ga0068857_100216599 3300005577 Bacteria 1748
30 Ga0068852_100265793 3300005616 Bacteria 1649
31 Ga0068859_100426827 3300005617 Bacteria 1422
32 Ga0068864_100119437 3300005618 Bacteria 2355
33 Ga0068864_100395176 3300005618 Bacteria 1313
34 Ga0068866_10231939 3300005718 Bacteria 1120
35 Ga0068870_10075815 3300005840 Bacteria 1845
36 Ga0068858_100041841 3300005842 Bacteria 4247
37 Ga0068858_100207623 3300005842 Bacteria 1853
38 Ga0068860_100133784 3300005843 Bacteria 2381
39 Ga0070717_10291489 3300006028 Bacteria 1449
40 Ga0068871_100163446 3300006358 Bacteria 1905
41 Ga0075428_100053389 3300006844 Bacteria 4428
42 Ga0075431_100512903 3300006847 Bacteria 1189
43 Ga0075434_100102752 3300006871 Bacteria 2866
44 Ga0075429_100025576 3300006880 Bacteria 5124
45 Ga0068865_100141508 3300006881 Bacteria 1814
46 Ga0097620_100426782 3300006931 Bacteria 1422
47 Ga0075435_100160597 3300007076 Bacteria 1893
48 Ga0111539_10034836 3300009094 Bacteria 6099
49 Ga0111539_10286950 3300009094 Bacteria 1915
50 Ga0111539_10673582 3300009094 Unclassified 1204
51 Ga0105245_10285036 3300009098 Bacteria 1616
52 Ga0105243_10062187 3300009148 Bacteria 2989
53 Ga0105243_10730525 3300009148 Bacteria 968
54 Ga0105242_10001967 3300009176 Bacteria 16162
55 Ga0105248_10066020 3300009177 Bacteria 4063
56 Ga0105249_10034675 3300009553 Bacteria 4573
57 Ga0105249_10299354 3300009553 Bacteria 1612
58 Ga0157378_10080656 3300013297 Bacteria 2940
59 Ga0157378_10121941 3300013297 Bacteria 2404
60 Ga0157378_10212972 3300013297 Bacteria 1833
61 Ga0163162_10047401 3300013306 Bacteria 4307
62 Ga0157375_10055640 3300013308 Bacteria 3902
63 Ga0163163_10201869 3300014325 Bacteria 2037
64 Ga0163163_10361016 3300014325 Bacteria 1509
65 Ga0157380_10030890 3300014326 Bacteria 4108
66 Ga0157380_10368713 3300014326 Bacteria 1350
67 Ga0157380_10549049 3300014326 Unclassified 1133
68 Ga0157379_10049912 3300014968 Bacteria 3736
69 Ga0157379_10151628 3300014968 Bacteria 2091
70 Ga0157376_10045483 3300014969 Bacteria 3615
71 Ga0163161_10023368 3300017792 Bacteria 4361
72 Ga0207697_10036446 3300025315 Bacteria 2014
73 Ga0207682_10035583 3300025893 Bacteria 2012
74 Ga0207688_10007628 3300025901 Bacteria 5890
75 Ga0207645_10014305 3300025907 Bacteria 5314
76 Ga0207643_10083971 3300025908 Bacteria 1848
77 Ga0207646_10256526 3300025922 Bacteria 1580
78 Ga0207694_10342339 3300025924 Bacteria 1237
79 Ga0207706_10067226 3300025933 Bacteria 3153
80 Ga0207686_10047761 3300025934 Bacteria 2648
81 Ga0207709_10308381 3300025935 Bacteria 1180
82 Ga0207709_10503782 3300025935 Bacteria 945
83 Ga0207670_10302061 3300025936 Unclassified 1253
84 Ga0207704_10410337 3300025938 Bacteria 1071
85 Ga0207691_10035207 3300025940 Bacteria 4650
86 Ga0207691_10387458 3300025940 Bacteria 1193
87 Ga0207711_10079134 3300025941 Bacteria 2869
88 Ga0207689_10155536 3300025942 Bacteria 1885
89 Ga0207712_10255408 3300025961 Bacteria 1419
90 Ga0207658_10161513 3300025986 Bacteria 1837
91 Ga0207703_10079260 3300026035 Bacteria 2732
92 Ga0207703_10464337 3300026035 Bacteria 1184
93 Ga0207708_10074983 3300026075 Bacteria 2593
94 Ga0207648_10090113 3300026089 Bacteria 2679
95 Ga0207648_10386382 3300026089 Bacteria 1266
96 Ga0207674_10303591 3300026116 Bacteria 1545
97 Ga0207675_100062875 3300026118 Bacteria 3468
98 Ga0207683_10061842 3300026121 Bacteria 3296
99 Ga0207698_10367285 3300026142 Bacteria 1365
100 Ga0268265_10157245 3300028380 Bacteria 1925
101 Ga0265330_10023402 3300031235 Bacteria 2805
102 Ga0265330_10140926 3300031235 Bacteria 1025
103 Ga0265340_10025441 3300031247 Bacteria 2997
104 Ga0265339_10054697 3300031249 Bacteria 2167
105 Ga0307408_100568126 3300031548 Bacteria 1003
106 Ga0316579_10052006 3300031691 Bacteria 1918
107 Ga0265314_10086825 3300031711 Bacteria 2047
108 Ga0265342_10002569 3300031712 Bacteria 15570
109 Ga0316576_10330825 3300031727 Bacteria 1135
110 Ga0316578_10044206 3300031728 Bacteria 2590
111 Ga0316578_10055871 3300031728 Bacteria 2318
112 Ga0316583_10059103 3300032133 Bacteria 1345
113 Ga0316593_10001707 3300032168 Bacteria 4959
114 Ga0316593_10016705 3300032168 Bacteria 2229
115 Ga0316593_10023753 3300032168 Bacteria 1938
116 Ga0316593_10069959 3300032168 Unclassified 1213
117 Ga0316593_10117685 3300032168 Bacteria 952
118 Ga0316592_1000805 3300033524 Bacteria 4685
119 Ga0316586_1000250 3300033527 Bacteria 4682
120 Ga0316588_1030457 3300033528 Bacteria 1265
121 Ga0316587_1000403 3300033529 Bacteria 4234
122 Ga0316587_1040690 3300033529 Unclassified 839
123 Ga0316596_1034535 3300033541 Bacteria 1321
124 Ga0373934_0026291 3300035086 Bacteria 2257
125 Ga0373923_0002094 3300035111 Bacteria 6042
126 Ga0373923_0026503 3300035111 Bacteria 2306
127 Ga0373936_0001760 3300035113 Bacteria 7952
128 Ga0373945_0003182 3300035116 Bacteria 5149
129 Ga0373953_0025433 3300035117 Bacteria 2261
130 Ga0373954_0000084 3300035118 Bacteria 33354
131 Ga0373954_0040739 3300035118 Bacteria 2164
132 Ga0373954_0048354 3300035118 Bacteria 1993
133 Ga0373954_0209121 3300035118 Bacteria 959
134 Ga0373956_0249124 3300035119 Bacteria 844
135 Ga0373957_0045619 3300035120 Bacteria 1661
136 Ga0373943_0086578 3300035170 Bacteria 1616
137 Ga0373943_0103739 3300035170 Bacteria 1491
138 Ga0373946_0018419 3300035171 Bacteria 2681
139 Ga0373946_0123421 3300035171 Bacteria 1184
140 Ga0373946_0231264 3300035171 Bacteria 896
141 Ga0373955_0000167 3300035172 Bacteria 26793
142 Ga0373955_0001471 3300035172 Bacteria 10004
143 Ga0373955_0147504 3300035172 Unclassified 1383
144 Ga0373955_0249824 3300035172 Bacteria 1063
145 Ga0316574_0001571 3300035398 Bacteria 10911
146 Ga0373924_0001339 3300035410 Bacteria 7932
147 Ga0373935_0000022 3300035692 Bacteria 62564
148 Ga0373935_0030008 3300035692 Bacteria 3367
149 Ga0373935_0037942 3300035692 Unclassified 3015
150 Ga0373935_0152497 3300035692 Unclassified 1569
151 Ga0373927_0003542 3300035695 Bacteria 11163
152 Ga0373927_0015400 3300035695 Bacteria 5054
153 Ga0373927_0019939 3300035695 Bacteria 4397
154 Ga0373927_0033940 3300035695 Unclassified 3320
155 Ga0373927_0070156 3300035695 Bacteria 2268
156 Ga0373927_0209457 3300035695 Bacteria 1280
157 Ga0373933_0000105 3300035724 Bacteria 53488
158 Ga0373933_0022837 3300035724 Bacteria 3567
159 Ga0373933_0182710 3300035724 Bacteria 1338
160 Ga0373933_0436512 3300035724 Unclassified 856
161 Ga0373947_0002128 3300035725 Bacteria 12057
162 Ga0373947_0072615 3300035725 Bacteria 2113
163 Ga0373947_0182027 3300035725 Bacteria 1368
164 Ga0373947_0302081 3300035725 Unclassified 1067
165 Ga0373937_0000070 3300036401 Bacteria 92587
166 Ga0373937_0039858 3300036401 Bacteria 4281
167 Ga0373937_0121621 3300036401 Bacteria 2433
168 Ga0373937_0134597 3300036401 Unclassified 2310
169 Ga0373937_0316086 3300036401 Bacteria 1477
170 Ga0373937_0658056 3300036401 Bacteria 993
171 Ga0316584_0014288 3300036712 Bacteria 5647
172 Ga0373925_0000012 3300037068 Bacteria 202139
173 Ga0373925_0083609 3300037068 Bacteria 2431
174 Ga0373925_0086303 3300037068 Bacteria 2394
175 Ga0439453_0012503 3300041408 Bacteria 1430
176 Ga0495592_0000033 3300046454 Bacteria 127028
177 Ga0495592_0024763 3300046454 Bacteria 4561
178 Ga0495603_0132104 3300046455 Unclassified 1453
179 Ga0495590_0003483 3300046457 Bacteria 6425
180 Ga0495629_0007109 3300046459 Bacteria 8246
181 Ga0495629_0009657 3300046459 Bacteria 7046
182 Ga0495629_0030226 3300046459 Bacteria 3842
183 Ga0495629_0030480 3300046459 Bacteria 3823
184 Ga0495641_0035650 3300046461 Unclassified 2342
185 Ga0495641_0141245 3300046461 Unclassified 1076
186 Ga0495651_0001284 3300046462 Bacteria 19461
187 Ga0495651_0040580 3300046462 Bacteria 3619
188 Ga0495651_0467351 3300046462 Unclassified 812
189 Ga0495653_0000019 3300046463 Bacteria 178799
190 Ga0495653_0001471 3300046463 Bacteria 18364
191 Ga0495653_0005299 3300046463 Bacteria 10490
192 Ga0495582_0084552 3300046473 Bacteria 1764
193 Ga0495582_0097950 3300046473 Bacteria 1640
194 Ga0495639_0050846 3300046475 Unclassified 1883
195 Ga0495639_0229274 3300046475 Bacteria 915
196 Ga0495662_0010195 3300046476 Bacteria 4604
197 Ga0495662_0013426 3300046476 Bacteria 3986
198 Ga0495662_0013838 3300046476 Bacteria 3926
199 Ga0495664_0000005 3300046477 Bacteria 439635
200 Ga0495664_0008825 3300046477 Bacteria 5632
201 Ga0495594_0065809 3300046499 Bacteria 2010
202 Ga0495608_0000003 3300046511 Bacteria 369831
203 Ga0495608_0010898 3300046511 Bacteria 6333
204 Ga0495608_0205850 3300046511 Unclassified 1238
205 Ga0495618_0000009 3300046514 Bacteria 200423
206 Ga0495618_0011280 3300046514 Bacteria 5416
207 Ga0495618_0020413 3300046514 Bacteria 4077
208 Ga0495628_0000010 3300046516 Bacteria 234932
209 Ga0495628_0031819 3300046516 Bacteria 4264
210 Ga0495630_0001179 3300046517 Bacteria 18015
211 Ga0495630_0060195 3300046517 Bacteria 2849
212 Ga0495666_0047718 3300046526 Bacteria 2063
213 Ga0495652_0000016 3300046529 Bacteria 212723
214 Ga0495652_0028851 3300046529 Bacteria 4878
215 Ga0495652_0035861 3300046529 Bacteria 4315
216 Ga0495665_0024773 3300046531 Bacteria 3223
217 Ga0495640_0000015 3300046533 Bacteria 160055
218 Ga0495640_0014307 3300046533 Bacteria 6009
219 Ga0495640_0139428 3300046533 Bacteria 1564
220 Ga0495587_0000009 3300046536 Bacteria 241480
221 Ga0495587_0033579 3300046536 Bacteria 3097
222 Ga0495621_0015597 3300046539 Bacteria 2425
223 Ga0495645_0000005 3300046543 Bacteria 443917
224 Ga0495645_0054030 3300046543 Bacteria 2919
225 Ga0495667_0000073 3300046559 Bacteria 74946
226 Ga0495667_0010024 3300046559 Bacteria 6417
227 Ga0495667_0038599 3300046559 Unclassified 3179
228 Ga0495667_0118514 3300046559 Bacteria 1710
229 Ga0495634_0000954 3300046642 Bacteria 27324
230 Ga0495634_0042030 3300046642 Bacteria 3102
231 Ga0495634_0209722 3300046642 Unclassified 1206
232 Ga0495635_0000013 3300046663 Bacteria 221753
233 Ga0495635_0000636 3300046663 Bacteria 22538
234 Ga0495635_0057766 3300046663 Bacteria 2669
235 Ga0495635_0071584 3300046663 Bacteria 2376
236 Ga0495588_0019790 3300046674 Unclassified 3302
237 Ga0495657_0000066 3300046675 Bacteria 93382
238 Ga0495657_0027971 3300046675 Bacteria 3969
239 Ga0495657_0358011 3300046675 Bacteria 863
240 Ga0495657_0502059 3300046675 Bacteria 707
241 Ga0495599_0000011 3300046678 Bacteria 207639
242 Ga0495599_0003673 3300046678 Bacteria 8997
243 Ga0495599_0106000 3300046678 Unclassified 1751
244 Ga0495623_0000005 3300046679 Bacteria 140586
245 Ga0495623_0017213 3300046679 Bacteria 4668
246 Ga0495646_0000011 3300046680 Bacteria 195220
247 Ga0495646_0048039 3300046680 Unclassified 2595
248 Ga0495647_0009598 3300046681 Bacteria 3281
249 Ga0495647_0065800 3300046681 Unclassified 1440
250 Ga0495647_0069777 3300046681 Unclassified 1404
251 Ga0495658_0012348 3300046683 Bacteria 4323
252 Ga0495658_0037759 3300046683 Unclassified 2671
253 Ga0495658_0138262 3300046683 Bacteria 1488
254 Ga0495613_0004812 3300046689 Bacteria 10127
255 Ga0495613_0013482 3300046689 Bacteria 6071
256 Ga0495613_0046971 3300046689 Bacteria 3190
257 Ga0495613_0496422 3300046689 Bacteria 822
258 Ga0495624_0062117 3300046690 Bacteria 2338
259 Ga0495624_0071242 3300046690 Unclassified 2162
260 Ga0495600_0000004 3300046809 Bacteria 180417
261 Ga0495600_0029208 3300046809 Bacteria 3569
262 Ga0495600_0055289 3300046809 Unclassified 2592
263 Ga0495581_0005392 3300047315 Bacteria 7397
264 Ga0495581_0061148 3300047315 Unclassified 2176
265 Ga0495581_0214218 3300047315 Bacteria 1126
266 Ga0495604_0000006 3300047317 Bacteria 420480
267 Ga0495604_0003160 3300047317 Bacteria 13167
268 Ga0495674_0000005 3300047319 Bacteria 375129
269 Ga0495674_0088882 3300047319 Unclassified 2641
270 Ga0495676_0328854 3300047321 Unclassified 1025
271 Ga0495680_0000141 3300047322 Bacteria 72373
272 Ga0495680_0001883 3300047322 Bacteria 22052
273 Ga0495680_0024328 3300047322 Bacteria 5024
274 Ga0495675_0000070 3300047444 Bacteria 71129
275 Ga0495675_0244177 3300047444 Bacteria 1080
276 Ga0495675_0323560 3300047444 Unclassified 912
277 Ga0495684_0000001 3300047471 Bacteria 369809
278 Ga0495684_0000666 3300047471 Bacteria 27678
279 Ga0495684_0049027 3300047471 Bacteria 3228
280 Ga0495593_0005206 3300047673 Bacteria 7686
281 Ga0495593_0010947 3300047673 Bacteria 5224
282 Ga0495593_0017828 3300047673 Bacteria 3998
283 Ga0495593_0092737 3300047673 Unclassified 1554
284 Ga0495602_0000003 3300048088 Bacteria 357240
285 Ga0495602_0079909 3300048088 Bacteria 2756
286 Ga0495614_0052685 3300048089 Unclassified 1744
287 Ga0496104_0004526 3300048907 Bacteria 12113
288 Ga0496105_0003393 3300048908 Bacteria 11777
289 Ga0496109_0006751 3300048912 Bacteria 9665
290 Ga0496110_0061064 3300048913 Bacteria 3325
291 Ga0496111_0014884 3300048914 Bacteria 5324
292 Ga0496112_0204922 3300048915 Bacteria 1930
293 Ga0501031_0115122 3300049568 Bacteria 1757
294 Ga0501033_0108908 3300049570 Unclassified 2018
295 Ga0501038_0245571 3300049574 Bacteria 1420
296 Ga0501041_0075095 3300049577 Unclassified 2078
297 Ga0501042_0187688 3300049578 Unclassified 1491
298 Ga0501046_0032541 3300049580 Unclassified 4223
299 Ga0501076_0284436 3300049592 Unclassified 1355
300 Ga0501079_0184344 3300049741 Bacteria 1629
301 Ga0501079_0276418 3300049741 Bacteria 1313
302 Ga0501035_0850797 3300049822 Unclassified 726
303 nmdc:mga05p37_216041_c1 3300050507 Unclassified 2316
304 nmdc:mga09592_493035_c1 3300050508 Bacteria 1055
305 nmdc:mga0qj67_435786_c1 3300050509 Bacteria 1056
306 nmdc:mga06r32_574122_c1 3300050510 Bacteria 1100
307 nmdc:mga08y16_77267_c1 3300050511 Bacteria 3471
308 nmdc:mga0n895_367318_c1 3300050512 Bacteria 1457
309 nmdc:mga0rr50_49800_c1 3300050513 Bacteria 3102
310 Ga0495601_0000005 3300053077 Bacteria 387079
311 Ga0495601_0127130 3300053077 Bacteria 1658
312 Ga0495612_0000001 3300053078 Bacteria 418244
313 Ga0495595_0000030 3300053084 Bacteria 89992
314 Ga0495595_0034983 3300053084 Bacteria 2274
315 Ga0495595_0057146 3300053084 Bacteria 1820
316 Ga0495619_0000007 3300053085 Bacteria 369936
317 Ga0501084_0308871 3300054114 Bacteria 1336
318 Ga0501082_0206656 3300060353 Unclassified 1708
319 Ga0530510_0046523 3300061734 Bacteria 3134

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035172 Ga0373955_0249824 Ga0373955_0249824_445_1053 202
2 3300046462 Ga0495651_0467351 Ga0495651_0467351_19_627 202
3 3300035695 Ga0373927_0033940 Ga0373927_0033940_445_1140 216
4 3300046457 Ga0495590_0003483 Ga0495590_0003483_2247_2924 216
5 3300005471 Ga0070698_100228027 Ga0070698_1002280271 219
6 3300005459 Ga0068867_100070440 Ga0068867_1000704401 220
7 3300005718 Ga0068866_10231939 Ga0068866_102319391 220
8 3300005842 Ga0068858_100041841 Ga0068858_1000418415 220
9 3300009148 Ga0105243_10062187 Ga0105243_100621875 220
10 3300009176 Ga0105242_10001967 Ga0105242_1000196710 220
11 3300009177 Ga0105248_10066020 Ga0105248_100660202 220
12 3300009553 Ga0105249_10299354 Ga0105249_102993543 220
13 3300014968 Ga0157379_10049912 Ga0157379_100499125 220
14 3300025924 Ga0207694_10342339 Ga0207694_103423392 220
15 3300025934 Ga0207686_10047761 Ga0207686_100477612 220
16 3300025935 Ga0207709_10308381 Ga0207709_103083811 220
17 3300025941 Ga0207711_10079134 Ga0207711_100791341 220
18 3300026035 Ga0207703_10079260 Ga0207703_100792605 220
19 3300026089 Ga0207648_10386382 Ga0207648_103863821 220
20 3300046539 Ga0495621_0015597 Ga0495621_0015597_722_1408 220
21 3300046683 Ga0495658_0138262 Ga0495658_0138262_349_1044 220
22 3300047673 Ga0495593_0092737 Ga0495593_0092737_85_750 220
23 3300049822 Ga0501035_0850797 Ga0501035_0850797_26_691 221
24 iso_pu_bacteria 2671180139 2671694439 221
25 iso_pu_bacteria 2738541317 2738945260 221
26 iso_pu_bacteria 2913308742 2913309962 221
27 3300035695 Ga0373927_0209457 Ga0373927_0209457_203_883 222
28 3300035725 Ga0373947_0182027 Ga0373947_0182027_123_803 222
29 3300046675 Ga0495657_0502059 Ga0495657_0502059_13_681 222
30 3300014326 Ga0157380_10368713 Ga0157380_103687132 226
31 3300025940 Ga0207691_10387458 Ga0207691_103874582 227
32 3300049568 Ga0501031_0115122 Ga0501031_0115122_1005_1721 228
33 3300054114 Ga0501084_0308871 Ga0501084_0308871_120_836 228
34 3300005328 Ga0070676_10051593 Ga0070676_100515932 229
35 3300005330 Ga0070690_100120751 Ga0070690_1001207512 229
36 3300005331 Ga0070670_100068046 Ga0070670_1000680463 229
37 3300005334 Ga0068869_100057140 Ga0068869_1000571402 229
38 3300005335 Ga0070666_10058728 Ga0070666_100587282 229
39 3300005356 Ga0070674_100148190 Ga0070674_1001481902 229
40 3300005441 Ga0070700_100102347 Ga0070700_1001023473 229
41 3300005456 Ga0070678_100068642 Ga0070678_1000686423 229
42 3300005457 Ga0070662_100010070 Ga0070662_1000100705 229
43 3300005459 Ga0068867_100023259 Ga0068867_1000232592 229
44 3300005543 Ga0070672_100029108 Ga0070672_1000291083 229
45 3300005564 Ga0070664_100033850 Ga0070664_1000338503 229
46 3300005616 Ga0068852_100265793 Ga0068852_1002657932 229
47 3300005618 Ga0068864_100119437 Ga0068864_1001194371 229
48 3300005840 Ga0068870_10075815 Ga0068870_100758152 229
49 3300005842 Ga0068858_100207623 Ga0068858_1002076232 229
50 3300005843 Ga0068860_100133784 Ga0068860_1001337843 229
51 3300006358 Ga0068871_100163446 Ga0068871_1001634461 229
52 3300006881 Ga0068865_100141508 Ga0068865_1001415082 229
53 3300009094 Ga0111539_10286950 Ga0111539_102869502 229
54 3300009098 Ga0105245_10285036 Ga0105245_102850361 229
55 3300009148 Ga0105243_10730525 Ga0105243_107305252 229
56 3300009553 Ga0105249_10034675 Ga0105249_100346753 229
57 3300013297 Ga0157378_10121941 Ga0157378_101219413 229
58 3300013306 Ga0163162_10047401 Ga0163162_100474013 229
59 3300013308 Ga0157375_10055640 Ga0157375_100556401 229
60 3300014325 Ga0163163_10201869 Ga0163163_102018691 229
61 3300014326 Ga0157380_10030890 Ga0157380_100308903 229
62 3300014968 Ga0157379_10151628 Ga0157379_101516282 229
63 3300014969 Ga0157376_10045483 Ga0157376_100454832 229
64 3300017792 Ga0163161_10023368 Ga0163161_100233683 229
65 3300025315 Ga0207697_10036446 Ga0207697_100364462 229
66 3300025893 Ga0207682_10035583 Ga0207682_100355831 229
67 3300025901 Ga0207688_10007628 Ga0207688_100076284 229
68 3300025907 Ga0207645_10014305 Ga0207645_100143053 229
69 3300025908 Ga0207643_10083971 Ga0207643_100839712 229
70 3300025933 Ga0207706_10067226 Ga0207706_100672263 229
71 3300025935 Ga0207709_10503782 Ga0207709_105037822 229
72 3300025938 Ga0207704_10410337 Ga0207704_104103371 229
73 3300025940 Ga0207691_10035207 Ga0207691_100352073 229
74 3300025942 Ga0207689_10155536 Ga0207689_101555361 229
75 3300025961 Ga0207712_10255408 Ga0207712_102554082 229
76 3300025986 Ga0207658_10161513 Ga0207658_101615131 229
77 3300026035 Ga0207703_10464337 Ga0207703_104643372 229
78 3300026075 Ga0207708_10074983 Ga0207708_100749833 229
79 3300026089 Ga0207648_10090113 Ga0207648_100901132 229
80 3300026118 Ga0207675_100062875 Ga0207675_1000628752 229
81 3300026121 Ga0207683_10061842 Ga0207683_100618423 229
82 3300026142 Ga0207698_10367285 Ga0207698_103672852 229
83 3300028380 Ga0268265_10157245 Ga0268265_101572452 229
84 3300035692 Ga0373935_0152497 Ga0373935_0152497_110_811 229
85 3300050512 nmdc:mga0n895_367318_c1 nmdc:mga0n895_367318_c1_47_757 229
86 3300031548 Ga0307408_100568126 Ga0307408_1005681261 230
87 3300031691 Ga0316579_10052006 Ga0316579_100520063 230
88 3300031728 Ga0316578_10055871 Ga0316578_100558712 230
89 3300032168 Ga0316593_10016705 Ga0316593_100167053 230
90 3300032168 Ga0316593_10023753 Ga0316593_100237531 230
91 3300032168 Ga0316593_10069959 Ga0316593_100699591 230
92 3300032168 Ga0316593_10117685 Ga0316593_101176851 230
93 3300033524 Ga0316592_1000805 Ga0316592_10008054 230
94 3300033527 Ga0316586_1000250 Ga0316586_10002505 230
95 3300033528 Ga0316588_1030457 Ga0316588_10304571 230
96 3300033529 Ga0316587_1000403 Ga0316587_10004033 230
97 3300033529 Ga0316587_1040690 Ga0316587_10406901 230
98 3300033541 Ga0316596_1034535 Ga0316596_10345352 230
99 3300005445 Ga0070708_100000095 Ga0070708_10000009537 231
100 3300035119 Ga0373956_0249124 Ga0373956_0249124_120_830 231
101 3300035170 Ga0373943_0086578 Ga0373943_0086578_864_1574 231
102 3300035171 Ga0373946_0123421 Ga0373946_0123421_268_978 231
103 3300035692 Ga0373935_0030008 Ga0373935_0030008_22_732 231
104 3300035695 Ga0373927_0019939 Ga0373927_0019939_2333_3043 231
105 3300035724 Ga0373933_0436512 Ga0373933_0436512_15_710 231
106 3300035725 Ga0373947_0072615 Ga0373947_0072615_1383_2093 231
107 3300036401 Ga0373937_0316086 Ga0373937_0316086_673_1383 231
108 3300046459 Ga0495629_0030480 Ga0495629_0030480_1631_2341 231
109 3300046476 Ga0495662_0010195 Ga0495662_0010195_1938_2648 231
110 3300046499 Ga0495594_0065809 Ga0495594_0065809_650_1360 231
111 3300046526 Ga0495666_0047718 Ga0495666_0047718_1264_1974 231
112 3300046531 Ga0495665_0024773 Ga0495665_0024773_1793_2503 231
113 3300046533 Ga0495640_0139428 Ga0495640_0139428_190_900 231
114 3300046663 Ga0495635_0057766 Ga0495635_0057766_232_942 231
115 3300046681 Ga0495647_0009598 Ga0495647_0009598_1037_1747 231
116 3300046683 Ga0495658_0012348 Ga0495658_0012348_3148_3858 231
117 3300046809 Ga0495600_0029208 Ga0495600_0029208_1007_1717 231
118 3300047315 Ga0495581_0005392 Ga0495581_0005392_4674_5384 231
119 3300047673 Ga0495593_0010947 Ga0495593_0010947_3253_3963 231
120 3300053084 Ga0495595_0057146 Ga0495595_0057146_446_1156 231
121 3300035724 Ga0373933_0182710 Ga0373933_0182710_518_1237 234
122 3300036401 Ga0373937_0039858 Ga0373937_0039858_567_1286 234
123 3300031235 Ga0265330_10140926 Ga0265330_101409261 236
124 3300005445 Ga0070708_100006049 Ga0070708_1000060495 237
125 3300005468 Ga0070707_100119532 Ga0070707_1001195322 237
126 3300005471 Ga0070698_100011325 Ga0070698_1000113255 237
127 3300025922 Ga0207646_10256526 Ga0207646_102565262 237
128 3300035170 Ga0373943_0103739 Ga0373943_0103739_703_1434 237
129 3300048907 Ga0496104_0004526 Ga0496104_0004526_8766_9497 237
130 3300048908 Ga0496105_0003393 Ga0496105_0003393_10776_11507 237
131 3300048912 Ga0496109_0006751 Ga0496109_0006751_2195_2926 237
132 3300048913 Ga0496110_0061064 Ga0496110_0061064_405_1136 237
133 3300048914 Ga0496111_0014884 Ga0496111_0014884_1770_2501 237
134 3300048915 Ga0496112_0204922 Ga0496112_0204922_99_830 237
135 3300035118 Ga0373954_0209121 Ga0373954_0209121_103_843 238
136 3300035172 Ga0373955_0147504 Ga0373955_0147504_49_831 239
137 3300035692 Ga0373935_0037942 Ga0373935_0037942_1934_2716 239
138 3300035695 Ga0373927_0070156 Ga0373927_0070156_254_1036 239
139 3300035725 Ga0373947_0302081 Ga0373947_0302081_182_964 239
140 3300036401 Ga0373937_0134597 Ga0373937_0134597_92_874 239
141 3300037068 Ga0373925_0083609 Ga0373925_0083609_1268_2050 239
142 3300046455 Ga0495603_0132104 Ga0495603_0132104_121_903 239
143 3300046459 Ga0495629_0009657 Ga0495629_0009657_5244_6026 239
144 3300046461 Ga0495641_0035650 Ga0495641_0035650_363_1145 239
145 3300046462 Ga0495651_0040580 Ga0495651_0040580_331_1113 239
146 3300046463 Ga0495653_0005299 Ga0495653_0005299_6444_7226 239
147 3300046473 Ga0495582_0097950 Ga0495582_0097950_766_1548 239
148 3300046475 Ga0495639_0050846 Ga0495639_0050846_735_1517 239
149 3300046476 Ga0495662_0013838 Ga0495662_0013838_1653_2423 239
150 3300046477 Ga0495664_0008825 Ga0495664_0008825_4589_5371 239
151 3300046511 Ga0495608_0205850 Ga0495608_0205850_396_1178 239
152 3300046514 Ga0495618_0020413 Ga0495618_0020413_2147_2929 239
153 3300046517 Ga0495630_0060195 Ga0495630_0060195_1026_1808 239
154 3300046529 Ga0495652_0035861 Ga0495652_0035861_2153_2935 239
155 3300046536 Ga0495587_0033579 Ga0495587_0033579_19_801 239
156 3300046559 Ga0495667_0038599 Ga0495667_0038599_1856_2638 239
157 3300046642 Ga0495634_0209722 Ga0495634_0209722_121_903 239
158 3300046663 Ga0495635_0071584 Ga0495635_0071584_604_1386 239
159 3300046674 Ga0495588_0019790 Ga0495588_0019790_327_1109 239
160 3300046678 Ga0495599_0106000 Ga0495599_0106000_50_832 239
161 3300046680 Ga0495646_0048039 Ga0495646_0048039_1486_2268 239
162 3300046681 Ga0495647_0069777 Ga0495647_0069777_75_857 239
163 3300046683 Ga0495658_0037759 Ga0495658_0037759_1430_2212 239
164 3300046689 Ga0495613_0046971 Ga0495613_0046971_1223_2005 239
165 3300046690 Ga0495624_0071242 Ga0495624_0071242_1285_2067 239
166 3300046809 Ga0495600_0055289 Ga0495600_0055289_383_1165 239
167 3300047315 Ga0495581_0061148 Ga0495581_0061148_330_1112 239
168 3300047319 Ga0495674_0088882 Ga0495674_0088882_1487_2269 239
169 3300047321 Ga0495676_0328854 Ga0495676_0328854_133_915 239
170 3300047322 Ga0495680_0024328 Ga0495680_0024328_3813_4595 239
171 3300047444 Ga0495675_0323560 Ga0495675_0323560_88_870 239
172 3300047471 Ga0495684_0049027 Ga0495684_0049027_2337_3119 239
173 3300048089 Ga0495614_0052685 Ga0495614_0052685_731_1513 239
174 3300053084 Ga0495595_0034983 Ga0495595_0034983_310_1092 239
175 3300031235 Ga0265330_10023402 Ga0265330_100234024 240
176 3300031711 Ga0265314_10086825 Ga0265314_100868252 240
177 3300013297 Ga0157378_10080656 Ga0157378_100806564 241
178 3300049570 Ga0501033_0108908 Ga0501033_0108908_264_989 241
179 3300005436 Ga0070713_100651561 Ga0070713_1006515612 242
180 3300006028 Ga0070717_10291489 Ga0070717_102914892 242
181 3300006871 Ga0075434_100102752 Ga0075434_1001027522 242
182 3300007076 Ga0075435_100160597 Ga0075435_1001605972 242
183 3300035086 Ga0373934_0026291 Ga0373934_0026291_1019_1768 242
184 3300035111 Ga0373923_0002094 Ga0373923_0002094_2842_3585 242
185 3300035111 Ga0373923_0026503 Ga0373923_0026503_760_1509 242
186 3300035113 Ga0373936_0001760 Ga0373936_0001760_1398_2141 242
187 3300035116 Ga0373945_0003182 Ga0373945_0003182_2624_3367 242
188 3300035117 Ga0373953_0025433 Ga0373953_0025433_798_1547 242
189 3300035118 Ga0373954_0000084 Ga0373954_0000084_627_1376 242
190 3300035118 Ga0373954_0040739 Ga0373954_0040739_907_1668 242
191 3300035118 Ga0373954_0048354 Ga0373954_0048354_1120_1863 242
192 3300035120 Ga0373957_0045619 Ga0373957_0045619_367_1116 242
193 3300035171 Ga0373946_0018419 Ga0373946_0018419_1801_2544 242
194 3300035171 Ga0373946_0231264 Ga0373946_0231264_74_838 242
195 3300035172 Ga0373955_0000167 Ga0373955_0000167_21434_22177 242
196 3300035172 Ga0373955_0001471 Ga0373955_0001471_1935_2684 242
197 3300035410 Ga0373924_0001339 Ga0373924_0001339_808_1551 242
198 3300035692 Ga0373935_0000022 Ga0373935_0000022_55545_56288 242
199 3300035695 Ga0373927_0003542 Ga0373927_0003542_5330_6073 242
200 3300035724 Ga0373933_0022837 Ga0373933_0022837_1073_1816 242
201 3300035725 Ga0373947_0002128 Ga0373947_0002128_5010_5753 242
202 3300036401 Ga0373937_0000070 Ga0373937_0000070_28670_29413 242
203 3300036401 Ga0373937_0658056 Ga0373937_0658056_49_813 242
204 3300037068 Ga0373925_0000012 Ga0373925_0000012_56319_57062 242
205 3300037068 Ga0373925_0086303 Ga0373925_0086303_1443_2207 242
206 3300046454 Ga0495592_0000033 Ga0495592_0000033_69704_70447 242
207 3300046454 Ga0495592_0024763 Ga0495592_0024763_1116_1865 242
208 3300046459 Ga0495629_0007109 Ga0495629_0007109_2592_3341 242
209 3300046459 Ga0495629_0030226 Ga0495629_0030226_1962_2705 242
210 3300046461 Ga0495641_0141245 Ga0495641_0141245_222_965 242
211 3300046462 Ga0495651_0001284 Ga0495651_0001284_4975_5718 242
212 3300046463 Ga0495653_0000019 Ga0495653_0000019_25598_26341 242
213 3300046463 Ga0495653_0001471 Ga0495653_0001471_4356_5105 242
214 3300046476 Ga0495662_0013426 Ga0495662_0013426_204_947 242
215 3300046477 Ga0495664_0000005 Ga0495664_0000005_369760_370503 242
216 3300046511 Ga0495608_0000003 Ga0495608_0000003_69075_69818 242
217 3300046511 Ga0495608_0010898 Ga0495608_0010898_2532_3281 242
218 3300046514 Ga0495618_0000009 Ga0495618_0000009_130618_131361 242
219 3300046514 Ga0495618_0011280 Ga0495618_0011280_3183_3932 242
220 3300046516 Ga0495628_0000010 Ga0495628_0000010_145710_146453 242
221 3300046516 Ga0495628_0031819 Ga0495628_0031819_2499_3248 242
222 3300046517 Ga0495630_0001179 Ga0495630_0001179_8036_8779 242
223 3300046529 Ga0495652_0000016 Ga0495652_0000016_142813_143556 242
224 3300046529 Ga0495652_0028851 Ga0495652_0028851_1244_1993 242
225 3300046533 Ga0495640_0000015 Ga0495640_0000015_90159_90902 242
226 3300046533 Ga0495640_0014307 Ga0495640_0014307_516_1265 242
227 3300046536 Ga0495587_0000009 Ga0495587_0000009_88492_89235 242
228 3300046543 Ga0495645_0000005 Ga0495645_0000005_369731_370474 242
229 3300046543 Ga0495645_0054030 Ga0495645_0054030_857_1606 242
230 3300046559 Ga0495667_0000073 Ga0495667_0000073_69157_69900 242
231 3300046559 Ga0495667_0010024 Ga0495667_0010024_3669_4418 242
232 3300046559 Ga0495667_0118514 Ga0495667_0118514_523_1284 242
233 3300046642 Ga0495634_0000954 Ga0495634_0000954_17665_18408 242
234 3300046642 Ga0495634_0042030 Ga0495634_0042030_1018_1767 242
235 3300046663 Ga0495635_0000013 Ga0495635_0000013_69128_69871 242
236 3300046663 Ga0495635_0000636 Ga0495635_0000636_5265_6014 242
237 3300046675 Ga0495657_0000066 Ga0495657_0000066_67021_67764 242
238 3300046675 Ga0495657_0027971 Ga0495657_0027971_1674_2423 242
239 3300046675 Ga0495657_0358011 Ga0495657_0358011_64_825 242
240 3300046678 Ga0495599_0000011 Ga0495599_0000011_137814_138557 242
241 3300046678 Ga0495599_0003673 Ga0495599_0003673_1914_2663 242
242 3300046679 Ga0495623_0000005 Ga0495623_0000005_74118_74861 242
243 3300046679 Ga0495623_0017213 Ga0495623_0017213_3852_4601 242
244 3300046680 Ga0495646_0000011 Ga0495646_0000011_137709_138452 242
245 3300046681 Ga0495647_0065800 Ga0495647_0065800_14_757 242
246 3300046689 Ga0495613_0004812 Ga0495613_0004812_4845_5588 242
247 3300046689 Ga0495613_0013482 Ga0495613_0013482_1935_2684 242
248 3300046689 Ga0495613_0496422 Ga0495613_0496422_10_774 242
249 3300046690 Ga0495624_0062117 Ga0495624_0062117_1323_2066 242
250 3300046809 Ga0495600_0000004 Ga0495600_0000004_69092_69835 242
251 3300047315 Ga0495581_0214218 Ga0495581_0214218_211_954 242
252 3300047317 Ga0495604_0000006 Ga0495604_0000006_130633_131376 242
253 3300047317 Ga0495604_0003160 Ga0495604_0003160_8750_9499 242
254 3300047319 Ga0495674_0000005 Ga0495674_0000005_74369_75112 242
255 3300047322 Ga0495680_0000141 Ga0495680_0000141_69005_69748 242
256 3300047322 Ga0495680_0001883 Ga0495680_0001883_13388_14137 242
257 3300047444 Ga0495675_0000070 Ga0495675_0000070_1434_2177 242
258 3300047444 Ga0495675_0244177 Ga0495675_0244177_219_980 242
259 3300047471 Ga0495684_0000001 Ga0495684_0000001_299994_300737 242
260 3300047471 Ga0495684_0000666 Ga0495684_0000666_8174_8923 242
261 3300047673 Ga0495593_0005206 Ga0495593_0005206_4125_4874 242
262 3300047673 Ga0495593_0017828 Ga0495593_0017828_61_804 242
263 3300048088 Ga0495602_0000003 Ga0495602_0000003_56612_57355 242
264 3300048088 Ga0495602_0079909 Ga0495602_0079909_1645_2394 242
265 3300050513 nmdc:mga0rr50_49800_c1 nmdc:mga0rr50_49800_c1_187_960 242
266 3300053077 Ga0495601_0000005 Ga0495601_0000005_297898_298641 242
267 3300053077 Ga0495601_0127130 Ga0495601_0127130_345_1094 242
268 3300053078 Ga0495612_0000001 Ga0495612_0000001_117484_118227 242
269 3300053084 Ga0495595_0000030 Ga0495595_0000030_70735_71478 242
270 3300053085 Ga0495619_0000007 Ga0495619_0000007_300018_300761 242
271 3300006844 Ga0075428_100053389 Ga0075428_1000533893 244
272 3300006847 Ga0075431_100512903 Ga0075431_1005129032 244
273 3300049574 Ga0501038_0245571 Ga0501038_0245571_557_1291 244
274 3300049577 Ga0501041_0075095 Ga0501041_0075095_211_945 244
275 3300049578 Ga0501042_0187688 Ga0501042_0187688_360_1094 244
276 3300049580 Ga0501046_0032541 Ga0501046_0032541_2581_3315 244
277 3300049592 Ga0501076_0284436 Ga0501076_0284436_531_1265 244
278 3300049741 Ga0501079_0184344 Ga0501079_0184344_774_1508 244
279 3300049741 Ga0501079_0276418 Ga0501079_0276418_325_1059 244
280 3300050510 nmdc:mga06r32_574122_c1 nmdc:mga06r32_574122_c1_286_1020 244
281 3300060353 Ga0501082_0206656 Ga0501082_0206656_22_756 244
282 3300061734 Ga0530510_0046523 Ga0530510_0046523_1899_2633 244
283 3300009094 Ga0111539_10673582 Ga0111539_106735822 245
284 3300013297 Ga0157378_10212972 Ga0157378_102129723 245
285 3300031247 Ga0265340_10025441 Ga0265340_100254414 245
286 3300031249 Ga0265339_10054697 Ga0265339_100546971 245
287 3300031712 Ga0265342_10002569 Ga0265342_1000256914 245
288 3300032168 Ga0316593_10001707 Ga0316593_100017072 245
289 3300035695 Ga0373927_0015400 Ga0373927_0015400_126_866 245
290 3300035724 Ga0373933_0000105 Ga0373933_0000105_13464_14258 245
291 3300036401 Ga0373937_0121621 Ga0373937_0121621_267_1040 245
292 3300046473 Ga0495582_0084552 Ga0495582_0084552_313_1053 245
293 3300046475 Ga0495639_0229274 Ga0495639_0229274_96_836 245
294 3300005290 Ga0065712_10163368 Ga0065712_101633682 246
295 3300005293 Ga0065715_10156130 Ga0065715_101561302 246
296 3300005330 Ga0070690_100137881 Ga0070690_1001378812 246
297 3300005338 Ga0068868_100280503 Ga0068868_1002805031 246
298 3300005353 Ga0070669_100636739 Ga0070669_1006367391 246
299 3300005354 Ga0070675_100109431 Ga0070675_1001094312 246
300 3300005364 Ga0070673_100231771 Ga0070673_1002317712 246
301 3300005466 Ga0070685_10367314 Ga0070685_103673141 246
302 3300005544 Ga0070686_100565026 Ga0070686_1005650261 246
303 3300005577 Ga0068857_100216599 Ga0068857_1002165991 246
304 3300005617 Ga0068859_100426827 Ga0068859_1004268272 246
305 3300005618 Ga0068864_100395176 Ga0068864_1003951761 246
306 3300006880 Ga0075429_100025576 Ga0075429_1000255764 246
307 3300006931 Ga0097620_100426782 Ga0097620_1004267822 246
308 3300009094 Ga0111539_10034836 Ga0111539_100348365 246
309 3300014325 Ga0163163_10361016 Ga0163163_103610161 246
310 3300014326 Ga0157380_10549049 Ga0157380_105490491 246
311 3300025936 Ga0207670_10302061 Ga0207670_103020612 246
312 3300026116 Ga0207674_10303591 Ga0207674_103035911 246
313 3300031727 Ga0316576_10330825 Ga0316576_103308251 246
314 3300031728 Ga0316578_10044206 Ga0316578_100442061 246
315 3300032133 Ga0316583_10059103 Ga0316583_100591032 246
316 3300035398 Ga0316574_0001571 Ga0316574_0001571_6122_6871 246
317 3300036712 Ga0316584_0014288 Ga0316584_0014288_1571_2320 246
318 3300041408 Ga0439453_0012503 Ga0439453_0012503_317_1069 246
319 3300050507 nmdc:mga05p37_216041_c1 nmdc:mga05p37_216041_c1_433_1203 246
320 3300050508 nmdc:mga09592_493035_c1 nmdc:mga09592_493035_c1_26_796 246
321 3300050509 nmdc:mga0qj67_435786_c1 nmdc:mga0qj67_435786_c1_83_853 246
322 3300050511 nmdc:mga08y16_77267_c1 nmdc:mga08y16_77267_c1_419_1192 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

97

194

0.94

PF08241

Methyltransf_11

Methyltransferase domain

98

198

0.9

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

68

218

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wzg-assembly1.cif.gz_F cypemycin n-terminal methyltransferase cypm 0.8716 79 184
7v6h-assembly2.cif.gz_B crystal structure of the spnl 0.7883 58 186
5w7m-assembly1.cif.gz_A crystal structure of roqn 0.7744 62 184
6p3n-assembly1.cif.gz_A-2 tetrahydroprotoberberine n-methyltransferase in complex with s-adenosylmethionine 0.7717 65 186
5w7k-assembly1.cif.gz_A crystal structure of oxag 0.7655 62 184
ID Description Score Start End Superfamily
af_P9WLW9_47_240_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8464 79 185 3.40.50.150
af_O80543_104_299_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8432 106 186 3.40.50.150
af_Q2FYG5_1_193_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8394 70 246 3.40.50.150
af_O13871_19_175_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8294 66 179 3.40.50.150
af_O74529_17_260_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8168 63 185 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1F4XI12-F1-model_v4 Methyltransferase domain-containing protein 0.969 26 246 GO:0008168
GO:0032259
AF-A0A7X6WQS4-F1-model_v4 deleted 0.9574 26 245
AF-A0A1F4XI12-F1-model_v4 Methyltransferase domain-containing protein 0.9237 26 246 GO:0008168
GO:0032259
AF-A0A3B1B105-F1-model_v4 Methyltransferase domain-containing protein 0.8924 1 246
AF-A0A7C1KPD5-F1-model_v4 Methyltransferase domain-containing protein 0.8811 61 245 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
82.15 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map