F406396

General Info

Members Datasets Scaffolds Average Seq Length
322 188 322 205

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100003322|Ga0068871_10000332210
Length 240
Sequence VPGPALYFAVTLNGFGIFLLFNGPLHEQDIFMETSGKKRLSMLRSYTTADLFTIGNATCGTLSIFLCLDYIAEANNRFLWIAFILLLAALFFDVFDGYWARRSGRQSILGADLDSLSDIISFGVAPAVLGFTLGMRGGWDMLILAFFVVCGISRLARFNVTAEALSGGTGKVKYFEGTPIPTSILIVLLLGVAFSRQAVDNDLWFGAYRVLSIATLHPLTLIYVLSGLGMISATIRIPKP

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
124 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
125 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
126 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
127 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
128 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
129 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
130 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
131 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
182 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
183 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
184 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
185 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
186 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.76
Nodule 0
Rhizoplane 1.24
Rhizosphere 90.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10001091 3300005290 Bacteria 8552
2 Ga0065712_10126892 3300005290 Bacteria 1597
3 Ga0070690_100015830 3300005330 Bacteria 4506
4 Ga0070670_100033125 3300005331 Bacteria 4451
5 Ga0070670_100413924 3300005331 Bacteria 1191
6 Ga0070670_100639346 3300005331 Unclassified 954
7 Ga0070677_10014120 3300005333 Bacteria 2805
8 Ga0070677_10059186 3300005333 Bacteria 1575
9 Ga0070666_10309335 3300005335 Unclassified 1126
10 Ga0070680_100872640 3300005336 Bacteria 776
11 Ga0068868_100002519 3300005338 Bacteria 12720
12 Ga0070689_100084633 3300005340 Bacteria 2493
13 Ga0070689_100486914 3300005340 Bacteria 1054
14 Ga0070687_100039040 3300005343 Bacteria 2383
15 Ga0070661_100082209 3300005344 Bacteria 2379
16 Ga0070661_100222388 3300005344 Bacteria 1449
17 Ga0070675_100170757 3300005354 Bacteria 1875
18 Ga0070675_100436283 3300005354 Bacteria 1173
19 Ga0070674_100163876 3300005356 Bacteria 1689
20 Ga0070673_100069421 3300005364 Bacteria 2824
21 Ga0070673_100381104 3300005364 Bacteria 1257
22 Ga0070688_100019561 3300005365 Unclassified 3924
23 Ga0070659_100398793 3300005366 Bacteria 1161
24 Ga0070667_100025796 3300005367 Bacteria 4888
25 Ga0070703_10152222 3300005406 Bacteria 870
26 Ga0070701_10288916 3300005438 Bacteria 1004
27 Ga0070705_100400639 3300005440 Bacteria 1016
28 Ga0070700_100011402 3300005441 Bacteria 4924
29 Ga0070700_100333794 3300005441 Bacteria 1118
30 Ga0070694_100303170 3300005444 Bacteria 1225
31 Ga0070663_100598496 3300005455 Bacteria 927
32 Ga0068867_100274648 3300005459 Bacteria 1380
33 Ga0068867_100357220 3300005459 Bacteria 1221
34 Ga0070707_100533300 3300005468 Bacteria 1136
35 Ga0070698_100013300 3300005471 Bacteria 8710
36 Ga0070698_100807389 3300005471 Bacteria 882
37 Ga0070699_100000583 3300005518 Bacteria 34487
38 Ga0070684_100084753 3300005535 Bacteria 2809
39 Ga0070697_100151682 3300005536 Bacteria 1953
40 Ga0068853_100506602 3300005539 Bacteria 1140
41 Ga0070672_100028826 3300005543 Bacteria 4156
42 Ga0070672_100036199 3300005543 Bacteria 3759
43 Ga0070696_100671437 3300005546 Bacteria 842
44 Ga0070704_100051031 3300005549 Bacteria 2911
45 Ga0070704_100258103 3300005549 Bacteria 1434
46 Ga0070664_100027963 3300005564 Bacteria 4690
47 Ga0070664_100068344 3300005564 Bacteria 3037
48 Ga0070664_100236363 3300005564 Bacteria 1639
49 Ga0068857_100467190 3300005577 Unclassified 1181
50 Ga0068856_100319922 3300005614 Unclassified 1569
51 Ga0068859_100093192 3300005617 Bacteria 3064
52 Ga0068859_100132982 3300005617 Bacteria 2560
53 Ga0068859_100761620 3300005617 Bacteria 1057
54 Ga0068864_100004341 3300005618 Bacteria 11643
55 Ga0068864_100574621 3300005618 Unclassified 1091
56 Ga0068861_100378294 3300005719 Bacteria 1250
57 Ga0068870_10119270 3300005840 Bacteria 1517
58 Ga0068863_100013820 3300005841 Bacteria 7783
59 Ga0068863_100428339 3300005841 Unclassified 1297
60 Ga0068858_100040680 3300005842 Bacteria 4312
61 Ga0068858_100414304 3300005842 Bacteria 1295
62 Ga0068860_100665130 3300005843 Unclassified 1050
63 Ga0075368_10060018 3300006042 Bacteria 1522
64 Ga0075363_100194642 3300006048 Bacteria 1157
65 Ga0075364_10113703 3300006051 Bacteria 1808
66 Ga0075364_10223328 3300006051 Bacteria 1279
67 Ga0075367_10147151 3300006178 Bacteria 1461
68 Ga0075369_10137664 3300006186 Bacteria 1112
69 Ga0075366_10094215 3300006195 Bacteria 1795
70 Ga0075366_10231405 3300006195 Bacteria 1126
71 Ga0097621_100224227 3300006237 Bacteria 1639
72 Ga0075370_10052882 3300006353 Bacteria 2305
73 Ga0068871_100003322 3300006358 Bacteria 11044
74 Ga0068871_100104713 3300006358 Unclassified 2373
75 Ga0068871_100308370 3300006358 Bacteria 1391
76 Ga0075428_100040843 3300006844 Bacteria 5102
77 Ga0075428_100199883 3300006844 Bacteria 2161
78 Ga0075428_100659593 3300006844 Bacteria 1115
79 Ga0075428_100963515 3300006844 Unclassified 904
80 Ga0075430_100007947 3300006846 Bacteria 8966
81 Ga0075430_100012111 3300006846 Bacteria 7344
82 Ga0075430_100713866 3300006846 Unclassified 826
83 Ga0075431_100030150 3300006847 Bacteria 5586
84 Ga0075431_100176645 3300006847 Bacteria 2193
85 Ga0075431_100445913 3300006847 Bacteria 1290
86 Ga0075433_10348671 3300006852 Bacteria 1308
87 Ga0075429_100192675 3300006880 Bacteria 1786
88 Ga0075429_100209284 3300006880 Bacteria 1709
89 Ga0075429_100386876 3300006880 Bacteria 1225
90 Ga0097620_100093194 3300006931 Bacteria 3064
91 Ga0097620_100761650 3300006931 Bacteria 1057
92 Ga0111539_10040310 3300009094 Bacteria 5624
93 Ga0111539_10091809 3300009094 Bacteria 3567
94 Ga0111539_10118256 3300009094 Bacteria 3106
95 Ga0111539_10231863 3300009094 Bacteria 2150
96 Ga0111539_10341327 3300009094 Bacteria 1743
97 Ga0105245_10041235 3300009098 Bacteria 4115
98 Ga0105245_10049128 3300009098 Bacteria 3776
99 Ga0114129_10050951 3300009147 Bacteria 5813
100 Ga0114129_10222913 3300009147 Bacteria 2543
101 Ga0114129_10446051 3300009147 Bacteria 1698
102 Ga0114129_10856611 3300009147 Bacteria 1155
103 Ga0105242_10022042 3300009176 Bacteria 5005
104 Ga0105242_10088817 3300009176 Bacteria 2597
105 Ga0105248_10010347 3300009177 Bacteria 10269
106 Ga0105248_10067273 3300009177 Bacteria 4022
107 Ga0105248_10154331 3300009177 Bacteria 2591
108 Ga0105248_10895800 3300009177 Bacteria 1002
109 Ga0105248_11325575 3300009177 Unclassified 814
110 Ga0105237_10278979 3300009545 Bacteria 1674
111 Ga0105237_10571489 3300009545 Unclassified 1137
112 Ga0105237_11293131 3300009545 Unclassified 736
113 Ga0105249_10927676 3300009553 Bacteria 938
114 Ga0105249_11061842 3300009553 Bacteria 879
115 Ga0105246_10198962 3300011119 Unclassified 1556
116 Ga0157374_10555219 3300013296 Bacteria 1156
117 Ga0157374_10809388 3300013296 Unclassified 953
118 Ga0157378_10043921 3300013297 Bacteria 3967
119 Ga0157378_10516020 3300013297 Unclassified 1196
120 Ga0157378_10589719 3300013297 Bacteria 1121
121 Ga0157378_11014348 3300013297 Unclassified 865
122 Ga0163162_10023057 3300013306 Bacteria 6140
123 Ga0163162_10069453 3300013306 Bacteria 3575
124 Ga0157375_10025550 3300013308 Bacteria 5490
125 Ga0157375_10095918 3300013308 Unclassified 3038
126 Ga0157375_10244462 3300013308 Unclassified 1954
127 Ga0157375_10681679 3300013308 Unclassified 1182
128 Ga0157375_10697207 3300013308 Bacteria 1169
129 Ga0157375_11585503 3300013308 Unclassified 774
130 Ga0163163_10002495 3300014325 Bacteria 15562
131 Ga0163163_10016668 3300014325 Bacteria 6833
132 Ga0163163_10024660 3300014325 Bacteria 5726
133 Ga0163163_10216404 3300014325 Bacteria 1965
134 Ga0163163_10275321 3300014325 Bacteria 1734
135 Ga0157380_10006079 3300014326 Bacteria 8462
136 Ga0157380_10032348 3300014326 Bacteria 4023
137 Ga0157380_10086179 3300014326 Bacteria 2580
138 Ga0157380_10101472 3300014326 Bacteria 2398
139 Ga0157377_10107401 3300014745 Bacteria 1673
140 Ga0157376_10192789 3300014969 Bacteria 1870
141 Ga0157376_10297313 3300014969 Unclassified 1527
142 Ga0157376_10609510 3300014969 Bacteria 1087
143 Ga0163161_10473768 3300017792 Bacteria 1015
144 Ga0207682_10102522 3300025893 Bacteria 1252
145 Ga0207671_10092512 3300025914 Bacteria 2280
146 Ga0207671_10357101 3300025914 Bacteria 1159
147 Ga0207660_10567820 3300025917 Bacteria 923
148 Ga0207662_10082509 3300025918 Bacteria 1964
149 Ga0207681_10277705 3300025923 Bacteria 1318
150 Ga0207650_10003895 3300025925 Bacteria 10203
151 Ga0207650_10264700 3300025925 Bacteria 1396
152 Ga0207650_10304355 3300025925 Bacteria 1303
153 Ga0207650_10502075 3300025925 Bacteria 1014
154 Ga0207659_10002199 3300025926 Bacteria 11594
155 Ga0207659_10037011 3300025926 Bacteria 3385
156 Ga0207659_10117334 3300025926 Unclassified 2034
157 Ga0207687_10025919 3300025927 Bacteria 3924
158 Ga0207687_10083290 3300025927 Bacteria 2315
159 Ga0207644_10003671 3300025931 Bacteria 9952
160 Ga0207706_10613273 3300025933 Bacteria 934
161 Ga0207706_10908306 3300025933 Bacteria 743
162 Ga0207686_10003288 3300025934 Bacteria 8689
163 Ga0207686_10316322 3300025934 Unclassified 1165
164 Ga0207686_10497635 3300025934 Unclassified 945
165 Ga0207670_10187619 3300025936 Bacteria 1562
166 Ga0207670_10615998 3300025936 Bacteria 892
167 Ga0207669_10689341 3300025937 Unclassified 839
168 Ga0207691_10013906 3300025940 Bacteria 7679
169 Ga0207691_10106883 3300025940 Bacteria 2492
170 Ga0207691_10215879 3300025940 Bacteria 1665
171 Ga0207711_10111399 3300025941 Bacteria 2434
172 Ga0207711_10112742 3300025941 Bacteria 2420
173 Ga0207711_10605468 3300025941 Unclassified 1022
174 Ga0207679_10035327 3300025945 Bacteria 3535
175 Ga0207679_10173759 3300025945 Bacteria 1776
176 Ga0207651_10088900 3300025960 Bacteria 2253
177 Ga0207712_10483223 3300025961 Bacteria 1056
178 Ga0207658_10027715 3300025986 Bacteria 3983
179 Ga0207677_10012954 3300026023 Bacteria 4817
180 Ga0207703_10045683 3300026035 Bacteria 3524
181 Ga0207703_10118966 3300026035 Bacteria 2265
182 Ga0207703_10230848 3300026035 Bacteria 1659
183 Ga0207639_10570425 3300026041 Bacteria 1041
184 Ga0207678_10734665 3300026067 Bacteria 870
185 Ga0207708_10077217 3300026075 Bacteria 2556
186 Ga0207708_10194869 3300026075 Bacteria 1614
187 Ga0207708_10436213 3300026075 Bacteria 1089
188 Ga0207702_10304303 3300026078 Bacteria 1514
189 Ga0207641_10117335 3300026088 Bacteria 2370
190 Ga0207641_10285694 3300026088 Unclassified 1553
191 Ga0207641_11128046 3300026088 Unclassified 783
192 Ga0207648_10735500 3300026089 Bacteria 916
193 Ga0207648_10830164 3300026089 Bacteria 861
194 Ga0207676_10021460 3300026095 Bacteria 4737
195 Ga0207676_10332706 3300026095 Bacteria 1398
196 Ga0207676_10711384 3300026095 Unclassified 974
197 Ga0207683_10222639 3300026121 Bacteria 1719
198 Ga0209813_10017109 3300027866 Bacteria 1986
199 Ga0207428_10002585 3300027907 Bacteria 18073
200 Ga0207428_10022553 3300027907 Bacteria 5310
201 Ga0268266_10079434 3300028379 Bacteria 2856
202 Ga0307408_100130306 3300031548 Bacteria 1961
203 Ga0307408_100666498 3300031548 Bacteria 932
204 Ga0265314_10124048 3300031711 Bacteria 1621
205 Ga0307405_10016050 3300031731 Bacteria 4074
206 Ga0307405_10060099 3300031731 Bacteria 2397
207 Ga0307405_10132678 3300031731 Bacteria 1724
208 Ga0307413_10096396 3300031824 Bacteria 1942
209 Ga0307413_10174858 3300031824 Bacteria 1524
210 Ga0307410_10065265 3300031852 Bacteria 2504
211 Ga0307410_10125524 3300031852 Bacteria 1878
212 Ga0307410_10189032 3300031852 Bacteria 1565
213 Ga0307407_10031842 3300031903 Bacteria 2861
214 Ga0307412_10065272 3300031911 Bacteria 2463
215 Ga0307412_10762840 3300031911 Bacteria 836
216 Ga0307412_11066380 3300031911 Bacteria 717
217 Ga0307409_100005844 3300031995 Bacteria 7143
218 Ga0307409_100120802 3300031995 Bacteria 2218
219 Ga0307409_100949562 3300031995 Bacteria 876
220 Ga0307416_100067358 3300032002 Bacteria 2952
221 Ga0307416_100131693 3300032002 Bacteria 2252
222 Ga0307416_100939124 3300032002 Bacteria 966
223 Ga0307414_10075731 3300032004 Bacteria 2443
224 Ga0307411_10526795 3300032005 Bacteria 1004
225 Ga0307415_100236183 3300032126 Bacteria 1476
226 Ga0373957_0071889 3300035120 Bacteria 1354
227 Ga0373955_0036546 3300035172 Bacteria 2607
228 Ga0373955_0389259 3300035172 Bacteria 846
229 Ga0373924_0105524 3300035410 Bacteria 1215
230 Ga0373937_0017211 3300036401 Bacteria 6435
231 Ga0373937_0041621 3300036401 Bacteria 4190
232 Ga0373937_0115390 3300036401 Bacteria 2501
233 Ga0373937_0192415 3300036401 Bacteria 1917
234 Ga0439453_0031190 3300041408 Bacteria 1011
235 Ga0439433_0001690 3300041999 Bacteria 4603
236 Ga0439433_0024246 3300041999 Bacteria 1366
237 Ga0439442_067919 3300042002 Bacteria 758
238 Ga0439462_0048289 3300042015 Bacteria 1141
239 Ga0450923_003441 3300042125 Unclassified 2389
240 Ga0439446_0002406 3300042156 Bacteria 4485
241 Ga0439435_0005184 3300042436 Bacteria 2855
242 Ga0439464_0099360 3300042439 Bacteria 883
243 Ga0450916_009965 3300042530 Bacteria 1180
244 Ga0495592_0034640 3300046454 Bacteria 3805
245 Ga0495638_0013750 3300046460 Bacteria 5498
246 Ga0495580_0091348 3300046472 Bacteria 2119
247 Ga0495639_0089433 3300046475 Bacteria 1443
248 Ga0495618_0075438 3300046514 Bacteria 2148
249 Ga0495630_0265172 3300046517 Bacteria 1312
250 Ga0495667_0032731 3300046559 Bacteria 3481
251 Ga0495634_0198867 3300046642 Bacteria 1246
252 Ga0495657_0002296 3300046675 Bacteria 16157
253 Ga0495599_0042943 3300046678 Bacteria 2837
254 Ga0495658_0092756 3300046683 Bacteria 1791
255 Ga0495613_0021719 3300046689 Bacteria 4782
256 Ga0495613_0038405 3300046689 Bacteria 3549
257 Ga0495613_0467563 3300046689 Bacteria 853
258 Ga0495636_0252766 3300047318 Bacteria 815
259 Ga0495674_0144564 3300047319 Bacteria 1997
260 Ga0495672_0037582 3300047320 Bacteria 2961
261 Ga0495676_0364198 3300047321 Bacteria 965
262 Ga0495675_0294961 3300047444 Bacteria 964
263 Ga0495684_0671762 3300047471 Unclassified 690
264 Ga0496106_0602700 3300048909 Bacteria 880
265 Ga0496110_0252348 3300048913 Bacteria 1606
266 Ga0496112_0283258 3300048915 Bacteria 1604
267 Ga0496113_0794084 3300048916 Unclassified 752
268 Ga0501036_0374864 3300049572 Bacteria 1188
269 Ga0501042_0053513 3300049578 Bacteria 2880
270 Ga0501042_0403964 3300049578 Bacteria 990
271 Ga0501048_0597917 3300049582 Bacteria 792
272 Ga0501048_0738335 3300049582 Bacteria 707
273 Ga0501071_0380971 3300049587 Bacteria 1076
274 Ga0501071_0540596 3300049587 Bacteria 895
275 Ga0501072_0113138 3300049588 Bacteria 2161
276 Ga0501073_0011091 3300049589 Bacteria 6592
277 Ga0501075_0043287 3300049591 Bacteria 3377
278 Ga0501076_0175734 3300049592 Bacteria 1745
279 Ga0501077_0415654 3300049593 Bacteria 860
280 Ga0501249_095053 3300049679 Bacteria 710
281 Ga0501079_0523352 3300049741 Bacteria 932
282 Ga0501079_0909881 3300049741 Bacteria 693
283 Ga0501283_074923 3300049779 Bacteria 629
284 Ga0501045_0014212 3300049824 Bacteria 5640
285 nmdc:mga00v17_98806_c1 3300050491 Bacteria 1841
286 nmdc:mga0k408_208342_c1 3300050493 Bacteria 1167
287 nmdc:mga0k408_269546_c1 3300050493 Bacteria 1016
288 nmdc:mga0k408_66536_c1 3300050493 Bacteria 2099
289 nmdc:mga06z11_26312_c1 3300050494 Bacteria 2768
290 nmdc:mga06z11_59909_c1 3300050494 Bacteria 1980
291 nmdc:mga06z11_601988_c1 3300050494 Bacteria 668
292 nmdc:mga04h51_81624_c1 3300050495 Bacteria 1149
293 nmdc:mga05p37_1065123_c1 3300050507 Bacteria 851
294 nmdc:mga05p37_156889_c1 3300050507 Bacteria 2781
295 nmdc:mga05p37_314843_c1 3300050507 Bacteria 1854
296 nmdc:mga05p37_498383_c1 3300050507 Bacteria 1398
297 nmdc:mga05p37_6390_c1 3300050507 Bacteria 13888
298 nmdc:mga09592_216068_c1 3300050508 Bacteria 1661
299 nmdc:mga09592_228506_c1 3300050508 Bacteria 1612
300 nmdc:mga0qj67_26160_c1 3300050509 Bacteria 4516
301 nmdc:mga0qj67_319370_c1 3300050509 Bacteria 1257
302 nmdc:mga0qj67_9069_c1 3300050509 Bacteria 7384
303 nmdc:mga06r32_198058_c1 3300050510 Bacteria 1996
304 nmdc:mga06r32_37164_c1 3300050510 Bacteria 4606
305 nmdc:mga06r32_519283_c1 3300050510 Bacteria 1167
306 nmdc:mga06r32_85653_c1 3300050510 Bacteria 3073
307 nmdc:mga08y16_143533_c1 3300050511 Bacteria 2482
308 nmdc:mga08y16_4144_c1 3300050511 Bacteria 15133
309 nmdc:mga08y16_69898_c1 3300050511 Bacteria 3660
310 nmdc:mga0n895_28518_c2 3300050512 Bacteria 3219
311 nmdc:mga0rr50_569020_c1 3300050513 Bacteria 965
312 nmdc:mga0a205_22963_c1 3300050515 Bacteria 5915
313 nmdc:mga0sz30_114429_c1 3300050516 Bacteria 1183
314 Ga0495619_0211108 3300053085 Bacteria 1344
315 Ga0500646_0124698 3300053090 Bacteria 831
316 Ga0500641_0001989 3300053096 Bacteria 7252
317 Ga0500555_007247 3300053103 Bacteria 3153
318 Ga0500556_0004903 3300053104 Bacteria 3788
319 Ga0500658_0293281 3300053134 Bacteria 748
320 Ga0500568_0001250 3300053139 Bacteria 16849
321 Ga0501084_0580210 3300054114 Bacteria 948
322 Ga0501082_0023640 3300060353 Bacteria 5301

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006186 Ga0075369_10137664 Ga0075369_101376642 170
2 3300009545 Ga0105237_10278979 Ga0105237_102789793 170
3 3300006051 Ga0075364_10113703 Ga0075364_101137032 181
4 3300006353 Ga0075370_10052882 Ga0075370_100528822 181
5 3300009553 Ga0105249_10927676 Ga0105249_109276761 181
6 3300025961 Ga0207712_10483223 Ga0207712_104832232 182
7 3300050491 nmdc:mga00v17_98806_c1 nmdc:mga00v17_98806_c1_496_1125 182
8 3300005366 Ga0070659_100398793 Ga0070659_1003987932 186
9 3300005365 Ga0070688_100019561 Ga0070688_1000195614 187
10 3300050516 nmdc:mga0sz30_114429_c1 nmdc:mga0sz30_114429_c1_424_993 189
11 3300049578 Ga0501042_0403964 Ga0501042_0403964_364_942 191
12 3300013297 Ga0157378_10043921 Ga0157378_100439213 192
13 3300005335 Ga0070666_10309335 Ga0070666_103093351 197
14 3300005535 Ga0070684_100084753 Ga0070684_1000847534 197
15 3300005577 Ga0068857_100467190 Ga0068857_1004671901 197
16 3300005614 Ga0068856_100319922 Ga0068856_1003199222 197
17 3300005841 Ga0068863_100428339 Ga0068863_1004283392 197
18 3300006844 Ga0075428_100963515 Ga0075428_1009635151 197
19 3300009177 Ga0105248_10067273 Ga0105248_100672732 197
20 3300009545 Ga0105237_10571489 Ga0105237_105714891 197
21 3300013306 Ga0163162_10069453 Ga0163162_100694536 197
22 3300025927 Ga0207687_10025919 Ga0207687_100259192 197
23 3300025934 Ga0207686_10003288 Ga0207686_100032886 197
24 3300025934 Ga0207686_10497635 Ga0207686_104976351 197
25 3300025941 Ga0207711_10605468 Ga0207711_106054682 197
26 3300026035 Ga0207703_10230848 Ga0207703_102308481 197
27 3300026078 Ga0207702_10304303 Ga0207702_103043031 197
28 3300049572 Ga0501036_0374864 Ga0501036_0374864_66_662 197
29 3300049582 Ga0501048_0738335 Ga0501048_0738335_97_693 197
30 3300049587 Ga0501071_0380971 Ga0501071_0380971_346_942 197
31 3300049587 Ga0501071_0540596 Ga0501071_0540596_191_787 197
32 3300049741 Ga0501079_0523352 Ga0501079_0523352_312_908 197
33 3300006844 Ga0075428_100040843 Ga0075428_1000408433 198
34 3300006846 Ga0075430_100007947 Ga0075430_1000079475 198
35 3300006846 Ga0075430_100713866 Ga0075430_1007138661 198
36 3300006847 Ga0075431_100030150 Ga0075431_1000301506 198
37 3300013297 Ga0157378_10516020 Ga0157378_105160203 198
38 3300031548 Ga0307408_100130306 Ga0307408_1001303062 198
39 3300031731 Ga0307405_10016050 Ga0307405_100160502 198
40 3300031852 Ga0307410_10065265 Ga0307410_100652652 198
41 3300031911 Ga0307412_10065272 Ga0307412_100652722 198
42 3300031911 Ga0307412_11066380 Ga0307412_110663801 198
43 3300032002 Ga0307416_100939124 Ga0307416_1009391242 198
44 3300049679 Ga0501249_095053 Ga0501249_095053_73_672 198
45 3300049779 Ga0501283_074923 Ga0501283_074923_15_614 198
46 3300050508 nmdc:mga09592_228506_c1 nmdc:mga09592_228506_c1_503_1102 198
47 3300050509 nmdc:mga0qj67_319370_c1 nmdc:mga0qj67_319370_c1_515_1111 198
48 3300050509 nmdc:mga0qj67_9069_c1 nmdc:mga0qj67_9069_c1_4063_4662 198
49 3300050510 nmdc:mga06r32_37164_c1 nmdc:mga06r32_37164_c1_1119_1718 198
50 3300054114 Ga0501084_0580210 Ga0501084_0580210_38_637 198
51 3300005330 Ga0070690_100015830 Ga0070690_1000158303 199
52 3300005331 Ga0070670_100033125 Ga0070670_1000331254 199
53 3300005336 Ga0070680_100872640 Ga0070680_1008726401 199
54 3300005338 Ga0068868_100002519 Ga0068868_10000251914 199
55 3300005340 Ga0070689_100084633 Ga0070689_1000846333 199
56 3300005343 Ga0070687_100039040 Ga0070687_1000390404 199
57 3300005344 Ga0070661_100082209 Ga0070661_1000822094 199
58 3300005354 Ga0070675_100436283 Ga0070675_1004362833 199
59 3300005356 Ga0070674_100163876 Ga0070674_1001638762 199
60 3300005364 Ga0070673_100069421 Ga0070673_1000694214 199
61 3300005367 Ga0070667_100025796 Ga0070667_1000257964 199
62 3300005406 Ga0070703_10152222 Ga0070703_101522221 199
63 3300005440 Ga0070705_100400639 Ga0070705_1004006392 199
64 3300005455 Ga0070663_100598496 Ga0070663_1005984962 199
65 3300005459 Ga0068867_100357220 Ga0068867_1003572201 199
66 3300005539 Ga0068853_100506602 Ga0068853_1005066022 199
67 3300005543 Ga0070672_100036199 Ga0070672_1000361991 199
68 3300005546 Ga0070696_100671437 Ga0070696_1006714371 199
69 3300005549 Ga0070704_100258103 Ga0070704_1002581032 199
70 3300005564 Ga0070664_100027963 Ga0070664_1000279636 199
71 3300005564 Ga0070664_100236363 Ga0070664_1002363632 199
72 3300005617 Ga0068859_100093192 Ga0068859_1000931922 199
73 3300005618 Ga0068864_100004341 Ga0068864_10000434113 199
74 3300005618 Ga0068864_100574621 Ga0068864_1005746212 199
75 3300005840 Ga0068870_10119270 Ga0068870_101192703 199
76 3300005841 Ga0068863_100013820 Ga0068863_1000138207 199
77 3300005842 Ga0068858_100040680 Ga0068858_1000406802 199
78 3300005842 Ga0068858_100414304 Ga0068858_1004143042 199
79 3300005843 Ga0068860_100665130 Ga0068860_1006651302 199
80 3300006237 Ga0097621_100224227 Ga0097621_1002242272 199
81 3300006358 Ga0068871_100003322 Ga0068871_10000332210 199
82 3300006358 Ga0068871_100104713 Ga0068871_1001047132 199
83 3300006358 Ga0068871_100308370 Ga0068871_1003083702 199
84 3300006844 Ga0075428_100659593 Ga0075428_1006595932 199
85 3300006847 Ga0075431_100445913 Ga0075431_1004459132 199
86 3300006852 Ga0075433_10348671 Ga0075433_103486712 199
87 3300006880 Ga0075429_100386876 Ga0075429_1003868762 199
88 3300006931 Ga0097620_100093194 Ga0097620_1000931944 199
89 3300009094 Ga0111539_10040310 Ga0111539_100403104 199
90 3300009094 Ga0111539_10231863 Ga0111539_102318632 199
91 3300009098 Ga0105245_10041235 Ga0105245_100412352 199
92 3300009098 Ga0105245_10049128 Ga0105245_100491282 199
93 3300009147 Ga0114129_10050951 Ga0114129_100509513 199
94 3300009147 Ga0114129_10446051 Ga0114129_104460512 199
95 3300009147 Ga0114129_10856611 Ga0114129_108566112 199
96 3300009176 Ga0105242_10022042 Ga0105242_100220422 199
97 3300009176 Ga0105242_10088817 Ga0105242_100888173 199
98 3300009177 Ga0105248_10010347 Ga0105248_100103473 199
99 3300009177 Ga0105248_10154331 Ga0105248_101543311 199
100 3300009177 Ga0105248_10895800 Ga0105248_108958002 199
101 3300009177 Ga0105248_11325575 Ga0105248_113255751 199
102 3300009545 Ga0105237_11293131 Ga0105237_112931311 199
103 3300011119 Ga0105246_10198962 Ga0105246_101989622 199
104 3300013296 Ga0157374_10555219 Ga0157374_105552192 199
105 3300013296 Ga0157374_10809388 Ga0157374_108093881 199
106 3300013297 Ga0157378_10589719 Ga0157378_105897191 199
107 3300013297 Ga0157378_11014348 Ga0157378_110143481 199
108 3300013306 Ga0163162_10023057 Ga0163162_100230575 199
109 3300013308 Ga0157375_10025550 Ga0157375_100255504 199
110 3300013308 Ga0157375_10095918 Ga0157375_100959184 199
111 3300013308 Ga0157375_10681679 Ga0157375_106816792 199
112 3300013308 Ga0157375_10697207 Ga0157375_106972071 199
113 3300013308 Ga0157375_11585503 Ga0157375_115855031 199
114 3300014325 Ga0163163_10002495 Ga0163163_100024955 199
115 3300014325 Ga0163163_10016668 Ga0163163_100166687 199
116 3300014325 Ga0163163_10024660 Ga0163163_100246606 199
117 3300014325 Ga0163163_10275321 Ga0163163_102753212 199
118 3300014745 Ga0157377_10107401 Ga0157377_101074012 199
119 3300014969 Ga0157376_10192789 Ga0157376_101927893 199
120 3300014969 Ga0157376_10297313 Ga0157376_102973132 199
121 3300017792 Ga0163161_10473768 Ga0163161_104737682 199
122 3300025914 Ga0207671_10092512 Ga0207671_100925123 199
123 3300025914 Ga0207671_10357101 Ga0207671_103571012 199
124 3300025917 Ga0207660_10567820 Ga0207660_105678201 199
125 3300025918 Ga0207662_10082509 Ga0207662_100825092 199
126 3300025925 Ga0207650_10003895 Ga0207650_100038952 199
127 3300025925 Ga0207650_10502075 Ga0207650_105020752 199
128 3300025926 Ga0207659_10002199 Ga0207659_1000219914 199
129 3300025926 Ga0207659_10117334 Ga0207659_101173343 199
130 3300025927 Ga0207687_10083290 Ga0207687_100832902 199
131 3300025931 Ga0207644_10003671 Ga0207644_1000367110 199
132 3300025933 Ga0207706_10613273 Ga0207706_106132731 199
133 3300025934 Ga0207686_10316322 Ga0207686_103163222 199
134 3300025936 Ga0207670_10187619 Ga0207670_101876192 199
135 3300025937 Ga0207669_10689341 Ga0207669_106893412 199
136 3300025940 Ga0207691_10013906 Ga0207691_100139066 199
137 3300025940 Ga0207691_10215879 Ga0207691_102158792 199
138 3300025941 Ga0207711_10111399 Ga0207711_101113993 199
139 3300025941 Ga0207711_10112742 Ga0207711_101127423 199
140 3300025945 Ga0207679_10035327 Ga0207679_100353271 199
141 3300025960 Ga0207651_10088900 Ga0207651_100889002 199
142 3300025986 Ga0207658_10027715 Ga0207658_100277155 199
143 3300026023 Ga0207677_10012954 Ga0207677_100129544 199
144 3300026035 Ga0207703_10045683 Ga0207703_100456832 199
145 3300026035 Ga0207703_10118966 Ga0207703_101189662 199
146 3300026041 Ga0207639_10570425 Ga0207639_105704251 199
147 3300026067 Ga0207678_10734665 Ga0207678_107346652 199
148 3300026075 Ga0207708_10077217 Ga0207708_100772173 199
149 3300026075 Ga0207708_10194869 Ga0207708_101948692 199
150 3300026088 Ga0207641_10117335 Ga0207641_101173353 199
151 3300026088 Ga0207641_10285694 Ga0207641_102856942 199
152 3300026088 Ga0207641_11128046 Ga0207641_111280462 199
153 3300026089 Ga0207648_10830164 Ga0207648_108301641 199
154 3300026095 Ga0207676_10021460 Ga0207676_100214603 199
155 3300026095 Ga0207676_10332706 Ga0207676_103327062 199
156 3300026095 Ga0207676_10711384 Ga0207676_107113841 199
157 3300026121 Ga0207683_10222639 Ga0207683_102226392 199
158 3300027907 Ga0207428_10002585 Ga0207428_100025858 199
159 3300027907 Ga0207428_10022553 Ga0207428_100225535 199
160 3300028379 Ga0268266_10079434 Ga0268266_100794344 199
161 3300031548 Ga0307408_100666498 Ga0307408_1006664982 199
162 3300031731 Ga0307405_10060099 Ga0307405_100600992 199
163 3300031824 Ga0307413_10096396 Ga0307413_100963962 199
164 3300031852 Ga0307410_10125524 Ga0307410_101255241 199
165 3300031852 Ga0307410_10189032 Ga0307410_101890322 199
166 3300031903 Ga0307407_10031842 Ga0307407_100318424 199
167 3300031911 Ga0307412_10762840 Ga0307412_107628401 199
168 3300031995 Ga0307409_100005844 Ga0307409_1000058442 199
169 3300031995 Ga0307409_100949562 Ga0307409_1009495622 199
170 3300032005 Ga0307411_10526795 Ga0307411_105267952 199
171 3300035120 Ga0373957_0071889 Ga0373957_0071889_474_1103 199
172 3300035172 Ga0373955_0036546 Ga0373955_0036546_1140_1793 199
173 3300035172 Ga0373955_0389259 Ga0373955_0389259_190_819 199
174 3300035410 Ga0373924_0105524 Ga0373924_0105524_250_879 199
175 3300036401 Ga0373937_0017211 Ga0373937_0017211_3488_4138 199
176 3300036401 Ga0373937_0041621 Ga0373937_0041621_94_723 199
177 3300036401 Ga0373937_0115390 Ga0373937_0115390_1432_2061 199
178 3300036401 Ga0373937_0192415 Ga0373937_0192415_1270_1899 199
179 3300042530 Ga0450916_009965 Ga0450916_009965_87_689 199
180 3300046454 Ga0495592_0034640 Ga0495592_0034640_3073_3702 199
181 3300046472 Ga0495580_0091348 Ga0495580_0091348_417_1046 199
182 3300046475 Ga0495639_0089433 Ga0495639_0089433_365_994 199
183 3300046514 Ga0495618_0075438 Ga0495618_0075438_1357_1986 199
184 3300046517 Ga0495630_0265172 Ga0495630_0265172_382_1011 199
185 3300046559 Ga0495667_0032731 Ga0495667_0032731_1790_2419 199
186 3300046642 Ga0495634_0198867 Ga0495634_0198867_268_897 199
187 3300046675 Ga0495657_0002296 Ga0495657_0002296_678_1307 199
188 3300046678 Ga0495599_0042943 Ga0495599_0042943_1752_2381 199
189 3300046683 Ga0495658_0092756 Ga0495658_0092756_816_1445 199
190 3300046689 Ga0495613_0021719 Ga0495613_0021719_3669_4298 199
191 3300046689 Ga0495613_0038405 Ga0495613_0038405_816_1445 199
192 3300046689 Ga0495613_0467563 Ga0495613_0467563_127_756 199
193 3300047318 Ga0495636_0252766 Ga0495636_0252766_133_756 199
194 3300047319 Ga0495674_0144564 Ga0495674_0144564_408_1037 199
195 3300047320 Ga0495672_0037582 Ga0495672_0037582_1617_2216 199
196 3300047321 Ga0495676_0364198 Ga0495676_0364198_20_622 199
197 3300047444 Ga0495675_0294961 Ga0495675_0294961_288_917 199
198 3300047471 Ga0495684_0671762 Ga0495684_0671762_49_678 199
199 3300048915 Ga0496112_0283258 Ga0496112_0283258_316_939 199
200 3300048916 Ga0496113_0794084 Ga0496113_0794084_100_723 199
201 3300049578 Ga0501042_0053513 Ga0501042_0053513_967_1569 199
202 3300049582 Ga0501048_0597917 Ga0501048_0597917_38_640 199
203 3300049589 Ga0501073_0011091 Ga0501073_0011091_3251_3853 199
204 3300049593 Ga0501077_0415654 Ga0501077_0415654_66_665 199
205 3300050493 nmdc:mga0k408_269546_c1 nmdc:mga0k408_269546_c1_159_758 199
206 3300050494 nmdc:mga06z11_59909_c1 nmdc:mga06z11_59909_c1_311_910 199
207 3300050494 nmdc:mga06z11_601988_c1 nmdc:mga06z11_601988_c1_44_643 199
208 3300050507 nmdc:mga05p37_1065123_c1 nmdc:mga05p37_1065123_c1_109_708 199
209 3300050507 nmdc:mga05p37_156889_c1 nmdc:mga05p37_156889_c1_1973_2575 199
210 3300050507 nmdc:mga05p37_6390_c1 nmdc:mga05p37_6390_c1_4825_5424 199
211 3300050509 nmdc:mga0qj67_26160_c1 nmdc:mga0qj67_26160_c1_1102_1701 199
212 3300050510 nmdc:mga06r32_519283_c1 nmdc:mga06r32_519283_c1_308_907 199
213 3300050510 nmdc:mga06r32_85653_c1 nmdc:mga06r32_85653_c1_2014_2613 199
214 3300050511 nmdc:mga08y16_143533_c1 nmdc:mga08y16_143533_c1_1037_1675 199
215 3300050511 nmdc:mga08y16_4144_c1 nmdc:mga08y16_4144_c1_7684_8286 199
216 3300050515 nmdc:mga0a205_22963_c1 nmdc:mga0a205_22963_c1_4703_5305 199
217 3300053085 Ga0495619_0211108 Ga0495619_0211108_318_947 199
218 3300053104 Ga0500556_0004903 Ga0500556_0004903_2861_3460 199
219 3300053139 Ga0500568_0001250 Ga0500568_0001250_8096_8695 199
220 3300005333 Ga0070677_10014120 Ga0070677_100141202 200
221 3300005444 Ga0070694_100303170 Ga0070694_1003031702 200
222 3300014969 Ga0157376_10609510 Ga0157376_106095102 200
223 3300031711 Ga0265314_10124048 Ga0265314_101240482 200
224 3300005290 Ga0065712_10001091 Ga0065712_100010919 201
225 3300005290 Ga0065712_10126892 Ga0065712_101268922 201
226 3300005331 Ga0070670_100413924 Ga0070670_1004139242 201
227 3300005331 Ga0070670_100639346 Ga0070670_1006393461 201
228 3300005333 Ga0070677_10059186 Ga0070677_100591862 201
229 3300005340 Ga0070689_100486914 Ga0070689_1004869142 201
230 3300005344 Ga0070661_100222388 Ga0070661_1002223882 201
231 3300005354 Ga0070675_100170757 Ga0070675_1001707572 201
232 3300005364 Ga0070673_100381104 Ga0070673_1003811042 201
233 3300005438 Ga0070701_10288916 Ga0070701_102889161 201
234 3300005441 Ga0070700_100011402 Ga0070700_1000114022 201
235 3300005441 Ga0070700_100333794 Ga0070700_1003337942 201
236 3300005459 Ga0068867_100274648 Ga0068867_1002746483 201
237 3300005468 Ga0070707_100533300 Ga0070707_1005333002 201
238 3300005471 Ga0070698_100013300 Ga0070698_1000133005 201
239 3300005471 Ga0070698_100807389 Ga0070698_1008073891 201
240 3300005518 Ga0070699_100000583 Ga0070699_10000058328 201
241 3300005536 Ga0070697_100151682 Ga0070697_1001516823 201
242 3300005543 Ga0070672_100028826 Ga0070672_1000288264 201
243 3300005549 Ga0070704_100051031 Ga0070704_1000510313 201
244 3300005564 Ga0070664_100068344 Ga0070664_1000683443 201
245 3300005617 Ga0068859_100132982 Ga0068859_1001329821 201
246 3300005617 Ga0068859_100761620 Ga0068859_1007616201 201
247 3300005719 Ga0068861_100378294 Ga0068861_1003782941 201
248 3300006042 Ga0075368_10060018 Ga0075368_100600182 201
249 3300006048 Ga0075363_100194642 Ga0075363_1001946422 201
250 3300006051 Ga0075364_10223328 Ga0075364_102233282 201
251 3300006178 Ga0075367_10147151 Ga0075367_101471512 201
252 3300006195 Ga0075366_10094215 Ga0075366_100942152 201
253 3300006195 Ga0075366_10231405 Ga0075366_102314051 201
254 3300006844 Ga0075428_100199883 Ga0075428_1001998833 201
255 3300006846 Ga0075430_100012111 Ga0075430_1000121113 201
256 3300006847 Ga0075431_100176645 Ga0075431_1001766453 201
257 3300006880 Ga0075429_100192675 Ga0075429_1001926752 201
258 3300006880 Ga0075429_100209284 Ga0075429_1002092843 201
259 3300006931 Ga0097620_100761650 Ga0097620_1007616502 201
260 3300009094 Ga0111539_10091809 Ga0111539_100918092 201
261 3300009094 Ga0111539_10118256 Ga0111539_101182562 201
262 3300009094 Ga0111539_10341327 Ga0111539_103413272 201
263 3300009147 Ga0114129_10222913 Ga0114129_102229132 201
264 3300009553 Ga0105249_11061842 Ga0105249_110618421 201
265 3300013308 Ga0157375_10244462 Ga0157375_102444622 201
266 3300014325 Ga0163163_10216404 Ga0163163_102164042 201
267 3300014326 Ga0157380_10006079 Ga0157380_100060796 201
268 3300014326 Ga0157380_10032348 Ga0157380_100323482 201
269 3300014326 Ga0157380_10086179 Ga0157380_100861792 201
270 3300014326 Ga0157380_10101472 Ga0157380_101014723 201
271 3300025893 Ga0207682_10102522 Ga0207682_101025221 201
272 3300025923 Ga0207681_10277705 Ga0207681_102777052 201
273 3300025925 Ga0207650_10264700 Ga0207650_102647002 201
274 3300025925 Ga0207650_10304355 Ga0207650_103043552 201
275 3300025926 Ga0207659_10037011 Ga0207659_100370116 201
276 3300025933 Ga0207706_10908306 Ga0207706_109083061 201
277 3300025936 Ga0207670_10615998 Ga0207670_106159982 201
278 3300025940 Ga0207691_10106883 Ga0207691_101068833 201
279 3300025945 Ga0207679_10173759 Ga0207679_101737592 201
280 3300026075 Ga0207708_10436213 Ga0207708_104362131 201
281 3300026089 Ga0207648_10735500 Ga0207648_107355001 201
282 3300027866 Ga0209813_10017109 Ga0209813_100171092 201
283 3300031731 Ga0307405_10132678 Ga0307405_101326782 201
284 3300031824 Ga0307413_10174858 Ga0307413_101748582 201
285 3300031995 Ga0307409_100120802 Ga0307409_1001208023 201
286 3300032002 Ga0307416_100067358 Ga0307416_1000673582 201
287 3300032002 Ga0307416_100131693 Ga0307416_1001316932 201
288 3300032004 Ga0307414_10075731 Ga0307414_100757313 201
289 3300032126 Ga0307415_100236183 Ga0307415_1002361832 201
290 3300041408 Ga0439453_0031190 Ga0439453_0031190_12_620 201
291 3300041999 Ga0439433_0001690 Ga0439433_0001690_1874_2503 201
292 3300041999 Ga0439433_0024246 Ga0439433_0024246_294_923 201
293 3300042002 Ga0439442_067919 Ga0439442_067919_34_663 201
294 3300042015 Ga0439462_0048289 Ga0439462_0048289_112_741 201
295 3300042125 Ga0450923_003441 Ga0450923_003441_1077_1706 201
296 3300042156 Ga0439446_0002406 Ga0439446_0002406_2863_3492 201
297 3300042436 Ga0439435_0005184 Ga0439435_0005184_1467_2075 201
298 3300042439 Ga0439464_0099360 Ga0439464_0099360_90_785 201
299 3300046460 Ga0495638_0013750 Ga0495638_0013750_4741_5370 201
300 3300048909 Ga0496106_0602700 Ga0496106_0602700_137_742 201
301 3300048913 Ga0496110_0252348 Ga0496110_0252348_906_1511 201
302 3300049588 Ga0501072_0113138 Ga0501072_0113138_1543_2151 201
303 3300049591 Ga0501075_0043287 Ga0501075_0043287_2630_3238 201
304 3300049592 Ga0501076_0175734 Ga0501076_0175734_76_684 201
305 3300049741 Ga0501079_0909881 Ga0501079_0909881_46_675 201
306 3300049824 Ga0501045_0014212 Ga0501045_0014212_516_1124 201
307 3300050493 nmdc:mga0k408_208342_c1 nmdc:mga0k408_208342_c1_58_690 201
308 3300050493 nmdc:mga0k408_66536_c1 nmdc:mga0k408_66536_c1_323_952 201
309 3300050494 nmdc:mga06z11_26312_c1 nmdc:mga06z11_26312_c1_2014_2643 201
310 3300050495 nmdc:mga04h51_81624_c1 nmdc:mga04h51_81624_c1_284_913 201
311 3300050507 nmdc:mga05p37_314843_c1 nmdc:mga05p37_314843_c1_1156_1785 201
312 3300050507 nmdc:mga05p37_498383_c1 nmdc:mga05p37_498383_c1_360_965 201
313 3300050508 nmdc:mga09592_216068_c1 nmdc:mga09592_216068_c1_686_1315 201
314 3300050510 nmdc:mga06r32_198058_c1 nmdc:mga06r32_198058_c1_1233_1862 201
315 3300050511 nmdc:mga08y16_69898_c1 nmdc:mga08y16_69898_c1_1301_1930 201
316 3300050512 nmdc:mga0n895_28518_c2 nmdc:mga0n895_28518_c2_141_770 201
317 3300050513 nmdc:mga0rr50_569020_c1 nmdc:mga0rr50_569020_c1_220_849 201
318 3300053090 Ga0500646_0124698 Ga0500646_0124698_178_807 201
319 3300053096 Ga0500641_0001989 Ga0500641_0001989_6372_7001 201
320 3300053103 Ga0500555_007247 Ga0500555_007247_2313_2966 201
321 3300053134 Ga0500658_0293281 Ga0500658_0293281_107_736 201
322 3300060353 Ga0501082_0023640 Ga0501082_0023640_1991_2599 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

46

225

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.8544 1 201
4q7c-assembly1.cif.gz_B structure of af2299, a cdp-alcohol phosphotransferase 0.7244 8 193
4q7c-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase 0.7051 8 193
4o6m-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) 0.6967 8 192
7b1l-assembly1.cif.gz_A crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. 0.6802 1 201
ID Description Score Start End Superfamily
af_O94584_24_237_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9143 2 198 1.20.120.1760
af_A0A1D8PF32_71_260_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.897 1 188 1.20.120.1760
af_O94584_24_237_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8926 2 198 1.20.120.1760
af_Q58609_4_200_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8887 3 201 1.20.120.1760
af_A0A1D8PF32_71_260_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8836 1 188 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A6P0EMV5-F1-model_v4 deleted 0.9725 3 89
AF-A0A068S3H5-F1-model_v4 Pyruvate carboxylase 0.9647 1 96 GO:0005524
GO:0008654
GO:0016020
GO:0016780
GO:0016874
GO:0046872
AF-A0A6P0EMV5-F1-model_v4 deleted 0.9509 3 89
AF-A0A1Y1YAZ4-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9324 3 201 GO:0008654
GO:0012505
GO:0016020
GO:0016780
AF-A0A015LXI4-F1-model_v4 CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) 0.9315 10 201 GO:0008654
GO:0012505
GO:0016020
GO:0016780

Feature Viewer

pLDDT pTM Quality
83.9 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map