F406396
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 322 | 188 | 322 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300006358|Ga0068871_100003322|Ga0068871_10000332210 |
| Length | 240 |
| Sequence | VPGPALYFAVTLNGFGIFLLFNGPLHEQDIFMETSGKKRLSMLRSYTTADLFTIGNATCGTLSIFLCLDYIAEANNRFLWIAFILLLAALFFDVFDGYWARRSGRQSILGADLDSLSDIISFGVAPAVLGFTLGMRGGWDMLILAFFVVCGISRLARFNVTAEALSGGTGKVKYFEGTPIPTSILIVLLLGVAFSRQAVDNDLWFGAYRVLSIATLHPLTLIYVLSGLGMISATIRIPKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 44 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 45 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 46 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 47 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 48 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 54 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 108 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 109 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 110 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 111 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 112 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 113 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 114 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 115 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 116 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 117 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 118 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 119 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 120 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 121 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 122 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 124 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 125 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 126 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 127 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 128 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 129 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 130 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 131 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 132 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 151 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 152 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 153 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 154 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 164 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 166 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 168 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 169 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 170 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 171 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 180 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 182 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 183 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 184 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 185 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 186 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 187 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.76 |
| Nodule | 0 |
| Rhizoplane | 1.24 |
| Rhizosphere | 90.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10001091 | 3300005290 | Bacteria | 8552 |
| 2 | Ga0065712_10126892 | 3300005290 | Bacteria | 1597 |
| 3 | Ga0070690_100015830 | 3300005330 | Bacteria | 4506 |
| 4 | Ga0070670_100033125 | 3300005331 | Bacteria | 4451 |
| 5 | Ga0070670_100413924 | 3300005331 | Bacteria | 1191 |
| 6 | Ga0070670_100639346 | 3300005331 | Unclassified | 954 |
| 7 | Ga0070677_10014120 | 3300005333 | Bacteria | 2805 |
| 8 | Ga0070677_10059186 | 3300005333 | Bacteria | 1575 |
| 9 | Ga0070666_10309335 | 3300005335 | Unclassified | 1126 |
| 10 | Ga0070680_100872640 | 3300005336 | Bacteria | 776 |
| 11 | Ga0068868_100002519 | 3300005338 | Bacteria | 12720 |
| 12 | Ga0070689_100084633 | 3300005340 | Bacteria | 2493 |
| 13 | Ga0070689_100486914 | 3300005340 | Bacteria | 1054 |
| 14 | Ga0070687_100039040 | 3300005343 | Bacteria | 2383 |
| 15 | Ga0070661_100082209 | 3300005344 | Bacteria | 2379 |
| 16 | Ga0070661_100222388 | 3300005344 | Bacteria | 1449 |
| 17 | Ga0070675_100170757 | 3300005354 | Bacteria | 1875 |
| 18 | Ga0070675_100436283 | 3300005354 | Bacteria | 1173 |
| 19 | Ga0070674_100163876 | 3300005356 | Bacteria | 1689 |
| 20 | Ga0070673_100069421 | 3300005364 | Bacteria | 2824 |
| 21 | Ga0070673_100381104 | 3300005364 | Bacteria | 1257 |
| 22 | Ga0070688_100019561 | 3300005365 | Unclassified | 3924 |
| 23 | Ga0070659_100398793 | 3300005366 | Bacteria | 1161 |
| 24 | Ga0070667_100025796 | 3300005367 | Bacteria | 4888 |
| 25 | Ga0070703_10152222 | 3300005406 | Bacteria | 870 |
| 26 | Ga0070701_10288916 | 3300005438 | Bacteria | 1004 |
| 27 | Ga0070705_100400639 | 3300005440 | Bacteria | 1016 |
| 28 | Ga0070700_100011402 | 3300005441 | Bacteria | 4924 |
| 29 | Ga0070700_100333794 | 3300005441 | Bacteria | 1118 |
| 30 | Ga0070694_100303170 | 3300005444 | Bacteria | 1225 |
| 31 | Ga0070663_100598496 | 3300005455 | Bacteria | 927 |
| 32 | Ga0068867_100274648 | 3300005459 | Bacteria | 1380 |
| 33 | Ga0068867_100357220 | 3300005459 | Bacteria | 1221 |
| 34 | Ga0070707_100533300 | 3300005468 | Bacteria | 1136 |
| 35 | Ga0070698_100013300 | 3300005471 | Bacteria | 8710 |
| 36 | Ga0070698_100807389 | 3300005471 | Bacteria | 882 |
| 37 | Ga0070699_100000583 | 3300005518 | Bacteria | 34487 |
| 38 | Ga0070684_100084753 | 3300005535 | Bacteria | 2809 |
| 39 | Ga0070697_100151682 | 3300005536 | Bacteria | 1953 |
| 40 | Ga0068853_100506602 | 3300005539 | Bacteria | 1140 |
| 41 | Ga0070672_100028826 | 3300005543 | Bacteria | 4156 |
| 42 | Ga0070672_100036199 | 3300005543 | Bacteria | 3759 |
| 43 | Ga0070696_100671437 | 3300005546 | Bacteria | 842 |
| 44 | Ga0070704_100051031 | 3300005549 | Bacteria | 2911 |
| 45 | Ga0070704_100258103 | 3300005549 | Bacteria | 1434 |
| 46 | Ga0070664_100027963 | 3300005564 | Bacteria | 4690 |
| 47 | Ga0070664_100068344 | 3300005564 | Bacteria | 3037 |
| 48 | Ga0070664_100236363 | 3300005564 | Bacteria | 1639 |
| 49 | Ga0068857_100467190 | 3300005577 | Unclassified | 1181 |
| 50 | Ga0068856_100319922 | 3300005614 | Unclassified | 1569 |
| 51 | Ga0068859_100093192 | 3300005617 | Bacteria | 3064 |
| 52 | Ga0068859_100132982 | 3300005617 | Bacteria | 2560 |
| 53 | Ga0068859_100761620 | 3300005617 | Bacteria | 1057 |
| 54 | Ga0068864_100004341 | 3300005618 | Bacteria | 11643 |
| 55 | Ga0068864_100574621 | 3300005618 | Unclassified | 1091 |
| 56 | Ga0068861_100378294 | 3300005719 | Bacteria | 1250 |
| 57 | Ga0068870_10119270 | 3300005840 | Bacteria | 1517 |
| 58 | Ga0068863_100013820 | 3300005841 | Bacteria | 7783 |
| 59 | Ga0068863_100428339 | 3300005841 | Unclassified | 1297 |
| 60 | Ga0068858_100040680 | 3300005842 | Bacteria | 4312 |
| 61 | Ga0068858_100414304 | 3300005842 | Bacteria | 1295 |
| 62 | Ga0068860_100665130 | 3300005843 | Unclassified | 1050 |
| 63 | Ga0075368_10060018 | 3300006042 | Bacteria | 1522 |
| 64 | Ga0075363_100194642 | 3300006048 | Bacteria | 1157 |
| 65 | Ga0075364_10113703 | 3300006051 | Bacteria | 1808 |
| 66 | Ga0075364_10223328 | 3300006051 | Bacteria | 1279 |
| 67 | Ga0075367_10147151 | 3300006178 | Bacteria | 1461 |
| 68 | Ga0075369_10137664 | 3300006186 | Bacteria | 1112 |
| 69 | Ga0075366_10094215 | 3300006195 | Bacteria | 1795 |
| 70 | Ga0075366_10231405 | 3300006195 | Bacteria | 1126 |
| 71 | Ga0097621_100224227 | 3300006237 | Bacteria | 1639 |
| 72 | Ga0075370_10052882 | 3300006353 | Bacteria | 2305 |
| 73 | Ga0068871_100003322 | 3300006358 | Bacteria | 11044 |
| 74 | Ga0068871_100104713 | 3300006358 | Unclassified | 2373 |
| 75 | Ga0068871_100308370 | 3300006358 | Bacteria | 1391 |
| 76 | Ga0075428_100040843 | 3300006844 | Bacteria | 5102 |
| 77 | Ga0075428_100199883 | 3300006844 | Bacteria | 2161 |
| 78 | Ga0075428_100659593 | 3300006844 | Bacteria | 1115 |
| 79 | Ga0075428_100963515 | 3300006844 | Unclassified | 904 |
| 80 | Ga0075430_100007947 | 3300006846 | Bacteria | 8966 |
| 81 | Ga0075430_100012111 | 3300006846 | Bacteria | 7344 |
| 82 | Ga0075430_100713866 | 3300006846 | Unclassified | 826 |
| 83 | Ga0075431_100030150 | 3300006847 | Bacteria | 5586 |
| 84 | Ga0075431_100176645 | 3300006847 | Bacteria | 2193 |
| 85 | Ga0075431_100445913 | 3300006847 | Bacteria | 1290 |
| 86 | Ga0075433_10348671 | 3300006852 | Bacteria | 1308 |
| 87 | Ga0075429_100192675 | 3300006880 | Bacteria | 1786 |
| 88 | Ga0075429_100209284 | 3300006880 | Bacteria | 1709 |
| 89 | Ga0075429_100386876 | 3300006880 | Bacteria | 1225 |
| 90 | Ga0097620_100093194 | 3300006931 | Bacteria | 3064 |
| 91 | Ga0097620_100761650 | 3300006931 | Bacteria | 1057 |
| 92 | Ga0111539_10040310 | 3300009094 | Bacteria | 5624 |
| 93 | Ga0111539_10091809 | 3300009094 | Bacteria | 3567 |
| 94 | Ga0111539_10118256 | 3300009094 | Bacteria | 3106 |
| 95 | Ga0111539_10231863 | 3300009094 | Bacteria | 2150 |
| 96 | Ga0111539_10341327 | 3300009094 | Bacteria | 1743 |
| 97 | Ga0105245_10041235 | 3300009098 | Bacteria | 4115 |
| 98 | Ga0105245_10049128 | 3300009098 | Bacteria | 3776 |
| 99 | Ga0114129_10050951 | 3300009147 | Bacteria | 5813 |
| 100 | Ga0114129_10222913 | 3300009147 | Bacteria | 2543 |
| 101 | Ga0114129_10446051 | 3300009147 | Bacteria | 1698 |
| 102 | Ga0114129_10856611 | 3300009147 | Bacteria | 1155 |
| 103 | Ga0105242_10022042 | 3300009176 | Bacteria | 5005 |
| 104 | Ga0105242_10088817 | 3300009176 | Bacteria | 2597 |
| 105 | Ga0105248_10010347 | 3300009177 | Bacteria | 10269 |
| 106 | Ga0105248_10067273 | 3300009177 | Bacteria | 4022 |
| 107 | Ga0105248_10154331 | 3300009177 | Bacteria | 2591 |
| 108 | Ga0105248_10895800 | 3300009177 | Bacteria | 1002 |
| 109 | Ga0105248_11325575 | 3300009177 | Unclassified | 814 |
| 110 | Ga0105237_10278979 | 3300009545 | Bacteria | 1674 |
| 111 | Ga0105237_10571489 | 3300009545 | Unclassified | 1137 |
| 112 | Ga0105237_11293131 | 3300009545 | Unclassified | 736 |
| 113 | Ga0105249_10927676 | 3300009553 | Bacteria | 938 |
| 114 | Ga0105249_11061842 | 3300009553 | Bacteria | 879 |
| 115 | Ga0105246_10198962 | 3300011119 | Unclassified | 1556 |
| 116 | Ga0157374_10555219 | 3300013296 | Bacteria | 1156 |
| 117 | Ga0157374_10809388 | 3300013296 | Unclassified | 953 |
| 118 | Ga0157378_10043921 | 3300013297 | Bacteria | 3967 |
| 119 | Ga0157378_10516020 | 3300013297 | Unclassified | 1196 |
| 120 | Ga0157378_10589719 | 3300013297 | Bacteria | 1121 |
| 121 | Ga0157378_11014348 | 3300013297 | Unclassified | 865 |
| 122 | Ga0163162_10023057 | 3300013306 | Bacteria | 6140 |
| 123 | Ga0163162_10069453 | 3300013306 | Bacteria | 3575 |
| 124 | Ga0157375_10025550 | 3300013308 | Bacteria | 5490 |
| 125 | Ga0157375_10095918 | 3300013308 | Unclassified | 3038 |
| 126 | Ga0157375_10244462 | 3300013308 | Unclassified | 1954 |
| 127 | Ga0157375_10681679 | 3300013308 | Unclassified | 1182 |
| 128 | Ga0157375_10697207 | 3300013308 | Bacteria | 1169 |
| 129 | Ga0157375_11585503 | 3300013308 | Unclassified | 774 |
| 130 | Ga0163163_10002495 | 3300014325 | Bacteria | 15562 |
| 131 | Ga0163163_10016668 | 3300014325 | Bacteria | 6833 |
| 132 | Ga0163163_10024660 | 3300014325 | Bacteria | 5726 |
| 133 | Ga0163163_10216404 | 3300014325 | Bacteria | 1965 |
| 134 | Ga0163163_10275321 | 3300014325 | Bacteria | 1734 |
| 135 | Ga0157380_10006079 | 3300014326 | Bacteria | 8462 |
| 136 | Ga0157380_10032348 | 3300014326 | Bacteria | 4023 |
| 137 | Ga0157380_10086179 | 3300014326 | Bacteria | 2580 |
| 138 | Ga0157380_10101472 | 3300014326 | Bacteria | 2398 |
| 139 | Ga0157377_10107401 | 3300014745 | Bacteria | 1673 |
| 140 | Ga0157376_10192789 | 3300014969 | Bacteria | 1870 |
| 141 | Ga0157376_10297313 | 3300014969 | Unclassified | 1527 |
| 142 | Ga0157376_10609510 | 3300014969 | Bacteria | 1087 |
| 143 | Ga0163161_10473768 | 3300017792 | Bacteria | 1015 |
| 144 | Ga0207682_10102522 | 3300025893 | Bacteria | 1252 |
| 145 | Ga0207671_10092512 | 3300025914 | Bacteria | 2280 |
| 146 | Ga0207671_10357101 | 3300025914 | Bacteria | 1159 |
| 147 | Ga0207660_10567820 | 3300025917 | Bacteria | 923 |
| 148 | Ga0207662_10082509 | 3300025918 | Bacteria | 1964 |
| 149 | Ga0207681_10277705 | 3300025923 | Bacteria | 1318 |
| 150 | Ga0207650_10003895 | 3300025925 | Bacteria | 10203 |
| 151 | Ga0207650_10264700 | 3300025925 | Bacteria | 1396 |
| 152 | Ga0207650_10304355 | 3300025925 | Bacteria | 1303 |
| 153 | Ga0207650_10502075 | 3300025925 | Bacteria | 1014 |
| 154 | Ga0207659_10002199 | 3300025926 | Bacteria | 11594 |
| 155 | Ga0207659_10037011 | 3300025926 | Bacteria | 3385 |
| 156 | Ga0207659_10117334 | 3300025926 | Unclassified | 2034 |
| 157 | Ga0207687_10025919 | 3300025927 | Bacteria | 3924 |
| 158 | Ga0207687_10083290 | 3300025927 | Bacteria | 2315 |
| 159 | Ga0207644_10003671 | 3300025931 | Bacteria | 9952 |
| 160 | Ga0207706_10613273 | 3300025933 | Bacteria | 934 |
| 161 | Ga0207706_10908306 | 3300025933 | Bacteria | 743 |
| 162 | Ga0207686_10003288 | 3300025934 | Bacteria | 8689 |
| 163 | Ga0207686_10316322 | 3300025934 | Unclassified | 1165 |
| 164 | Ga0207686_10497635 | 3300025934 | Unclassified | 945 |
| 165 | Ga0207670_10187619 | 3300025936 | Bacteria | 1562 |
| 166 | Ga0207670_10615998 | 3300025936 | Bacteria | 892 |
| 167 | Ga0207669_10689341 | 3300025937 | Unclassified | 839 |
| 168 | Ga0207691_10013906 | 3300025940 | Bacteria | 7679 |
| 169 | Ga0207691_10106883 | 3300025940 | Bacteria | 2492 |
| 170 | Ga0207691_10215879 | 3300025940 | Bacteria | 1665 |
| 171 | Ga0207711_10111399 | 3300025941 | Bacteria | 2434 |
| 172 | Ga0207711_10112742 | 3300025941 | Bacteria | 2420 |
| 173 | Ga0207711_10605468 | 3300025941 | Unclassified | 1022 |
| 174 | Ga0207679_10035327 | 3300025945 | Bacteria | 3535 |
| 175 | Ga0207679_10173759 | 3300025945 | Bacteria | 1776 |
| 176 | Ga0207651_10088900 | 3300025960 | Bacteria | 2253 |
| 177 | Ga0207712_10483223 | 3300025961 | Bacteria | 1056 |
| 178 | Ga0207658_10027715 | 3300025986 | Bacteria | 3983 |
| 179 | Ga0207677_10012954 | 3300026023 | Bacteria | 4817 |
| 180 | Ga0207703_10045683 | 3300026035 | Bacteria | 3524 |
| 181 | Ga0207703_10118966 | 3300026035 | Bacteria | 2265 |
| 182 | Ga0207703_10230848 | 3300026035 | Bacteria | 1659 |
| 183 | Ga0207639_10570425 | 3300026041 | Bacteria | 1041 |
| 184 | Ga0207678_10734665 | 3300026067 | Bacteria | 870 |
| 185 | Ga0207708_10077217 | 3300026075 | Bacteria | 2556 |
| 186 | Ga0207708_10194869 | 3300026075 | Bacteria | 1614 |
| 187 | Ga0207708_10436213 | 3300026075 | Bacteria | 1089 |
| 188 | Ga0207702_10304303 | 3300026078 | Bacteria | 1514 |
| 189 | Ga0207641_10117335 | 3300026088 | Bacteria | 2370 |
| 190 | Ga0207641_10285694 | 3300026088 | Unclassified | 1553 |
| 191 | Ga0207641_11128046 | 3300026088 | Unclassified | 783 |
| 192 | Ga0207648_10735500 | 3300026089 | Bacteria | 916 |
| 193 | Ga0207648_10830164 | 3300026089 | Bacteria | 861 |
| 194 | Ga0207676_10021460 | 3300026095 | Bacteria | 4737 |
| 195 | Ga0207676_10332706 | 3300026095 | Bacteria | 1398 |
| 196 | Ga0207676_10711384 | 3300026095 | Unclassified | 974 |
| 197 | Ga0207683_10222639 | 3300026121 | Bacteria | 1719 |
| 198 | Ga0209813_10017109 | 3300027866 | Bacteria | 1986 |
| 199 | Ga0207428_10002585 | 3300027907 | Bacteria | 18073 |
| 200 | Ga0207428_10022553 | 3300027907 | Bacteria | 5310 |
| 201 | Ga0268266_10079434 | 3300028379 | Bacteria | 2856 |
| 202 | Ga0307408_100130306 | 3300031548 | Bacteria | 1961 |
| 203 | Ga0307408_100666498 | 3300031548 | Bacteria | 932 |
| 204 | Ga0265314_10124048 | 3300031711 | Bacteria | 1621 |
| 205 | Ga0307405_10016050 | 3300031731 | Bacteria | 4074 |
| 206 | Ga0307405_10060099 | 3300031731 | Bacteria | 2397 |
| 207 | Ga0307405_10132678 | 3300031731 | Bacteria | 1724 |
| 208 | Ga0307413_10096396 | 3300031824 | Bacteria | 1942 |
| 209 | Ga0307413_10174858 | 3300031824 | Bacteria | 1524 |
| 210 | Ga0307410_10065265 | 3300031852 | Bacteria | 2504 |
| 211 | Ga0307410_10125524 | 3300031852 | Bacteria | 1878 |
| 212 | Ga0307410_10189032 | 3300031852 | Bacteria | 1565 |
| 213 | Ga0307407_10031842 | 3300031903 | Bacteria | 2861 |
| 214 | Ga0307412_10065272 | 3300031911 | Bacteria | 2463 |
| 215 | Ga0307412_10762840 | 3300031911 | Bacteria | 836 |
| 216 | Ga0307412_11066380 | 3300031911 | Bacteria | 717 |
| 217 | Ga0307409_100005844 | 3300031995 | Bacteria | 7143 |
| 218 | Ga0307409_100120802 | 3300031995 | Bacteria | 2218 |
| 219 | Ga0307409_100949562 | 3300031995 | Bacteria | 876 |
| 220 | Ga0307416_100067358 | 3300032002 | Bacteria | 2952 |
| 221 | Ga0307416_100131693 | 3300032002 | Bacteria | 2252 |
| 222 | Ga0307416_100939124 | 3300032002 | Bacteria | 966 |
| 223 | Ga0307414_10075731 | 3300032004 | Bacteria | 2443 |
| 224 | Ga0307411_10526795 | 3300032005 | Bacteria | 1004 |
| 225 | Ga0307415_100236183 | 3300032126 | Bacteria | 1476 |
| 226 | Ga0373957_0071889 | 3300035120 | Bacteria | 1354 |
| 227 | Ga0373955_0036546 | 3300035172 | Bacteria | 2607 |
| 228 | Ga0373955_0389259 | 3300035172 | Bacteria | 846 |
| 229 | Ga0373924_0105524 | 3300035410 | Bacteria | 1215 |
| 230 | Ga0373937_0017211 | 3300036401 | Bacteria | 6435 |
| 231 | Ga0373937_0041621 | 3300036401 | Bacteria | 4190 |
| 232 | Ga0373937_0115390 | 3300036401 | Bacteria | 2501 |
| 233 | Ga0373937_0192415 | 3300036401 | Bacteria | 1917 |
| 234 | Ga0439453_0031190 | 3300041408 | Bacteria | 1011 |
| 235 | Ga0439433_0001690 | 3300041999 | Bacteria | 4603 |
| 236 | Ga0439433_0024246 | 3300041999 | Bacteria | 1366 |
| 237 | Ga0439442_067919 | 3300042002 | Bacteria | 758 |
| 238 | Ga0439462_0048289 | 3300042015 | Bacteria | 1141 |
| 239 | Ga0450923_003441 | 3300042125 | Unclassified | 2389 |
| 240 | Ga0439446_0002406 | 3300042156 | Bacteria | 4485 |
| 241 | Ga0439435_0005184 | 3300042436 | Bacteria | 2855 |
| 242 | Ga0439464_0099360 | 3300042439 | Bacteria | 883 |
| 243 | Ga0450916_009965 | 3300042530 | Bacteria | 1180 |
| 244 | Ga0495592_0034640 | 3300046454 | Bacteria | 3805 |
| 245 | Ga0495638_0013750 | 3300046460 | Bacteria | 5498 |
| 246 | Ga0495580_0091348 | 3300046472 | Bacteria | 2119 |
| 247 | Ga0495639_0089433 | 3300046475 | Bacteria | 1443 |
| 248 | Ga0495618_0075438 | 3300046514 | Bacteria | 2148 |
| 249 | Ga0495630_0265172 | 3300046517 | Bacteria | 1312 |
| 250 | Ga0495667_0032731 | 3300046559 | Bacteria | 3481 |
| 251 | Ga0495634_0198867 | 3300046642 | Bacteria | 1246 |
| 252 | Ga0495657_0002296 | 3300046675 | Bacteria | 16157 |
| 253 | Ga0495599_0042943 | 3300046678 | Bacteria | 2837 |
| 254 | Ga0495658_0092756 | 3300046683 | Bacteria | 1791 |
| 255 | Ga0495613_0021719 | 3300046689 | Bacteria | 4782 |
| 256 | Ga0495613_0038405 | 3300046689 | Bacteria | 3549 |
| 257 | Ga0495613_0467563 | 3300046689 | Bacteria | 853 |
| 258 | Ga0495636_0252766 | 3300047318 | Bacteria | 815 |
| 259 | Ga0495674_0144564 | 3300047319 | Bacteria | 1997 |
| 260 | Ga0495672_0037582 | 3300047320 | Bacteria | 2961 |
| 261 | Ga0495676_0364198 | 3300047321 | Bacteria | 965 |
| 262 | Ga0495675_0294961 | 3300047444 | Bacteria | 964 |
| 263 | Ga0495684_0671762 | 3300047471 | Unclassified | 690 |
| 264 | Ga0496106_0602700 | 3300048909 | Bacteria | 880 |
| 265 | Ga0496110_0252348 | 3300048913 | Bacteria | 1606 |
| 266 | Ga0496112_0283258 | 3300048915 | Bacteria | 1604 |
| 267 | Ga0496113_0794084 | 3300048916 | Unclassified | 752 |
| 268 | Ga0501036_0374864 | 3300049572 | Bacteria | 1188 |
| 269 | Ga0501042_0053513 | 3300049578 | Bacteria | 2880 |
| 270 | Ga0501042_0403964 | 3300049578 | Bacteria | 990 |
| 271 | Ga0501048_0597917 | 3300049582 | Bacteria | 792 |
| 272 | Ga0501048_0738335 | 3300049582 | Bacteria | 707 |
| 273 | Ga0501071_0380971 | 3300049587 | Bacteria | 1076 |
| 274 | Ga0501071_0540596 | 3300049587 | Bacteria | 895 |
| 275 | Ga0501072_0113138 | 3300049588 | Bacteria | 2161 |
| 276 | Ga0501073_0011091 | 3300049589 | Bacteria | 6592 |
| 277 | Ga0501075_0043287 | 3300049591 | Bacteria | 3377 |
| 278 | Ga0501076_0175734 | 3300049592 | Bacteria | 1745 |
| 279 | Ga0501077_0415654 | 3300049593 | Bacteria | 860 |
| 280 | Ga0501249_095053 | 3300049679 | Bacteria | 710 |
| 281 | Ga0501079_0523352 | 3300049741 | Bacteria | 932 |
| 282 | Ga0501079_0909881 | 3300049741 | Bacteria | 693 |
| 283 | Ga0501283_074923 | 3300049779 | Bacteria | 629 |
| 284 | Ga0501045_0014212 | 3300049824 | Bacteria | 5640 |
| 285 | nmdc:mga00v17_98806_c1 | 3300050491 | Bacteria | 1841 |
| 286 | nmdc:mga0k408_208342_c1 | 3300050493 | Bacteria | 1167 |
| 287 | nmdc:mga0k408_269546_c1 | 3300050493 | Bacteria | 1016 |
| 288 | nmdc:mga0k408_66536_c1 | 3300050493 | Bacteria | 2099 |
| 289 | nmdc:mga06z11_26312_c1 | 3300050494 | Bacteria | 2768 |
| 290 | nmdc:mga06z11_59909_c1 | 3300050494 | Bacteria | 1980 |
| 291 | nmdc:mga06z11_601988_c1 | 3300050494 | Bacteria | 668 |
| 292 | nmdc:mga04h51_81624_c1 | 3300050495 | Bacteria | 1149 |
| 293 | nmdc:mga05p37_1065123_c1 | 3300050507 | Bacteria | 851 |
| 294 | nmdc:mga05p37_156889_c1 | 3300050507 | Bacteria | 2781 |
| 295 | nmdc:mga05p37_314843_c1 | 3300050507 | Bacteria | 1854 |
| 296 | nmdc:mga05p37_498383_c1 | 3300050507 | Bacteria | 1398 |
| 297 | nmdc:mga05p37_6390_c1 | 3300050507 | Bacteria | 13888 |
| 298 | nmdc:mga09592_216068_c1 | 3300050508 | Bacteria | 1661 |
| 299 | nmdc:mga09592_228506_c1 | 3300050508 | Bacteria | 1612 |
| 300 | nmdc:mga0qj67_26160_c1 | 3300050509 | Bacteria | 4516 |
| 301 | nmdc:mga0qj67_319370_c1 | 3300050509 | Bacteria | 1257 |
| 302 | nmdc:mga0qj67_9069_c1 | 3300050509 | Bacteria | 7384 |
| 303 | nmdc:mga06r32_198058_c1 | 3300050510 | Bacteria | 1996 |
| 304 | nmdc:mga06r32_37164_c1 | 3300050510 | Bacteria | 4606 |
| 305 | nmdc:mga06r32_519283_c1 | 3300050510 | Bacteria | 1167 |
| 306 | nmdc:mga06r32_85653_c1 | 3300050510 | Bacteria | 3073 |
| 307 | nmdc:mga08y16_143533_c1 | 3300050511 | Bacteria | 2482 |
| 308 | nmdc:mga08y16_4144_c1 | 3300050511 | Bacteria | 15133 |
| 309 | nmdc:mga08y16_69898_c1 | 3300050511 | Bacteria | 3660 |
| 310 | nmdc:mga0n895_28518_c2 | 3300050512 | Bacteria | 3219 |
| 311 | nmdc:mga0rr50_569020_c1 | 3300050513 | Bacteria | 965 |
| 312 | nmdc:mga0a205_22963_c1 | 3300050515 | Bacteria | 5915 |
| 313 | nmdc:mga0sz30_114429_c1 | 3300050516 | Bacteria | 1183 |
| 314 | Ga0495619_0211108 | 3300053085 | Bacteria | 1344 |
| 315 | Ga0500646_0124698 | 3300053090 | Bacteria | 831 |
| 316 | Ga0500641_0001989 | 3300053096 | Bacteria | 7252 |
| 317 | Ga0500555_007247 | 3300053103 | Bacteria | 3153 |
| 318 | Ga0500556_0004903 | 3300053104 | Bacteria | 3788 |
| 319 | Ga0500658_0293281 | 3300053134 | Bacteria | 748 |
| 320 | Ga0500568_0001250 | 3300053139 | Bacteria | 16849 |
| 321 | Ga0501084_0580210 | 3300054114 | Bacteria | 948 |
| 322 | Ga0501082_0023640 | 3300060353 | Bacteria | 5301 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006186 | Ga0075369_10137664 | Ga0075369_101376642 | 170 |
| 2 | 3300009545 | Ga0105237_10278979 | Ga0105237_102789793 | 170 |
| 3 | 3300006051 | Ga0075364_10113703 | Ga0075364_101137032 | 181 |
| 4 | 3300006353 | Ga0075370_10052882 | Ga0075370_100528822 | 181 |
| 5 | 3300009553 | Ga0105249_10927676 | Ga0105249_109276761 | 181 |
| 6 | 3300025961 | Ga0207712_10483223 | Ga0207712_104832232 | 182 |
| 7 | 3300050491 | nmdc:mga00v17_98806_c1 | nmdc:mga00v17_98806_c1_496_1125 | 182 |
| 8 | 3300005366 | Ga0070659_100398793 | Ga0070659_1003987932 | 186 |
| 9 | 3300005365 | Ga0070688_100019561 | Ga0070688_1000195614 | 187 |
| 10 | 3300050516 | nmdc:mga0sz30_114429_c1 | nmdc:mga0sz30_114429_c1_424_993 | 189 |
| 11 | 3300049578 | Ga0501042_0403964 | Ga0501042_0403964_364_942 | 191 |
| 12 | 3300013297 | Ga0157378_10043921 | Ga0157378_100439213 | 192 |
| 13 | 3300005335 | Ga0070666_10309335 | Ga0070666_103093351 | 197 |
| 14 | 3300005535 | Ga0070684_100084753 | Ga0070684_1000847534 | 197 |
| 15 | 3300005577 | Ga0068857_100467190 | Ga0068857_1004671901 | 197 |
| 16 | 3300005614 | Ga0068856_100319922 | Ga0068856_1003199222 | 197 |
| 17 | 3300005841 | Ga0068863_100428339 | Ga0068863_1004283392 | 197 |
| 18 | 3300006844 | Ga0075428_100963515 | Ga0075428_1009635151 | 197 |
| 19 | 3300009177 | Ga0105248_10067273 | Ga0105248_100672732 | 197 |
| 20 | 3300009545 | Ga0105237_10571489 | Ga0105237_105714891 | 197 |
| 21 | 3300013306 | Ga0163162_10069453 | Ga0163162_100694536 | 197 |
| 22 | 3300025927 | Ga0207687_10025919 | Ga0207687_100259192 | 197 |
| 23 | 3300025934 | Ga0207686_10003288 | Ga0207686_100032886 | 197 |
| 24 | 3300025934 | Ga0207686_10497635 | Ga0207686_104976351 | 197 |
| 25 | 3300025941 | Ga0207711_10605468 | Ga0207711_106054682 | 197 |
| 26 | 3300026035 | Ga0207703_10230848 | Ga0207703_102308481 | 197 |
| 27 | 3300026078 | Ga0207702_10304303 | Ga0207702_103043031 | 197 |
| 28 | 3300049572 | Ga0501036_0374864 | Ga0501036_0374864_66_662 | 197 |
| 29 | 3300049582 | Ga0501048_0738335 | Ga0501048_0738335_97_693 | 197 |
| 30 | 3300049587 | Ga0501071_0380971 | Ga0501071_0380971_346_942 | 197 |
| 31 | 3300049587 | Ga0501071_0540596 | Ga0501071_0540596_191_787 | 197 |
| 32 | 3300049741 | Ga0501079_0523352 | Ga0501079_0523352_312_908 | 197 |
| 33 | 3300006844 | Ga0075428_100040843 | Ga0075428_1000408433 | 198 |
| 34 | 3300006846 | Ga0075430_100007947 | Ga0075430_1000079475 | 198 |
| 35 | 3300006846 | Ga0075430_100713866 | Ga0075430_1007138661 | 198 |
| 36 | 3300006847 | Ga0075431_100030150 | Ga0075431_1000301506 | 198 |
| 37 | 3300013297 | Ga0157378_10516020 | Ga0157378_105160203 | 198 |
| 38 | 3300031548 | Ga0307408_100130306 | Ga0307408_1001303062 | 198 |
| 39 | 3300031731 | Ga0307405_10016050 | Ga0307405_100160502 | 198 |
| 40 | 3300031852 | Ga0307410_10065265 | Ga0307410_100652652 | 198 |
| 41 | 3300031911 | Ga0307412_10065272 | Ga0307412_100652722 | 198 |
| 42 | 3300031911 | Ga0307412_11066380 | Ga0307412_110663801 | 198 |
| 43 | 3300032002 | Ga0307416_100939124 | Ga0307416_1009391242 | 198 |
| 44 | 3300049679 | Ga0501249_095053 | Ga0501249_095053_73_672 | 198 |
| 45 | 3300049779 | Ga0501283_074923 | Ga0501283_074923_15_614 | 198 |
| 46 | 3300050508 | nmdc:mga09592_228506_c1 | nmdc:mga09592_228506_c1_503_1102 | 198 |
| 47 | 3300050509 | nmdc:mga0qj67_319370_c1 | nmdc:mga0qj67_319370_c1_515_1111 | 198 |
| 48 | 3300050509 | nmdc:mga0qj67_9069_c1 | nmdc:mga0qj67_9069_c1_4063_4662 | 198 |
| 49 | 3300050510 | nmdc:mga06r32_37164_c1 | nmdc:mga06r32_37164_c1_1119_1718 | 198 |
| 50 | 3300054114 | Ga0501084_0580210 | Ga0501084_0580210_38_637 | 198 |
| 51 | 3300005330 | Ga0070690_100015830 | Ga0070690_1000158303 | 199 |
| 52 | 3300005331 | Ga0070670_100033125 | Ga0070670_1000331254 | 199 |
| 53 | 3300005336 | Ga0070680_100872640 | Ga0070680_1008726401 | 199 |
| 54 | 3300005338 | Ga0068868_100002519 | Ga0068868_10000251914 | 199 |
| 55 | 3300005340 | Ga0070689_100084633 | Ga0070689_1000846333 | 199 |
| 56 | 3300005343 | Ga0070687_100039040 | Ga0070687_1000390404 | 199 |
| 57 | 3300005344 | Ga0070661_100082209 | Ga0070661_1000822094 | 199 |
| 58 | 3300005354 | Ga0070675_100436283 | Ga0070675_1004362833 | 199 |
| 59 | 3300005356 | Ga0070674_100163876 | Ga0070674_1001638762 | 199 |
| 60 | 3300005364 | Ga0070673_100069421 | Ga0070673_1000694214 | 199 |
| 61 | 3300005367 | Ga0070667_100025796 | Ga0070667_1000257964 | 199 |
| 62 | 3300005406 | Ga0070703_10152222 | Ga0070703_101522221 | 199 |
| 63 | 3300005440 | Ga0070705_100400639 | Ga0070705_1004006392 | 199 |
| 64 | 3300005455 | Ga0070663_100598496 | Ga0070663_1005984962 | 199 |
| 65 | 3300005459 | Ga0068867_100357220 | Ga0068867_1003572201 | 199 |
| 66 | 3300005539 | Ga0068853_100506602 | Ga0068853_1005066022 | 199 |
| 67 | 3300005543 | Ga0070672_100036199 | Ga0070672_1000361991 | 199 |
| 68 | 3300005546 | Ga0070696_100671437 | Ga0070696_1006714371 | 199 |
| 69 | 3300005549 | Ga0070704_100258103 | Ga0070704_1002581032 | 199 |
| 70 | 3300005564 | Ga0070664_100027963 | Ga0070664_1000279636 | 199 |
| 71 | 3300005564 | Ga0070664_100236363 | Ga0070664_1002363632 | 199 |
| 72 | 3300005617 | Ga0068859_100093192 | Ga0068859_1000931922 | 199 |
| 73 | 3300005618 | Ga0068864_100004341 | Ga0068864_10000434113 | 199 |
| 74 | 3300005618 | Ga0068864_100574621 | Ga0068864_1005746212 | 199 |
| 75 | 3300005840 | Ga0068870_10119270 | Ga0068870_101192703 | 199 |
| 76 | 3300005841 | Ga0068863_100013820 | Ga0068863_1000138207 | 199 |
| 77 | 3300005842 | Ga0068858_100040680 | Ga0068858_1000406802 | 199 |
| 78 | 3300005842 | Ga0068858_100414304 | Ga0068858_1004143042 | 199 |
| 79 | 3300005843 | Ga0068860_100665130 | Ga0068860_1006651302 | 199 |
| 80 | 3300006237 | Ga0097621_100224227 | Ga0097621_1002242272 | 199 |
| 81 | 3300006358 | Ga0068871_100003322 | Ga0068871_10000332210 | 199 |
| 82 | 3300006358 | Ga0068871_100104713 | Ga0068871_1001047132 | 199 |
| 83 | 3300006358 | Ga0068871_100308370 | Ga0068871_1003083702 | 199 |
| 84 | 3300006844 | Ga0075428_100659593 | Ga0075428_1006595932 | 199 |
| 85 | 3300006847 | Ga0075431_100445913 | Ga0075431_1004459132 | 199 |
| 86 | 3300006852 | Ga0075433_10348671 | Ga0075433_103486712 | 199 |
| 87 | 3300006880 | Ga0075429_100386876 | Ga0075429_1003868762 | 199 |
| 88 | 3300006931 | Ga0097620_100093194 | Ga0097620_1000931944 | 199 |
| 89 | 3300009094 | Ga0111539_10040310 | Ga0111539_100403104 | 199 |
| 90 | 3300009094 | Ga0111539_10231863 | Ga0111539_102318632 | 199 |
| 91 | 3300009098 | Ga0105245_10041235 | Ga0105245_100412352 | 199 |
| 92 | 3300009098 | Ga0105245_10049128 | Ga0105245_100491282 | 199 |
| 93 | 3300009147 | Ga0114129_10050951 | Ga0114129_100509513 | 199 |
| 94 | 3300009147 | Ga0114129_10446051 | Ga0114129_104460512 | 199 |
| 95 | 3300009147 | Ga0114129_10856611 | Ga0114129_108566112 | 199 |
| 96 | 3300009176 | Ga0105242_10022042 | Ga0105242_100220422 | 199 |
| 97 | 3300009176 | Ga0105242_10088817 | Ga0105242_100888173 | 199 |
| 98 | 3300009177 | Ga0105248_10010347 | Ga0105248_100103473 | 199 |
| 99 | 3300009177 | Ga0105248_10154331 | Ga0105248_101543311 | 199 |
| 100 | 3300009177 | Ga0105248_10895800 | Ga0105248_108958002 | 199 |
| 101 | 3300009177 | Ga0105248_11325575 | Ga0105248_113255751 | 199 |
| 102 | 3300009545 | Ga0105237_11293131 | Ga0105237_112931311 | 199 |
| 103 | 3300011119 | Ga0105246_10198962 | Ga0105246_101989622 | 199 |
| 104 | 3300013296 | Ga0157374_10555219 | Ga0157374_105552192 | 199 |
| 105 | 3300013296 | Ga0157374_10809388 | Ga0157374_108093881 | 199 |
| 106 | 3300013297 | Ga0157378_10589719 | Ga0157378_105897191 | 199 |
| 107 | 3300013297 | Ga0157378_11014348 | Ga0157378_110143481 | 199 |
| 108 | 3300013306 | Ga0163162_10023057 | Ga0163162_100230575 | 199 |
| 109 | 3300013308 | Ga0157375_10025550 | Ga0157375_100255504 | 199 |
| 110 | 3300013308 | Ga0157375_10095918 | Ga0157375_100959184 | 199 |
| 111 | 3300013308 | Ga0157375_10681679 | Ga0157375_106816792 | 199 |
| 112 | 3300013308 | Ga0157375_10697207 | Ga0157375_106972071 | 199 |
| 113 | 3300013308 | Ga0157375_11585503 | Ga0157375_115855031 | 199 |
| 114 | 3300014325 | Ga0163163_10002495 | Ga0163163_100024955 | 199 |
| 115 | 3300014325 | Ga0163163_10016668 | Ga0163163_100166687 | 199 |
| 116 | 3300014325 | Ga0163163_10024660 | Ga0163163_100246606 | 199 |
| 117 | 3300014325 | Ga0163163_10275321 | Ga0163163_102753212 | 199 |
| 118 | 3300014745 | Ga0157377_10107401 | Ga0157377_101074012 | 199 |
| 119 | 3300014969 | Ga0157376_10192789 | Ga0157376_101927893 | 199 |
| 120 | 3300014969 | Ga0157376_10297313 | Ga0157376_102973132 | 199 |
| 121 | 3300017792 | Ga0163161_10473768 | Ga0163161_104737682 | 199 |
| 122 | 3300025914 | Ga0207671_10092512 | Ga0207671_100925123 | 199 |
| 123 | 3300025914 | Ga0207671_10357101 | Ga0207671_103571012 | 199 |
| 124 | 3300025917 | Ga0207660_10567820 | Ga0207660_105678201 | 199 |
| 125 | 3300025918 | Ga0207662_10082509 | Ga0207662_100825092 | 199 |
| 126 | 3300025925 | Ga0207650_10003895 | Ga0207650_100038952 | 199 |
| 127 | 3300025925 | Ga0207650_10502075 | Ga0207650_105020752 | 199 |
| 128 | 3300025926 | Ga0207659_10002199 | Ga0207659_1000219914 | 199 |
| 129 | 3300025926 | Ga0207659_10117334 | Ga0207659_101173343 | 199 |
| 130 | 3300025927 | Ga0207687_10083290 | Ga0207687_100832902 | 199 |
| 131 | 3300025931 | Ga0207644_10003671 | Ga0207644_1000367110 | 199 |
| 132 | 3300025933 | Ga0207706_10613273 | Ga0207706_106132731 | 199 |
| 133 | 3300025934 | Ga0207686_10316322 | Ga0207686_103163222 | 199 |
| 134 | 3300025936 | Ga0207670_10187619 | Ga0207670_101876192 | 199 |
| 135 | 3300025937 | Ga0207669_10689341 | Ga0207669_106893412 | 199 |
| 136 | 3300025940 | Ga0207691_10013906 | Ga0207691_100139066 | 199 |
| 137 | 3300025940 | Ga0207691_10215879 | Ga0207691_102158792 | 199 |
| 138 | 3300025941 | Ga0207711_10111399 | Ga0207711_101113993 | 199 |
| 139 | 3300025941 | Ga0207711_10112742 | Ga0207711_101127423 | 199 |
| 140 | 3300025945 | Ga0207679_10035327 | Ga0207679_100353271 | 199 |
| 141 | 3300025960 | Ga0207651_10088900 | Ga0207651_100889002 | 199 |
| 142 | 3300025986 | Ga0207658_10027715 | Ga0207658_100277155 | 199 |
| 143 | 3300026023 | Ga0207677_10012954 | Ga0207677_100129544 | 199 |
| 144 | 3300026035 | Ga0207703_10045683 | Ga0207703_100456832 | 199 |
| 145 | 3300026035 | Ga0207703_10118966 | Ga0207703_101189662 | 199 |
| 146 | 3300026041 | Ga0207639_10570425 | Ga0207639_105704251 | 199 |
| 147 | 3300026067 | Ga0207678_10734665 | Ga0207678_107346652 | 199 |
| 148 | 3300026075 | Ga0207708_10077217 | Ga0207708_100772173 | 199 |
| 149 | 3300026075 | Ga0207708_10194869 | Ga0207708_101948692 | 199 |
| 150 | 3300026088 | Ga0207641_10117335 | Ga0207641_101173353 | 199 |
| 151 | 3300026088 | Ga0207641_10285694 | Ga0207641_102856942 | 199 |
| 152 | 3300026088 | Ga0207641_11128046 | Ga0207641_111280462 | 199 |
| 153 | 3300026089 | Ga0207648_10830164 | Ga0207648_108301641 | 199 |
| 154 | 3300026095 | Ga0207676_10021460 | Ga0207676_100214603 | 199 |
| 155 | 3300026095 | Ga0207676_10332706 | Ga0207676_103327062 | 199 |
| 156 | 3300026095 | Ga0207676_10711384 | Ga0207676_107113841 | 199 |
| 157 | 3300026121 | Ga0207683_10222639 | Ga0207683_102226392 | 199 |
| 158 | 3300027907 | Ga0207428_10002585 | Ga0207428_100025858 | 199 |
| 159 | 3300027907 | Ga0207428_10022553 | Ga0207428_100225535 | 199 |
| 160 | 3300028379 | Ga0268266_10079434 | Ga0268266_100794344 | 199 |
| 161 | 3300031548 | Ga0307408_100666498 | Ga0307408_1006664982 | 199 |
| 162 | 3300031731 | Ga0307405_10060099 | Ga0307405_100600992 | 199 |
| 163 | 3300031824 | Ga0307413_10096396 | Ga0307413_100963962 | 199 |
| 164 | 3300031852 | Ga0307410_10125524 | Ga0307410_101255241 | 199 |
| 165 | 3300031852 | Ga0307410_10189032 | Ga0307410_101890322 | 199 |
| 166 | 3300031903 | Ga0307407_10031842 | Ga0307407_100318424 | 199 |
| 167 | 3300031911 | Ga0307412_10762840 | Ga0307412_107628401 | 199 |
| 168 | 3300031995 | Ga0307409_100005844 | Ga0307409_1000058442 | 199 |
| 169 | 3300031995 | Ga0307409_100949562 | Ga0307409_1009495622 | 199 |
| 170 | 3300032005 | Ga0307411_10526795 | Ga0307411_105267952 | 199 |
| 171 | 3300035120 | Ga0373957_0071889 | Ga0373957_0071889_474_1103 | 199 |
| 172 | 3300035172 | Ga0373955_0036546 | Ga0373955_0036546_1140_1793 | 199 |
| 173 | 3300035172 | Ga0373955_0389259 | Ga0373955_0389259_190_819 | 199 |
| 174 | 3300035410 | Ga0373924_0105524 | Ga0373924_0105524_250_879 | 199 |
| 175 | 3300036401 | Ga0373937_0017211 | Ga0373937_0017211_3488_4138 | 199 |
| 176 | 3300036401 | Ga0373937_0041621 | Ga0373937_0041621_94_723 | 199 |
| 177 | 3300036401 | Ga0373937_0115390 | Ga0373937_0115390_1432_2061 | 199 |
| 178 | 3300036401 | Ga0373937_0192415 | Ga0373937_0192415_1270_1899 | 199 |
| 179 | 3300042530 | Ga0450916_009965 | Ga0450916_009965_87_689 | 199 |
| 180 | 3300046454 | Ga0495592_0034640 | Ga0495592_0034640_3073_3702 | 199 |
| 181 | 3300046472 | Ga0495580_0091348 | Ga0495580_0091348_417_1046 | 199 |
| 182 | 3300046475 | Ga0495639_0089433 | Ga0495639_0089433_365_994 | 199 |
| 183 | 3300046514 | Ga0495618_0075438 | Ga0495618_0075438_1357_1986 | 199 |
| 184 | 3300046517 | Ga0495630_0265172 | Ga0495630_0265172_382_1011 | 199 |
| 185 | 3300046559 | Ga0495667_0032731 | Ga0495667_0032731_1790_2419 | 199 |
| 186 | 3300046642 | Ga0495634_0198867 | Ga0495634_0198867_268_897 | 199 |
| 187 | 3300046675 | Ga0495657_0002296 | Ga0495657_0002296_678_1307 | 199 |
| 188 | 3300046678 | Ga0495599_0042943 | Ga0495599_0042943_1752_2381 | 199 |
| 189 | 3300046683 | Ga0495658_0092756 | Ga0495658_0092756_816_1445 | 199 |
| 190 | 3300046689 | Ga0495613_0021719 | Ga0495613_0021719_3669_4298 | 199 |
| 191 | 3300046689 | Ga0495613_0038405 | Ga0495613_0038405_816_1445 | 199 |
| 192 | 3300046689 | Ga0495613_0467563 | Ga0495613_0467563_127_756 | 199 |
| 193 | 3300047318 | Ga0495636_0252766 | Ga0495636_0252766_133_756 | 199 |
| 194 | 3300047319 | Ga0495674_0144564 | Ga0495674_0144564_408_1037 | 199 |
| 195 | 3300047320 | Ga0495672_0037582 | Ga0495672_0037582_1617_2216 | 199 |
| 196 | 3300047321 | Ga0495676_0364198 | Ga0495676_0364198_20_622 | 199 |
| 197 | 3300047444 | Ga0495675_0294961 | Ga0495675_0294961_288_917 | 199 |
| 198 | 3300047471 | Ga0495684_0671762 | Ga0495684_0671762_49_678 | 199 |
| 199 | 3300048915 | Ga0496112_0283258 | Ga0496112_0283258_316_939 | 199 |
| 200 | 3300048916 | Ga0496113_0794084 | Ga0496113_0794084_100_723 | 199 |
| 201 | 3300049578 | Ga0501042_0053513 | Ga0501042_0053513_967_1569 | 199 |
| 202 | 3300049582 | Ga0501048_0597917 | Ga0501048_0597917_38_640 | 199 |
| 203 | 3300049589 | Ga0501073_0011091 | Ga0501073_0011091_3251_3853 | 199 |
| 204 | 3300049593 | Ga0501077_0415654 | Ga0501077_0415654_66_665 | 199 |
| 205 | 3300050493 | nmdc:mga0k408_269546_c1 | nmdc:mga0k408_269546_c1_159_758 | 199 |
| 206 | 3300050494 | nmdc:mga06z11_59909_c1 | nmdc:mga06z11_59909_c1_311_910 | 199 |
| 207 | 3300050494 | nmdc:mga06z11_601988_c1 | nmdc:mga06z11_601988_c1_44_643 | 199 |
| 208 | 3300050507 | nmdc:mga05p37_1065123_c1 | nmdc:mga05p37_1065123_c1_109_708 | 199 |
| 209 | 3300050507 | nmdc:mga05p37_156889_c1 | nmdc:mga05p37_156889_c1_1973_2575 | 199 |
| 210 | 3300050507 | nmdc:mga05p37_6390_c1 | nmdc:mga05p37_6390_c1_4825_5424 | 199 |
| 211 | 3300050509 | nmdc:mga0qj67_26160_c1 | nmdc:mga0qj67_26160_c1_1102_1701 | 199 |
| 212 | 3300050510 | nmdc:mga06r32_519283_c1 | nmdc:mga06r32_519283_c1_308_907 | 199 |
| 213 | 3300050510 | nmdc:mga06r32_85653_c1 | nmdc:mga06r32_85653_c1_2014_2613 | 199 |
| 214 | 3300050511 | nmdc:mga08y16_143533_c1 | nmdc:mga08y16_143533_c1_1037_1675 | 199 |
| 215 | 3300050511 | nmdc:mga08y16_4144_c1 | nmdc:mga08y16_4144_c1_7684_8286 | 199 |
| 216 | 3300050515 | nmdc:mga0a205_22963_c1 | nmdc:mga0a205_22963_c1_4703_5305 | 199 |
| 217 | 3300053085 | Ga0495619_0211108 | Ga0495619_0211108_318_947 | 199 |
| 218 | 3300053104 | Ga0500556_0004903 | Ga0500556_0004903_2861_3460 | 199 |
| 219 | 3300053139 | Ga0500568_0001250 | Ga0500568_0001250_8096_8695 | 199 |
| 220 | 3300005333 | Ga0070677_10014120 | Ga0070677_100141202 | 200 |
| 221 | 3300005444 | Ga0070694_100303170 | Ga0070694_1003031702 | 200 |
| 222 | 3300014969 | Ga0157376_10609510 | Ga0157376_106095102 | 200 |
| 223 | 3300031711 | Ga0265314_10124048 | Ga0265314_101240482 | 200 |
| 224 | 3300005290 | Ga0065712_10001091 | Ga0065712_100010919 | 201 |
| 225 | 3300005290 | Ga0065712_10126892 | Ga0065712_101268922 | 201 |
| 226 | 3300005331 | Ga0070670_100413924 | Ga0070670_1004139242 | 201 |
| 227 | 3300005331 | Ga0070670_100639346 | Ga0070670_1006393461 | 201 |
| 228 | 3300005333 | Ga0070677_10059186 | Ga0070677_100591862 | 201 |
| 229 | 3300005340 | Ga0070689_100486914 | Ga0070689_1004869142 | 201 |
| 230 | 3300005344 | Ga0070661_100222388 | Ga0070661_1002223882 | 201 |
| 231 | 3300005354 | Ga0070675_100170757 | Ga0070675_1001707572 | 201 |
| 232 | 3300005364 | Ga0070673_100381104 | Ga0070673_1003811042 | 201 |
| 233 | 3300005438 | Ga0070701_10288916 | Ga0070701_102889161 | 201 |
| 234 | 3300005441 | Ga0070700_100011402 | Ga0070700_1000114022 | 201 |
| 235 | 3300005441 | Ga0070700_100333794 | Ga0070700_1003337942 | 201 |
| 236 | 3300005459 | Ga0068867_100274648 | Ga0068867_1002746483 | 201 |
| 237 | 3300005468 | Ga0070707_100533300 | Ga0070707_1005333002 | 201 |
| 238 | 3300005471 | Ga0070698_100013300 | Ga0070698_1000133005 | 201 |
| 239 | 3300005471 | Ga0070698_100807389 | Ga0070698_1008073891 | 201 |
| 240 | 3300005518 | Ga0070699_100000583 | Ga0070699_10000058328 | 201 |
| 241 | 3300005536 | Ga0070697_100151682 | Ga0070697_1001516823 | 201 |
| 242 | 3300005543 | Ga0070672_100028826 | Ga0070672_1000288264 | 201 |
| 243 | 3300005549 | Ga0070704_100051031 | Ga0070704_1000510313 | 201 |
| 244 | 3300005564 | Ga0070664_100068344 | Ga0070664_1000683443 | 201 |
| 245 | 3300005617 | Ga0068859_100132982 | Ga0068859_1001329821 | 201 |
| 246 | 3300005617 | Ga0068859_100761620 | Ga0068859_1007616201 | 201 |
| 247 | 3300005719 | Ga0068861_100378294 | Ga0068861_1003782941 | 201 |
| 248 | 3300006042 | Ga0075368_10060018 | Ga0075368_100600182 | 201 |
| 249 | 3300006048 | Ga0075363_100194642 | Ga0075363_1001946422 | 201 |
| 250 | 3300006051 | Ga0075364_10223328 | Ga0075364_102233282 | 201 |
| 251 | 3300006178 | Ga0075367_10147151 | Ga0075367_101471512 | 201 |
| 252 | 3300006195 | Ga0075366_10094215 | Ga0075366_100942152 | 201 |
| 253 | 3300006195 | Ga0075366_10231405 | Ga0075366_102314051 | 201 |
| 254 | 3300006844 | Ga0075428_100199883 | Ga0075428_1001998833 | 201 |
| 255 | 3300006846 | Ga0075430_100012111 | Ga0075430_1000121113 | 201 |
| 256 | 3300006847 | Ga0075431_100176645 | Ga0075431_1001766453 | 201 |
| 257 | 3300006880 | Ga0075429_100192675 | Ga0075429_1001926752 | 201 |
| 258 | 3300006880 | Ga0075429_100209284 | Ga0075429_1002092843 | 201 |
| 259 | 3300006931 | Ga0097620_100761650 | Ga0097620_1007616502 | 201 |
| 260 | 3300009094 | Ga0111539_10091809 | Ga0111539_100918092 | 201 |
| 261 | 3300009094 | Ga0111539_10118256 | Ga0111539_101182562 | 201 |
| 262 | 3300009094 | Ga0111539_10341327 | Ga0111539_103413272 | 201 |
| 263 | 3300009147 | Ga0114129_10222913 | Ga0114129_102229132 | 201 |
| 264 | 3300009553 | Ga0105249_11061842 | Ga0105249_110618421 | 201 |
| 265 | 3300013308 | Ga0157375_10244462 | Ga0157375_102444622 | 201 |
| 266 | 3300014325 | Ga0163163_10216404 | Ga0163163_102164042 | 201 |
| 267 | 3300014326 | Ga0157380_10006079 | Ga0157380_100060796 | 201 |
| 268 | 3300014326 | Ga0157380_10032348 | Ga0157380_100323482 | 201 |
| 269 | 3300014326 | Ga0157380_10086179 | Ga0157380_100861792 | 201 |
| 270 | 3300014326 | Ga0157380_10101472 | Ga0157380_101014723 | 201 |
| 271 | 3300025893 | Ga0207682_10102522 | Ga0207682_101025221 | 201 |
| 272 | 3300025923 | Ga0207681_10277705 | Ga0207681_102777052 | 201 |
| 273 | 3300025925 | Ga0207650_10264700 | Ga0207650_102647002 | 201 |
| 274 | 3300025925 | Ga0207650_10304355 | Ga0207650_103043552 | 201 |
| 275 | 3300025926 | Ga0207659_10037011 | Ga0207659_100370116 | 201 |
| 276 | 3300025933 | Ga0207706_10908306 | Ga0207706_109083061 | 201 |
| 277 | 3300025936 | Ga0207670_10615998 | Ga0207670_106159982 | 201 |
| 278 | 3300025940 | Ga0207691_10106883 | Ga0207691_101068833 | 201 |
| 279 | 3300025945 | Ga0207679_10173759 | Ga0207679_101737592 | 201 |
| 280 | 3300026075 | Ga0207708_10436213 | Ga0207708_104362131 | 201 |
| 281 | 3300026089 | Ga0207648_10735500 | Ga0207648_107355001 | 201 |
| 282 | 3300027866 | Ga0209813_10017109 | Ga0209813_100171092 | 201 |
| 283 | 3300031731 | Ga0307405_10132678 | Ga0307405_101326782 | 201 |
| 284 | 3300031824 | Ga0307413_10174858 | Ga0307413_101748582 | 201 |
| 285 | 3300031995 | Ga0307409_100120802 | Ga0307409_1001208023 | 201 |
| 286 | 3300032002 | Ga0307416_100067358 | Ga0307416_1000673582 | 201 |
| 287 | 3300032002 | Ga0307416_100131693 | Ga0307416_1001316932 | 201 |
| 288 | 3300032004 | Ga0307414_10075731 | Ga0307414_100757313 | 201 |
| 289 | 3300032126 | Ga0307415_100236183 | Ga0307415_1002361832 | 201 |
| 290 | 3300041408 | Ga0439453_0031190 | Ga0439453_0031190_12_620 | 201 |
| 291 | 3300041999 | Ga0439433_0001690 | Ga0439433_0001690_1874_2503 | 201 |
| 292 | 3300041999 | Ga0439433_0024246 | Ga0439433_0024246_294_923 | 201 |
| 293 | 3300042002 | Ga0439442_067919 | Ga0439442_067919_34_663 | 201 |
| 294 | 3300042015 | Ga0439462_0048289 | Ga0439462_0048289_112_741 | 201 |
| 295 | 3300042125 | Ga0450923_003441 | Ga0450923_003441_1077_1706 | 201 |
| 296 | 3300042156 | Ga0439446_0002406 | Ga0439446_0002406_2863_3492 | 201 |
| 297 | 3300042436 | Ga0439435_0005184 | Ga0439435_0005184_1467_2075 | 201 |
| 298 | 3300042439 | Ga0439464_0099360 | Ga0439464_0099360_90_785 | 201 |
| 299 | 3300046460 | Ga0495638_0013750 | Ga0495638_0013750_4741_5370 | 201 |
| 300 | 3300048909 | Ga0496106_0602700 | Ga0496106_0602700_137_742 | 201 |
| 301 | 3300048913 | Ga0496110_0252348 | Ga0496110_0252348_906_1511 | 201 |
| 302 | 3300049588 | Ga0501072_0113138 | Ga0501072_0113138_1543_2151 | 201 |
| 303 | 3300049591 | Ga0501075_0043287 | Ga0501075_0043287_2630_3238 | 201 |
| 304 | 3300049592 | Ga0501076_0175734 | Ga0501076_0175734_76_684 | 201 |
| 305 | 3300049741 | Ga0501079_0909881 | Ga0501079_0909881_46_675 | 201 |
| 306 | 3300049824 | Ga0501045_0014212 | Ga0501045_0014212_516_1124 | 201 |
| 307 | 3300050493 | nmdc:mga0k408_208342_c1 | nmdc:mga0k408_208342_c1_58_690 | 201 |
| 308 | 3300050493 | nmdc:mga0k408_66536_c1 | nmdc:mga0k408_66536_c1_323_952 | 201 |
| 309 | 3300050494 | nmdc:mga06z11_26312_c1 | nmdc:mga06z11_26312_c1_2014_2643 | 201 |
| 310 | 3300050495 | nmdc:mga04h51_81624_c1 | nmdc:mga04h51_81624_c1_284_913 | 201 |
| 311 | 3300050507 | nmdc:mga05p37_314843_c1 | nmdc:mga05p37_314843_c1_1156_1785 | 201 |
| 312 | 3300050507 | nmdc:mga05p37_498383_c1 | nmdc:mga05p37_498383_c1_360_965 | 201 |
| 313 | 3300050508 | nmdc:mga09592_216068_c1 | nmdc:mga09592_216068_c1_686_1315 | 201 |
| 314 | 3300050510 | nmdc:mga06r32_198058_c1 | nmdc:mga06r32_198058_c1_1233_1862 | 201 |
| 315 | 3300050511 | nmdc:mga08y16_69898_c1 | nmdc:mga08y16_69898_c1_1301_1930 | 201 |
| 316 | 3300050512 | nmdc:mga0n895_28518_c2 | nmdc:mga0n895_28518_c2_141_770 | 201 |
| 317 | 3300050513 | nmdc:mga0rr50_569020_c1 | nmdc:mga0rr50_569020_c1_220_849 | 201 |
| 318 | 3300053090 | Ga0500646_0124698 | Ga0500646_0124698_178_807 | 201 |
| 319 | 3300053096 | Ga0500641_0001989 | Ga0500641_0001989_6372_7001 | 201 |
| 320 | 3300053103 | Ga0500555_007247 | Ga0500555_007247_2313_2966 | 201 |
| 321 | 3300053134 | Ga0500658_0293281 | Ga0500658_0293281_107_736 | 201 |
| 322 | 3300060353 | Ga0501082_0023640 | Ga0501082_0023640_1991_2599 | 201 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7b1l-assembly1.cif.gz_A | crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. | 0.8544 | 1 | 201 |
| 4q7c-assembly1.cif.gz_B | structure of af2299, a cdp-alcohol phosphotransferase | 0.7244 | 8 | 193 |
| 4q7c-assembly1.cif.gz_A | structure of af2299, a cdp-alcohol phosphotransferase | 0.7051 | 8 | 193 |
| 4o6m-assembly1.cif.gz_A | structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) | 0.6967 | 8 | 192 |
| 7b1l-assembly1.cif.gz_A | crystal structure of phosphatidyl serine synthase (pss) in the closed conformation with bound citrate. | 0.6802 | 1 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O94584_24_237_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9143 | 2 | 198 | 1.20.120.1760 |
| af_A0A1D8PF32_71_260_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.897 | 1 | 188 | 1.20.120.1760 |
| af_O94584_24_237_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8926 | 2 | 198 | 1.20.120.1760 |
| af_Q58609_4_200_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8887 | 3 | 201 | 1.20.120.1760 |
| af_A0A1D8PF32_71_260_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8836 | 1 | 188 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P0EMV5-F1-model_v4 | deleted | 0.9725 | 3 | 89 |
|
| AF-A0A068S3H5-F1-model_v4 | Pyruvate carboxylase | 0.9647 | 1 | 96 |
GO:0005524
GO:0008654 GO:0016020 GO:0016780 GO:0016874 GO:0046872 |
| AF-A0A6P0EMV5-F1-model_v4 | deleted | 0.9509 | 3 | 89 |
|
| AF-A0A1Y1YAZ4-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) | 0.9324 | 3 | 201 |
GO:0008654
GO:0012505 GO:0016020 GO:0016780 |
| AF-A0A015LXI4-F1-model_v4 | CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8) (Phosphatidylserine synthase) | 0.9315 | 10 | 201 |
GO:0008654
GO:0012505 GO:0016020 GO:0016780 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar