F406371

General Info

Members Datasets Scaffolds Average Seq Length
322 184 644 157

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100501988|Ga0068861_1005019881
Length 172
Sequence MPIEVRRFGVGHRRPDGPPGTTGVSGQAIHSDARGVISELAFGRNGRIEPHSNPNTTWFIVIEGGGWVIVDGEPLRVAAGEAILWPPDVPHGAWADHGHMRAFVVELAGPDDTMFRGILEGHAVARLGPGDARGHATGGSGTDGPRTVSRGEGTLSGPDHPPPPDPEAGEPH

Samples

Sample ID Description Type Environment
1 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
122 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
123 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.7
Rhizosphere 90.37
Stem 0
Stem Tuber 0
Unclassified 26.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068861_100501988 3300005719 Bacteria 1097
2 Ga0070683_100089214 3300005329 Bacteria 2894
3 Ga0070683_100472109 3300005329 Bacteria 1198
4 Ga0070690_100294454 3300005330 Bacteria 1162
5 Ga0068869_100230139 3300005334 Unclassified 1472
6 Ga0070666_10152018 3300005335 Unclassified 1615
7 Ga0070680_100903158 3300005336 Bacteria 762
8 Ga0070682_100483380 3300005337 Bacteria 956
9 Ga0070682_100597173 3300005337 Bacteria 871
10 Ga0070691_10528561 3300005341 Unclassified 686
11 Ga0070687_100209935 3300005343 Unclassified 1185
12 Ga0070692_10012007 3300005345 Bacteria 3995
13 Ga0070674_100013642 3300005356 Bacteria 5029
14 Ga0070673_100278583 3300005364 Bacteria 1466
15 Ga0070673_100468122 3300005364 Bacteria 1136
16 Ga0070659_100888532 3300005366 Unclassified 778
17 Ga0070703_10012659 3300005406 Bacteria 2390
18 Ga0070705_100016308 3300005440 Bacteria 3859
19 Ga0070705_100057502 3300005440 Bacteria 2295
20 Ga0070705_100060291 3300005440 Unclassified 2250
21 Ga0070694_100002950 3300005444 Bacteria 10111
22 Ga0070694_100041541 3300005444 Bacteria 3068
23 Ga0070694_100064898 3300005444 Bacteria 2500
24 Ga0070694_100192381 3300005444 Bacteria 1516
25 Ga0070708_100006865 3300005445 Bacteria 9080
26 Ga0070708_100103135 3300005445 Bacteria 2614
27 Ga0070708_100144657 3300005445 Bacteria 2207
28 Ga0070708_100208261 3300005445 Bacteria 1832
29 Ga0070663_100658859 3300005455 Bacteria 886
30 Ga0070678_100098890 3300005456 Unclassified 2257
31 Ga0070681_10092626 3300005458 Bacteria 2971
32 Ga0070681_11304931 3300005458 Unclassified 649
33 Ga0070685_10387940 3300005466 Unclassified 964
34 Ga0070706_100000989 3300005467 Bacteria 30934
35 Ga0070706_100005544 3300005467 Bacteria 12018
36 Ga0070706_100014493 3300005467 Bacteria 7282
37 Ga0070706_100015251 3300005467 Bacteria 7094
38 Ga0070707_100006983 3300005468 Bacteria 10466
39 Ga0070707_100030570 3300005468 Bacteria 5128
40 Ga0070707_100038137 3300005468 Bacteria 4589
41 Ga0070707_101895019 3300005468 Bacteria 563
42 Ga0070698_100028456 3300005471 Bacteria 5804
43 Ga0070698_100064429 3300005471 Bacteria 3692
44 Ga0070698_100072013 3300005471 Bacteria 3465
45 Ga0070698_100101760 3300005471 Bacteria 2844
46 Ga0070698_100207622 3300005471 Unclassified 1894
47 Ga0070698_100220776 3300005471 Unclassified 1829
48 Ga0070698_100425588 3300005471 Bacteria 1262
49 Ga0070699_100005107 3300005518 Bacteria 11547
50 Ga0070699_100007254 3300005518 Bacteria 9647
51 Ga0070699_100051897 3300005518 Bacteria 3551
52 Ga0070699_100082116 3300005518 Bacteria 2809
53 Ga0070699_100167108 3300005518 Bacteria 1949
54 Ga0070699_100307422 3300005518 Unclassified 1423
55 Ga0070679_100560416 3300005530 Unclassified 1086
56 Ga0070684_100174720 3300005535 Bacteria 1952
57 Ga0070684_100284964 3300005535 Unclassified 1514
58 Ga0070697_100020105 3300005536 Bacteria 5277
59 Ga0070697_100026033 3300005536 Bacteria 4667
60 Ga0070697_100071801 3300005536 Bacteria 2840
61 Ga0070697_100549342 3300005536 Bacteria 1013
62 Ga0068853_100241705 3300005539 Bacteria 1655
63 Ga0070695_100007857 3300005545 Bacteria 6318
64 Ga0070695_100026682 3300005545 Bacteria 3576
65 Ga0070695_100032292 3300005545 Bacteria 3273
66 Ga0070695_100205357 3300005545 Unclassified 1411
67 Ga0070696_100006317 3300005546 Bacteria 7934
68 Ga0070696_100012601 3300005546 Bacteria 5676
69 Ga0070696_100094453 3300005546 Unclassified 2134
70 Ga0070696_100357878 3300005546 Unclassified 1132
71 Ga0070693_100266459 3300005547 Unclassified 1142
72 Ga0070665_101217125 3300005548 Bacteria 764
73 Ga0070704_100089973 3300005549 Unclassified 2285
74 Ga0068855_100432718 3300005563 Bacteria 1438
75 Ga0070664_101044274 3300005564 Bacteria 769
76 Ga0068857_100286871 3300005577 Bacteria 1515
77 Ga0068857_100732013 3300005577 Unclassified 941
78 Ga0068856_100077662 3300005614 Bacteria 3290
79 Ga0070702_100311542 3300005615 Bacteria 1093
80 Ga0068852_101812430 3300005616 Unclassified 632
81 Ga0068864_100880046 3300005618 Unclassified 884
82 Ga0068864_101020279 3300005618 Bacteria 821
83 Ga0068861_101072910 3300005719 Unclassified 773
84 Ga0068858_100392025 3300005842 Bacteria 1333
85 Ga0068860_100017303 3300005843 Bacteria 7024
86 Ga0081539_10020866 3300005985 Bacteria 4401
87 Ga0070716_100146770 3300006173 Bacteria 1512
88 Ga0068871_101087663 3300006358 Bacteria 747
89 Ga0075428_100000081 3300006844 Bacteria 80139
90 Ga0075430_101056514 3300006846 Bacteria 669
91 Ga0075433_10373863 3300006852 Unclassified 1258
92 Ga0075434_100262960 3300006871 Bacteria 1745
93 Ga0075434_100475534 3300006871 Unclassified 1271
94 Ga0075434_101764738 3300006871 Bacteria 626
95 Ga0075429_100134915 3300006880 Bacteria 2160
96 Ga0075436_100205867 3300006914 Bacteria 1394
97 Ga0075435_100263041 3300007076 Unclassified 1470
98 Ga0111539_10116719 3300009094 Bacteria 3129
99 Ga0105245_10176140 3300009098 Unclassified 2040
100 Ga0105245_10267114 3300009098 Bacteria 1667
101 Ga0105245_11042438 3300009098 Bacteria 863
102 Ga0105247_10092256 3300009101 Bacteria 1924
103 Ga0114129_10000286 3300009147 Bacteria 58249
104 Ga0114129_10064762 3300009147 Bacteria 5101
105 Ga0105243_10454423 3300009148 Unclassified 1203
106 Ga0105241_11994733 3300009174 Bacteria 571
107 Ga0105242_10138450 3300009176 Unclassified 2109
108 Ga0105248_11672327 3300009177 Bacteria 721
109 Ga0105238_10635019 3300009551 Bacteria 1077
110 Ga0105249_10054909 3300009553 Bacteria 3643
111 Ga0105249_10232111 3300009553 Bacteria 1820
112 Ga0105239_10156307 3300010375 Bacteria 2546
113 Ga0105239_10197371 3300010375 Bacteria 2254
114 Ga0105246_10090939 3300011119 Bacteria 2199
115 Ga0105246_10094673 3300011119 Bacteria 2161
116 Ga0157378_11233013 3300013297 Bacteria 788
117 Ga0163162_10843242 3300013306 Unclassified 1032
118 Ga0157372_12166385 3300013307 Unclassified 639
119 Ga0157375_10063994 3300013308 Bacteria 3661
120 Ga0157375_11923083 3300013308 Unclassified 702
121 Ga0163163_10029210 3300014325 Bacteria 5302
122 Ga0163163_10118305 3300014325 Bacteria 2682
123 Ga0163163_10198926 3300014325 Unclassified 2052
124 Ga0163163_10309101 3300014325 Unclassified 1633
125 Ga0157380_10060503 3300014326 Bacteria 3027
126 Ga0157380_10798520 3300014326 Bacteria 960
127 Ga0182008_10079826 3300014497 Unclassified 1610
128 Ga0157377_10231691 3300014745 Bacteria 1188
129 Ga0157377_10249701 3300014745 Bacteria 1149
130 Ga0157379_10023124 3300014968 Bacteria 5512
131 Ga0157376_10226829 3300014969 Unclassified 1733
132 Ga0163161_10099639 3300017792 Bacteria 2161
133 Ga0213876_10483136 3300021384 Bacteria 659
134 Ga0207653_10004014 3300025885 Bacteria 4630
135 Ga0207710_10262227 3300025900 Bacteria 866
136 Ga0207643_10376916 3300025908 Unclassified 894
137 Ga0207684_10001351 3300025910 Bacteria 26891
138 Ga0207684_10044784 3300025910 Bacteria 3753
139 Ga0207684_10058044 3300025910 Bacteria 3284
140 Ga0207684_10232328 3300025910 Bacteria 1591
141 Ga0207707_10266949 3300025912 Bacteria 1484
142 Ga0207707_11068938 3300025912 Unclassified 659
143 Ga0207660_10666570 3300025917 Unclassified 848
144 Ga0207662_10231232 3300025918 Bacteria 1208
145 Ga0207652_10488734 3300025921 Unclassified 1109
146 Ga0207652_10709078 3300025921 Unclassified 897
147 Ga0207646_10010276 3300025922 Bacteria 9160
148 Ga0207646_10033936 3300025922 Bacteria 4612
149 Ga0207646_10049982 3300025922 Bacteria 3743
150 Ga0207646_10089613 3300025922 Bacteria 2753
151 Ga0207659_10204844 3300025926 Bacteria 1578
152 Ga0207709_10195227 3300025935 Bacteria 1441
153 Ga0207709_10362780 3300025935 Unclassified 1097
154 Ga0207709_10660023 3300025935 Unclassified 833
155 Ga0207669_10047257 3300025937 Bacteria 2548
156 Ga0207665_10314827 3300025939 Bacteria 1173
157 Ga0207691_10146529 3300025940 Unclassified 2078
158 Ga0207689_10578851 3300025942 Unclassified 944
159 Ga0207661_10050799 3300025944 Bacteria 3306
160 Ga0207679_10371063 3300025945 Unclassified 1252
161 Ga0207667_10178729 3300025949 Bacteria 2180
162 Ga0207677_10070894 3300026023 Bacteria 2458
163 Ga0207703_10144696 3300026035 Bacteria 2066
164 Ga0207703_11283410 3300026035 Unclassified 704
165 Ga0207639_10292668 3300026041 Bacteria 1436
166 Ga0207678_10177652 3300026067 Unclassified 1818
167 Ga0207678_10459424 3300026067 Bacteria 1107
168 Ga0207678_10468900 3300026067 Unclassified 1096
169 Ga0207708_10169715 3300026075 Bacteria 1727
170 Ga0207708_10645474 3300026075 Unclassified 900
171 Ga0207641_10389925 3300026088 Bacteria 1336
172 Ga0207641_10715651 3300026088 Bacteria 987
173 Ga0207648_10339698 3300026089 Bacteria 1352
174 Ga0207676_10343647 3300026095 Unclassified 1378
175 Ga0207676_10365408 3300026095 Bacteria 1339
176 Ga0207674_10367339 3300026116 Unclassified 1391
177 Ga0207675_100381476 3300026118 Unclassified 1386
178 Ga0207683_10129907 3300026121 Bacteria 2265
179 Ga0207683_10325871 3300026121 Bacteria 1407
180 Ga0207683_11159522 3300026121 Unclassified 716
181 Ga0207698_10722858 3300026142 Bacteria 992
182 Ga0268265_10018043 3300028380 Bacteria 4886
183 Ga0268265_10144635 3300028380 Bacteria 1996
184 Ga0268264_10285394 3300028381 Bacteria 1548
185 Ga0268264_10295260 3300028381 Unclassified 1523
186 Ga0316575_10157874 3300031665 Unclassified 937
187 Ga0316576_10010674 3300031727 Bacteria 5982
188 Ga0316578_10271461 3300031728 Bacteria 1016
189 Ga0307405_10007625 3300031731 Bacteria 5430
190 Ga0307406_10063930 3300031901 Bacteria 2386
191 Ga0307416_100035431 3300032002 Bacteria 3811
192 Ga0307415_100001759 3300032126 Bacteria 10577
193 Ga0373951_0241107 3300035091 Bacteria 540
194 Ga0373943_0245691 3300035170 Bacteria 1004
195 Ga0316574_0047479 3300035398 Bacteria 2665
196 Ga0316574_0145538 3300035398 Bacteria 1527
197 Ga0436365_0351059 3300039437 Bacteria 903
198 Ga0451851_0081356 3300041507 Unclassified 542
199 Ga0439434_0050889 3300042435 Bacteria 1284
200 Ga0439459_0066269 3300042438 Unclassified 826
201 Ga0451577_0011953 3300042876 Bacteria 8181
202 Ga0451577_1027595 3300042876 Bacteria 739
203 Ga0451576_0580076 3300045051 Unclassified 1178
204 Ga0495590_0057590 3300046457 Bacteria 1359
205 Ga0495641_0069540 3300046461 Unclassified 1582
206 Ga0495628_0592266 3300046516 Bacteria 793
207 Ga0495630_0333060 3300046517 Bacteria 1161
208 Ga0495647_0484179 3300046681 Unclassified 575
209 Ga0495658_0114095 3300046683 Bacteria 1628
210 Ga0495624_0308898 3300046690 Bacteria 953
211 Ga0495674_0365243 3300047319 Bacteria 1170
212 Ga0495676_0253554 3300047321 Unclassified 1199
213 Ga0496100_1559474 3300048903 Bacteria 522
214 Ga0496102_0216903 3300048905 Bacteria 1803
215 Ga0496102_0536463 3300048905 Unclassified 1093
216 Ga0496103_0245303 3300048906 Bacteria 1152
217 Ga0496103_0276960 3300048906 Bacteria 1079
218 Ga0496104_0049254 3300048907 Bacteria 3973
219 Ga0496104_1438186 3300048907 Unclassified 592
220 Ga0496105_0134355 3300048908 Bacteria 2038
221 Ga0496106_0127727 3300048909 Bacteria 1992
222 Ga0496106_0192010 3300048909 Unclassified 1624
223 Ga0496106_1067335 3300048909 Bacteria 634
224 Ga0496107_0129812 3300048910 Bacteria 1860
225 Ga0496107_0506856 3300048910 Bacteria 895
226 Ga0496108_0005388 3300048911 Bacteria 10340
227 Ga0496109_0033490 3300048912 Bacteria 4622
228 Ga0496109_0055515 3300048912 Bacteria 3613
229 Ga0496109_0158326 3300048912 Bacteria 2121
230 Ga0496110_0098321 3300048913 Bacteria 2622
231 Ga0496110_0754984 3300048913 Bacteria 876
232 Ga0496111_0005181 3300048914 Bacteria 8309
233 Ga0496111_0014785 3300048914 Bacteria 5343
234 Ga0496112_0017255 3300048915 Bacteria 6777
235 Ga0496112_0033599 3300048915 Bacteria 4987
236 Ga0496112_0095121 3300048915 Bacteria 2950
237 Ga0496112_0115882 3300048915 Bacteria 2650
238 Ga0496113_0505738 3300048916 Bacteria 970
239 Ga0496113_0544870 3300048916 Bacteria 931
240 Ga0496114_0224423 3300048917 Bacteria 1650
241 Ga0501031_0010334 3300049568 Bacteria 6082
242 Ga0501032_0076614 3300049569 Bacteria 2227
243 Ga0501036_0051520 3300049572 Bacteria 3485
244 Ga0501036_0496871 3300049572 Bacteria 1015
245 Ga0501036_0537372 3300049572 Bacteria 972
246 Ga0501038_0387921 3300049574 Bacteria 1082
247 Ga0501039_0110064 3300049575 Bacteria 2153
248 Ga0501039_0256096 3300049575 Bacteria 1376
249 Ga0501040_0037765 3300049576 Bacteria 3282
250 Ga0501040_1256668 3300049576 Bacteria 537
251 Ga0501041_0394211 3300049577 Bacteria 877
252 Ga0501042_0348519 3300049578 Unclassified 1071
253 Ga0501042_0878032 3300049578 Bacteria 653
254 Ga0501043_0800133 3300049579 Bacteria 682
255 Ga0501048_0155821 3300049582 Unclassified 1616
256 Ga0501048_0561775 3300049582 Bacteria 819
257 Ga0501067_0006869 3300049583 Bacteria 6313
258 Ga0501067_0183899 3300049583 Unclassified 1164
259 Ga0501068_0404586 3300049584 Bacteria 880
260 Ga0501069_0006224 3300049585 Bacteria 6236
261 Ga0501069_0117306 3300049585 Unclassified 1519
262 Ga0501069_0161408 3300049585 Unclassified 1291
263 Ga0501070_0057393 3300049586 Bacteria 3227
264 Ga0501070_0572135 3300049586 Bacteria 903
265 Ga0501071_0108212 3300049587 Bacteria 2053
266 Ga0501071_0147331 3300049587 Bacteria 1755
267 Ga0501071_0335737 3300049587 Bacteria 1149
268 Ga0501071_0361090 3300049587 Unclassified 1106
269 Ga0501072_0029605 3300049588 Bacteria 4278
270 Ga0501072_0164558 3300049588 Bacteria 1769
271 Ga0501072_0441301 3300049588 Bacteria 1031
272 Ga0501072_0955980 3300049588 Bacteria 668
273 Ga0501073_0904338 3300049589 Unclassified 608
274 Ga0501074_0262500 3300049590 Bacteria 1228
275 Ga0501074_0333477 3300049590 Unclassified 1077
276 Ga0501075_0049259 3300049591 Bacteria 3167
277 Ga0501075_0210715 3300049591 Bacteria 1482
278 Ga0501075_0214235 3300049591 Bacteria 1469
279 Ga0501075_0274593 3300049591 Unclassified 1284
280 Ga0501075_0277755 3300049591 Unclassified 1276
281 Ga0501075_0734022 3300049591 Unclassified 752
282 Ga0501076_0000785 3300049592 Bacteria 20486
283 Ga0501076_0013696 3300049592 Bacteria 6085
284 Ga0501076_0127820 3300049592 Bacteria 2060
285 Ga0501076_0360469 3300049592 Bacteria 1194
286 Ga0501076_0606020 3300049592 Bacteria 903
287 Ga0501076_1018226 3300049592 Unclassified 682
288 Ga0501077_0072544 3300049593 Bacteria 2182
289 Ga0501077_0204115 3300049593 Bacteria 1256
290 Ga0501079_0017180 3300049741 Bacteria 5524
291 Ga0501079_0456562 3300049741 Unclassified 1003
292 Ga0501079_0655816 3300049741 Bacteria 826
293 Ga0501080_0227742 3300049742 Unclassified 1704
294 Ga0501080_0828657 3300049742 Unclassified 810
295 Ga0501080_1363712 3300049742 Bacteria 606
296 Ga0501080_1594369 3300049742 Bacteria 553
297 Ga0501081_0040628 3300049743 Bacteria 3185
298 Ga0501081_0379591 3300049743 Bacteria 1044
299 Ga0501081_0513297 3300049743 Bacteria 894
300 Ga0501044_0375023 3300049823 Bacteria 1339
301 Ga0501045_0013346 3300049824 Bacteria 5801
302 Ga0501045_0031922 3300049824 Bacteria 3815
303 nmdc:mga05p37_77203_c1 3300050507 Bacteria 4100
304 nmdc:mga05p37_7_c1 3300050507 Bacteria 154761
305 nmdc:mga09592_43781_c1 3300050508 Bacteria 3765
306 nmdc:mga06r32_173820_c1 3300050510 Bacteria 2138
307 nmdc:mga0n895_50788_c1 3300050512 Bacteria 4066
308 nmdc:mga0n895_708942_c1 3300050512 Unclassified 1002
309 nmdc:mga0n895_797027_c1 3300050512 Unclassified 935
310 nmdc:mga0rr50_329745_c1 3300050513 Bacteria 1281
311 Ga0495612_0000201 3300053078 Bacteria 25503
312 Ga0495619_0498309 3300053085 Bacteria 838
313 Ga0495619_0935498 3300053085 Unclassified 582
314 Ga0501084_0149869 3300054114 Bacteria 1966
315 Ga0501084_0282543 3300054114 Bacteria 1402
316 Ga0501084_0459662 3300054114 Bacteria 1076
317 Ga0501082_0009815 3300060353 Bacteria 8247
318 Ga0501082_0335637 3300060353 Unclassified 1317
319 Ga0501082_0514237 3300060353 Bacteria 1047
320 Ga0530510_0055464 3300061734 Bacteria 2863
321 Ga0530510_0176449 3300061734 Unclassified 1584
322 Ga0530510_0493091 3300061734 Bacteria 928
323 Ga0068861_100501988
324 Ga0070683_100089214
325 Ga0070683_100472109
326 Ga0070690_100294454
327 Ga0068869_100230139
328 Ga0070666_10152018
329 Ga0070680_100903158
330 Ga0070682_100483380
331 Ga0070682_100597173
332 Ga0070691_10528561
333 Ga0070687_100209935
334 Ga0070692_10012007
335 Ga0070674_100013642
336 Ga0070673_100278583
337 Ga0070673_100468122
338 Ga0070659_100888532
339 Ga0070703_10012659
340 Ga0070705_100016308
341 Ga0070705_100057502
342 Ga0070705_100060291
343 Ga0070694_100002950
344 Ga0070694_100041541
345 Ga0070694_100064898
346 Ga0070694_100192381
347 Ga0070708_100006865
348 Ga0070708_100103135
349 Ga0070708_100144657
350 Ga0070708_100208261
351 Ga0070663_100658859
352 Ga0070678_100098890
353 Ga0070681_10092626
354 Ga0070681_11304931
355 Ga0070685_10387940
356 Ga0070706_100000989
357 Ga0070706_100005544
358 Ga0070706_100014493
359 Ga0070706_100015251
360 Ga0070707_100006983
361 Ga0070707_100030570
362 Ga0070707_100038137
363 Ga0070707_101895019
364 Ga0070698_100028456
365 Ga0070698_100064429
366 Ga0070698_100072013
367 Ga0070698_100101760
368 Ga0070698_100207622
369 Ga0070698_100220776
370 Ga0070698_100425588
371 Ga0070699_100005107
372 Ga0070699_100007254
373 Ga0070699_100051897
374 Ga0070699_100082116
375 Ga0070699_100167108
376 Ga0070699_100307422
377 Ga0070679_100560416
378 Ga0070684_100174720
379 Ga0070684_100284964
380 Ga0070697_100020105
381 Ga0070697_100026033
382 Ga0070697_100071801
383 Ga0070697_100549342
384 Ga0068853_100241705
385 Ga0070695_100007857
386 Ga0070695_100026682
387 Ga0070695_100032292
388 Ga0070695_100205357
389 Ga0070696_100006317
390 Ga0070696_100012601
391 Ga0070696_100094453
392 Ga0070696_100357878
393 Ga0070693_100266459
394 Ga0070665_101217125
395 Ga0070704_100089973
396 Ga0068855_100432718
397 Ga0070664_101044274
398 Ga0068857_100286871
399 Ga0068857_100732013
400 Ga0068856_100077662
401 Ga0070702_100311542
402 Ga0068852_101812430
403 Ga0068864_100880046
404 Ga0068864_101020279
405 Ga0068861_101072910
406 Ga0068858_100392025
407 Ga0068860_100017303
408 Ga0081539_10020866
409 Ga0070716_100146770
410 Ga0068871_101087663
411 Ga0075428_100000081
412 Ga0075430_101056514
413 Ga0075433_10373863
414 Ga0075434_100262960
415 Ga0075434_100475534
416 Ga0075434_101764738
417 Ga0075429_100134915
418 Ga0075436_100205867
419 Ga0075435_100263041
420 Ga0111539_10116719
421 Ga0105245_10176140
422 Ga0105245_10267114
423 Ga0105245_11042438
424 Ga0105247_10092256
425 Ga0114129_10000286
426 Ga0114129_10064762
427 Ga0105243_10454423
428 Ga0105241_11994733
429 Ga0105242_10138450
430 Ga0105248_11672327
431 Ga0105238_10635019
432 Ga0105249_10054909
433 Ga0105249_10232111
434 Ga0105239_10156307
435 Ga0105239_10197371
436 Ga0105246_10090939
437 Ga0105246_10094673
438 Ga0157378_11233013
439 Ga0163162_10843242
440 Ga0157372_12166385
441 Ga0157375_10063994
442 Ga0157375_11923083
443 Ga0163163_10029210
444 Ga0163163_10118305
445 Ga0163163_10198926
446 Ga0163163_10309101
447 Ga0157380_10060503
448 Ga0157380_10798520
449 Ga0182008_10079826
450 Ga0157377_10231691
451 Ga0157377_10249701
452 Ga0157379_10023124
453 Ga0157376_10226829
454 Ga0163161_10099639
455 Ga0213876_10483136
456 Ga0207653_10004014
457 Ga0207710_10262227
458 Ga0207643_10376916
459 Ga0207684_10001351
460 Ga0207684_10044784
461 Ga0207684_10058044
462 Ga0207684_10232328
463 Ga0207707_10266949
464 Ga0207707_11068938
465 Ga0207660_10666570
466 Ga0207662_10231232
467 Ga0207652_10488734
468 Ga0207652_10709078
469 Ga0207646_10010276
470 Ga0207646_10033936
471 Ga0207646_10049982
472 Ga0207646_10089613
473 Ga0207659_10204844
474 Ga0207709_10195227
475 Ga0207709_10362780
476 Ga0207709_10660023
477 Ga0207669_10047257
478 Ga0207665_10314827
479 Ga0207691_10146529
480 Ga0207689_10578851
481 Ga0207661_10050799
482 Ga0207679_10371063
483 Ga0207667_10178729
484 Ga0207677_10070894
485 Ga0207703_10144696
486 Ga0207703_11283410
487 Ga0207639_10292668
488 Ga0207678_10177652
489 Ga0207678_10459424
490 Ga0207678_10468900
491 Ga0207708_10169715
492 Ga0207708_10645474
493 Ga0207641_10389925
494 Ga0207641_10715651
495 Ga0207648_10339698
496 Ga0207676_10343647
497 Ga0207676_10365408
498 Ga0207674_10367339
499 Ga0207675_100381476
500 Ga0207683_10129907
501 Ga0207683_10325871
502 Ga0207683_11159522
503 Ga0207698_10722858
504 Ga0268265_10018043
505 Ga0268265_10144635
506 Ga0268264_10285394
507 Ga0268264_10295260
508 Ga0316575_10157874
509 Ga0316576_10010674
510 Ga0316578_10271461
511 Ga0307405_10007625
512 Ga0307406_10063930
513 Ga0307416_100035431
514 Ga0307415_100001759
515 Ga0373951_0241107
516 Ga0373943_0245691
517 Ga0316574_0047479
518 Ga0316574_0145538
519 Ga0436365_0351059
520 Ga0451851_0081356
521 Ga0439434_0050889
522 Ga0439459_0066269
523 Ga0451577_0011953
524 Ga0451577_1027595
525 Ga0451576_0580076
526 Ga0495590_0057590
527 Ga0495641_0069540
528 Ga0495628_0592266
529 Ga0495630_0333060
530 Ga0495647_0484179
531 Ga0495658_0114095
532 Ga0495624_0308898
533 Ga0495674_0365243
534 Ga0495676_0253554
535 Ga0496100_1559474
536 Ga0496102_0216903
537 Ga0496102_0536463
538 Ga0496103_0245303
539 Ga0496103_0276960
540 Ga0496104_0049254
541 Ga0496104_1438186
542 Ga0496105_0134355
543 Ga0496106_0127727
544 Ga0496106_0192010
545 Ga0496106_1067335
546 Ga0496107_0129812
547 Ga0496107_0506856
548 Ga0496108_0005388
549 Ga0496109_0033490
550 Ga0496109_0055515
551 Ga0496109_0158326
552 Ga0496110_0098321
553 Ga0496110_0754984
554 Ga0496111_0005181
555 Ga0496111_0014785
556 Ga0496112_0017255
557 Ga0496112_0033599
558 Ga0496112_0095121
559 Ga0496112_0115882
560 Ga0496113_0505738
561 Ga0496113_0544870
562 Ga0496114_0224423
563 Ga0501031_0010334
564 Ga0501032_0076614
565 Ga0501036_0051520
566 Ga0501036_0496871
567 Ga0501036_0537372
568 Ga0501038_0387921
569 Ga0501039_0110064
570 Ga0501039_0256096
571 Ga0501040_0037765
572 Ga0501040_1256668
573 Ga0501041_0394211
574 Ga0501042_0348519
575 Ga0501042_0878032
576 Ga0501043_0800133
577 Ga0501048_0155821
578 Ga0501048_0561775
579 Ga0501067_0006869
580 Ga0501067_0183899
581 Ga0501068_0404586
582 Ga0501069_0006224
583 Ga0501069_0117306
584 Ga0501069_0161408
585 Ga0501070_0057393
586 Ga0501070_0572135
587 Ga0501071_0108212
588 Ga0501071_0147331
589 Ga0501071_0335737
590 Ga0501071_0361090
591 Ga0501072_0029605
592 Ga0501072_0164558
593 Ga0501072_0441301
594 Ga0501072_0955980
595 Ga0501073_0904338
596 Ga0501074_0262500
597 Ga0501074_0333477
598 Ga0501075_0049259
599 Ga0501075_0210715
600 Ga0501075_0214235
601 Ga0501075_0274593
602 Ga0501075_0277755
603 Ga0501075_0734022
604 Ga0501076_0000785
605 Ga0501076_0013696
606 Ga0501076_0127820
607 Ga0501076_0360469
608 Ga0501076_0606020
609 Ga0501076_1018226
610 Ga0501077_0072544
611 Ga0501077_0204115
612 Ga0501079_0017180
613 Ga0501079_0456562
614 Ga0501079_0655816
615 Ga0501080_0227742
616 Ga0501080_0828657
617 Ga0501080_1363712
618 Ga0501080_1594369
619 Ga0501081_0040628
620 Ga0501081_0379591
621 Ga0501081_0513297
622 Ga0501044_0375023
623 Ga0501045_0013346
624 Ga0501045_0031922
625 nmdc:mga05p37_77203_c1
626 nmdc:mga05p37_7_c1
627 nmdc:mga09592_43781_c1
628 nmdc:mga06r32_173820_c1
629 nmdc:mga0n895_50788_c1
630 nmdc:mga0n895_708942_c1
631 nmdc:mga0n895_797027_c1
632 nmdc:mga0rr50_329745_c1
633 Ga0495612_0000201
634 Ga0495619_0498309
635 Ga0495619_0935498
636 Ga0501084_0149869
637 Ga0501084_0282543
638 Ga0501084_0459662
639 Ga0501082_0009815
640 Ga0501082_0335637
641 Ga0501082_0514237
642 Ga0530510_0055464
643 Ga0530510_0176449
644 Ga0530510_0493091

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02311

AraC_binding

AraC-like ligand binding domain

39

128

0.88

PF07883

Cupin_2

Cupin domain

39

106

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.9442 24 107
3rns-assembly1.cif.gz_A cupin 2 conserved barrel domain protein from leptotrichia buccalis 0.944 24 108
5wse-assembly2.cif.gz_C crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.9373 21 107
5wse-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.9352 23 107
5wsf-assembly2.cif.gz_C crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii 0.935 23 107
ID Description Score Start End Superfamily
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9542 27 107 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9365 22 107 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9313 22 108 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9283 22 108 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9245 24 108 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A212DWR4-F1-model_v4 Cupin 0.9832 24 108
AF-A0A3D6ECS2-F1-model_v4 Cupin domain-containing protein 0.9782 24 109
AF-A0A3N2MYP7-F1-model_v4 deleted 0.9777 24 109
AF-A0A3C0TR72-F1-model_v4 Cupin type-2 domain-containing protein 0.9771 24 107
AF-A0A7C0UMU4-F1-model_v4 Cupin domain-containing protein 0.976 24 107 GO:0016020

Map