F405956
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 321 | 222 | 320 | 346 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10355495|Ga0105248_103554951 |
| Length | 366 |
| Sequence | VGANHRRYNRRSINYRPQAMPATMILTGDVNLMNVTDPDVPFKRVADEFRTTDVVFSNLECCLYHPPGGHSVDTEGFFADPLAGGDTLKRAGIHAVGIANNVNYGEAAIRSSIARLDELGIPHTGAGANRAAARAPVVLNRNGVRYGFLQRTSVYWPTNHEAAENAPGVAVIRGHTAYQLPLHKTRPEIPPANRPGLPPVIITWADAKYLQQYKEDVTALRSQCDILVASCHWGLHQDVLDYMPEIAHAAIDAGADIVIGHGPHYSLPVEAYKGKPIYYGLGSFSFHTGHGGRKHGDWVGMMARVRVDGKTIKHATFQFVRHNDANESVLCALTNEQATLEDITARSAKFGSKLKVEGDQVSIALS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 66 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 67 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 68 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 106 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 107 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 109 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 110 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 111 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 112 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 113 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 115 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 116 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 117 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 118 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 119 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 120 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 121 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 122 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 123 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 124 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 125 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 126 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 127 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 128 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 129 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 130 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 131 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 132 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 135 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 136 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 137 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 138 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 139 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 140 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 141 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 142 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 143 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 144 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 194 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 196 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 197 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 198 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0 |
| Isolates | 0.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0.31 |
| Rhizoplane | 2.49 |
| Rhizosphere | 93.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10007666 | 3300005327 | Bacteria | 8700 |
| 2 | Ga0070676_10154995 | 3300005328 | Bacteria | 1469 |
| 3 | Ga0070683_100017888 | 3300005329 | Bacteria | 6266 |
| 4 | Ga0070690_100067813 | 3300005330 | Bacteria | 2312 |
| 5 | Ga0070677_10063967 | 3300005333 | Bacteria | 1526 |
| 6 | Ga0070666_10050559 | 3300005335 | Bacteria | 2796 |
| 7 | Ga0070680_100077985 | 3300005336 | Bacteria | 2729 |
| 8 | Ga0070682_100059975 | 3300005337 | Bacteria | 2405 |
| 9 | Ga0068868_100023165 | 3300005338 | Bacteria | 4697 |
| 10 | Ga0068868_100226612 | 3300005338 | Bacteria | 1566 |
| 11 | Ga0070687_100021981 | 3300005343 | Bacteria | 3008 |
| 12 | Ga0070675_100089068 | 3300005354 | Bacteria | 2583 |
| 13 | Ga0070675_100188231 | 3300005354 | Bacteria | 1787 |
| 14 | Ga0070671_100029630 | 3300005355 | Bacteria | 4513 |
| 15 | Ga0070674_100074601 | 3300005356 | Bacteria | 2407 |
| 16 | Ga0070674_100129606 | 3300005356 | Bacteria | 1878 |
| 17 | Ga0070673_100291783 | 3300005364 | Bacteria | 1433 |
| 18 | Ga0070688_100238477 | 3300005365 | Unclassified | 1289 |
| 19 | Ga0070714_100456287 | 3300005435 | Bacteria | 1214 |
| 20 | Ga0070713_100142454 | 3300005436 | Unclassified | 2125 |
| 21 | Ga0070701_10112583 | 3300005438 | Unclassified | 1523 |
| 22 | Ga0070711_100062177 | 3300005439 | Bacteria | 2602 |
| 23 | Ga0070700_100026323 | 3300005441 | Bacteria | 3434 |
| 24 | Ga0070700_100047281 | 3300005441 | Bacteria | 2662 |
| 25 | Ga0070708_100099686 | 3300005445 | Bacteria | 2658 |
| 26 | Ga0070678_100004539 | 3300005456 | Bacteria | 7885 |
| 27 | Ga0070678_100053566 | 3300005456 | Bacteria | 2934 |
| 28 | Ga0070662_100185824 | 3300005457 | Bacteria | 1641 |
| 29 | Ga0070681_10000920 | 3300005458 | Bacteria | 24878 |
| 30 | Ga0070681_10065532 | 3300005458 | Bacteria | 3601 |
| 31 | Ga0068867_100226421 | 3300005459 | Bacteria | 1509 |
| 32 | Ga0070706_100011693 | 3300005467 | Bacteria | 8147 |
| 33 | Ga0070707_100010363 | 3300005468 | Bacteria | 8680 |
| 34 | Ga0070707_100095861 | 3300005468 | Bacteria | 2873 |
| 35 | Ga0070698_100001462 | 3300005471 | Bacteria | 26223 |
| 36 | Ga0070698_100103157 | 3300005471 | Bacteria | 2822 |
| 37 | Ga0070699_100071701 | 3300005518 | Bacteria | 3013 |
| 38 | Ga0070672_100027560 | 3300005543 | Bacteria | 4239 |
| 39 | Ga0070672_100144067 | 3300005543 | Bacteria | 1968 |
| 40 | Ga0070672_100204612 | 3300005543 | Bacteria | 1651 |
| 41 | Ga0070686_100040253 | 3300005544 | Bacteria | 2915 |
| 42 | Ga0070696_100013297 | 3300005546 | Bacteria | 5522 |
| 43 | Ga0070696_100036838 | 3300005546 | Bacteria | 3374 |
| 44 | Ga0070665_100550276 | 3300005548 | Unclassified | 1166 |
| 45 | Ga0070704_100038659 | 3300005549 | Bacteria | 3271 |
| 46 | Ga0070664_100027923 | 3300005564 | Bacteria | 4693 |
| 47 | Ga0068854_100019269 | 3300005578 | Bacteria | 4595 |
| 48 | Ga0070702_100043705 | 3300005615 | Bacteria | 2526 |
| 49 | Ga0068864_100170291 | 3300005618 | Bacteria | 1985 |
| 50 | Ga0068870_10042390 | 3300005840 | Bacteria | 2369 |
| 51 | Ga0068858_100310578 | 3300005842 | Bacteria | 1505 |
| 52 | Ga0081455_10021275 | 3300005937 | Bacteria | 6087 |
| 53 | Ga0070717_10000568 | 3300006028 | Bacteria | 23584 |
| 54 | Ga0070717_10099300 | 3300006028 | Bacteria | 2470 |
| 55 | Ga0070712_100032742 | 3300006175 | Bacteria | 3512 |
| 56 | Ga0070712_100065523 | 3300006175 | Bacteria | 2579 |
| 57 | Ga0097621_100004863 | 3300006237 | Bacteria | 9415 |
| 58 | Ga0097621_100027058 | 3300006237 | Bacteria | 4506 |
| 59 | Ga0097621_100214019 | 3300006237 | Unclassified | 1677 |
| 60 | Ga0097621_100308965 | 3300006237 | Unclassified | 1398 |
| 61 | Ga0068871_100076966 | 3300006358 | Bacteria | 2756 |
| 62 | Ga0075428_100000857 | 3300006844 | Bacteria | 31999 |
| 63 | Ga0075430_100188592 | 3300006846 | Bacteria | 1714 |
| 64 | Ga0075431_100004461 | 3300006847 | Bacteria | 13732 |
| 65 | Ga0075434_100115104 | 3300006871 | Bacteria | 2702 |
| 66 | Ga0075434_100145431 | 3300006871 | Bacteria | 2391 |
| 67 | Ga0075429_100001601 | 3300006880 | Bacteria | 18663 |
| 68 | Ga0075429_100104219 | 3300006880 | Bacteria | 2477 |
| 69 | Ga0075429_100159394 | 3300006880 | Bacteria | 1976 |
| 70 | Ga0111539_10009712 | 3300009094 | Bacteria | 12144 |
| 71 | Ga0111539_10016463 | 3300009094 | Bacteria | 9168 |
| 72 | Ga0111539_10032398 | 3300009094 | Bacteria | 6346 |
| 73 | Ga0111539_10046963 | 3300009094 | Bacteria | 5162 |
| 74 | Ga0105245_10297625 | 3300009098 | Bacteria | 1582 |
| 75 | Ga0114129_10377033 | 3300009147 | Bacteria | 1874 |
| 76 | Ga0114129_10679880 | 3300009147 | Bacteria | 1325 |
| 77 | Ga0105242_10082274 | 3300009176 | Bacteria | 2694 |
| 78 | Ga0105248_10355495 | 3300009177 | Unclassified | 1649 |
| 79 | Ga0105249_10110670 | 3300009553 | Bacteria | 2596 |
| 80 | Ga0105246_10095664 | 3300011119 | Bacteria | 2151 |
| 81 | Ga0157374_10088275 | 3300013296 | Bacteria | 2953 |
| 82 | Ga0157378_10118488 | 3300013297 | Bacteria | 2437 |
| 83 | Ga0157375_10267202 | 3300013308 | Bacteria | 1872 |
| 84 | Ga0157375_10408057 | 3300013308 | Bacteria | 1525 |
| 85 | Ga0157379_10116054 | 3300014968 | Bacteria | 2407 |
| 86 | Ga0157376_10045191 | 3300014969 | Bacteria | 3624 |
| 87 | Ga0157376_10121777 | 3300014969 | Bacteria | 2313 |
| 88 | Ga0163161_10054270 | 3300017792 | Bacteria | 2908 |
| 89 | Ga0163161_10191247 | 3300017792 | Bacteria | 1573 |
| 90 | Ga0213873_10023608 | 3300021358 | Unclassified | 1468 |
| 91 | Ga0213876_10068363 | 3300021384 | Bacteria | 1877 |
| 92 | Ga0213876_10113107 | 3300021384 | Bacteria | 1441 |
| 93 | Ga0213875_10086490 | 3300021388 | Bacteria | 1462 |
| 94 | Ga0207697_10023817 | 3300025315 | Bacteria | 2507 |
| 95 | Ga0207697_10042903 | 3300025315 | Bacteria | 1859 |
| 96 | Ga0207682_10000519 | 3300025893 | Bacteria | 17710 |
| 97 | Ga0207688_10055622 | 3300025901 | Unclassified | 2221 |
| 98 | Ga0207688_10084716 | 3300025901 | Bacteria | 1815 |
| 99 | Ga0207680_10058155 | 3300025903 | Bacteria | 2342 |
| 100 | Ga0207645_10005927 | 3300025907 | Bacteria | 8805 |
| 101 | Ga0207645_10056066 | 3300025907 | Bacteria | 2516 |
| 102 | Ga0207643_10047372 | 3300025908 | Bacteria | 2432 |
| 103 | Ga0207643_10162338 | 3300025908 | Bacteria | 1345 |
| 104 | Ga0207684_10016219 | 3300025910 | Bacteria | 6400 |
| 105 | Ga0207707_10049533 | 3300025912 | Bacteria | 3660 |
| 106 | Ga0207707_10100144 | 3300025912 | Bacteria | 2533 |
| 107 | Ga0207693_10094327 | 3300025915 | Bacteria | 2345 |
| 108 | Ga0207693_10106743 | 3300025915 | Bacteria | 2197 |
| 109 | Ga0207663_10009646 | 3300025916 | Bacteria | 5108 |
| 110 | Ga0207663_10290284 | 3300025916 | Bacteria | 1218 |
| 111 | Ga0207660_10085405 | 3300025917 | Bacteria | 2328 |
| 112 | Ga0207662_10015700 | 3300025918 | Bacteria | 4264 |
| 113 | Ga0207662_10017298 | 3300025918 | Bacteria | 4077 |
| 114 | Ga0207657_10075940 | 3300025919 | Bacteria | 2836 |
| 115 | Ga0207646_10047127 | 3300025922 | Bacteria | 3866 |
| 116 | Ga0207650_10006514 | 3300025925 | Bacteria | 7961 |
| 117 | Ga0207650_10063277 | 3300025925 | Unclassified | 2766 |
| 118 | Ga0207659_10051636 | 3300025926 | Bacteria | 2925 |
| 119 | Ga0207659_10373371 | 3300025926 | Unclassified | 1188 |
| 120 | Ga0207700_10126453 | 3300025928 | Unclassified | 2080 |
| 121 | Ga0207664_10137387 | 3300025929 | Unclassified | 2064 |
| 122 | Ga0207644_10020518 | 3300025931 | Bacteria | 4493 |
| 123 | Ga0207644_10165099 | 3300025931 | Bacteria | 1724 |
| 124 | Ga0207706_10014132 | 3300025933 | Bacteria | 7238 |
| 125 | Ga0207706_10109124 | 3300025933 | Bacteria | 2435 |
| 126 | Ga0207686_10062933 | 3300025934 | Bacteria | 2358 |
| 127 | Ga0207691_10003725 | 3300025940 | Bacteria | 14795 |
| 128 | Ga0207711_10117837 | 3300025941 | Bacteria | 2368 |
| 129 | Ga0207661_10042613 | 3300025944 | Bacteria | 3579 |
| 130 | Ga0207651_10127796 | 3300025960 | Bacteria | 1940 |
| 131 | Ga0207677_10002838 | 3300026023 | Bacteria | 9133 |
| 132 | Ga0207708_10010096 | 3300026075 | Bacteria | 7009 |
| 133 | Ga0207708_10020135 | 3300026075 | Bacteria | 5031 |
| 134 | Ga0207702_10164069 | 3300026078 | Bacteria | 2031 |
| 135 | Ga0207648_10017184 | 3300026089 | Bacteria | 6591 |
| 136 | Ga0207648_10024090 | 3300026089 | Bacteria | 5439 |
| 137 | Ga0207648_10024124 | 3300026089 | Bacteria | 5434 |
| 138 | Ga0207676_10166592 | 3300026095 | Bacteria | 1915 |
| 139 | Ga0207675_100038244 | 3300026118 | Bacteria | 4477 |
| 140 | Ga0207683_10005652 | 3300026121 | Bacteria | 10722 |
| 141 | Ga0207683_10011940 | 3300026121 | Bacteria | 7414 |
| 142 | Ga0207698_10093660 | 3300026142 | Bacteria | 2467 |
| 143 | Ga0207428_10003881 | 3300027907 | Bacteria | 14333 |
| 144 | Ga0268265_10151380 | 3300028380 | Unclassified | 1957 |
| 145 | Ga0268264_10212582 | 3300028381 | Bacteria | 1776 |
| 146 | Ga0265318_10002477 | 3300028577 | Bacteria | 9859 |
| 147 | Ga0265338_10017696 | 3300028800 | Bacteria | 7664 |
| 148 | Ga0265338_10115685 | 3300028800 | Bacteria | 2150 |
| 149 | Ga0265330_10012334 | 3300031235 | Bacteria | 3999 |
| 150 | Ga0265332_10001467 | 3300031238 | Bacteria | 13174 |
| 151 | Ga0265332_10001552 | 3300031238 | Bacteria | 12630 |
| 152 | Ga0265328_10011491 | 3300031239 | Bacteria | 3536 |
| 153 | Ga0265329_10008629 | 3300031242 | Bacteria | 3850 |
| 154 | Ga0265331_10002735 | 3300031250 | Bacteria | 11739 |
| 155 | Ga0265331_10014871 | 3300031250 | Bacteria | 4128 |
| 156 | Ga0265316_10027438 | 3300031344 | Bacteria | 4715 |
| 157 | Ga0265313_10068657 | 3300031595 | Unclassified | 1637 |
| 158 | Ga0265314_10000220 | 3300031711 | Bacteria | 84921 |
| 159 | Ga0265314_10012115 | 3300031711 | Bacteria | 7063 |
| 160 | Ga0307413_10024226 | 3300031824 | Bacteria | 3306 |
| 161 | Ga0307410_10342627 | 3300031852 | Unclassified | 1192 |
| 162 | Ga0307407_10144067 | 3300031903 | Bacteria | 1541 |
| 163 | Ga0307409_100348680 | 3300031995 | Bacteria | 1396 |
| 164 | Ga0307416_100031526 | 3300032002 | Bacteria | 3992 |
| 165 | Ga0307415_100072510 | 3300032126 | Unclassified | 2426 |
| 166 | Ga0373938_0023183 | 3300034957 | Unclassified | 1274 |
| 167 | Ga0373934_0010734 | 3300035086 | Unclassified | 3440 |
| 168 | Ga0373923_0047849 | 3300035111 | Unclassified | 1784 |
| 169 | Ga0373923_0052818 | 3300035111 | Unclassified | 1708 |
| 170 | Ga0373939_0039189 | 3300035114 | Unclassified | 1417 |
| 171 | Ga0373953_0021336 | 3300035117 | Bacteria | 2429 |
| 172 | Ga0373957_0037517 | 3300035120 | Bacteria | 1811 |
| 173 | Ga0373960_0030157 | 3300035121 | Unclassified | 1509 |
| 174 | Ga0373943_0022256 | 3300035170 | Bacteria | 2935 |
| 175 | Ga0373943_0116936 | 3300035170 | Unclassified | 1413 |
| 176 | Ga0373931_0058713 | 3300035691 | Bacteria | 2067 |
| 177 | Ga0373935_0065099 | 3300035692 | Unclassified | 2338 |
| 178 | Ga0373935_0188106 | 3300035692 | Bacteria | 1421 |
| 179 | Ga0373927_0060689 | 3300035695 | Bacteria | 2447 |
| 180 | Ga0373927_0080352 | 3300035695 | Bacteria | 2113 |
| 181 | Ga0373927_0088144 | 3300035695 | Bacteria | 2014 |
| 182 | Ga0373927_0124422 | 3300035695 | Bacteria | 1683 |
| 183 | Ga0373933_0060618 | 3300035724 | Unclassified | 2281 |
| 184 | Ga0373933_0061504 | 3300035724 | Bacteria | 2266 |
| 185 | Ga0373937_0007631 | 3300036401 | Bacteria | 9373 |
| 186 | Ga0373937_0011042 | 3300036401 | Bacteria | 7918 |
| 187 | Ga0373937_0011599 | 3300036401 | Bacteria | 7739 |
| 188 | Ga0373937_0062219 | 3300036401 | Bacteria | 3431 |
| 189 | Ga0373937_0071822 | 3300036401 | Bacteria | 3192 |
| 190 | Ga0373925_0028491 | 3300037068 | Bacteria | 4093 |
| 191 | Ga0373925_0053397 | 3300037068 | Unclassified | 3021 |
| 192 | Ga0373925_0102429 | 3300037068 | Bacteria | 2202 |
| 193 | Ga0436364_0834454 | 3300037853 | Unclassified | 1027 |
| 194 | Ga0436364_1033644 | 3300037853 | Bacteria | 4694 |
| 195 | Ga0436365_0794783 | 3300039437 | Bacteria | 1891 |
| 196 | Ga0436365_1147068 | 3300039437 | Bacteria | 1431 |
| 197 | Ga0436365_1397164 | 3300039437 | Bacteria | 5679 |
| 198 | Ga0436360_0350253 | 3300039438 | Bacteria | 4829 |
| 199 | Ga0436360_0785082 | 3300039438 | Bacteria | 1805 |
| 200 | Ga0436361_0716251 | 3300039447 | Bacteria | 4927 |
| 201 | Ga0436361_1223713 | 3300039447 | Bacteria | 1927 |
| 202 | Ga0436363_1057229 | 3300039450 | Bacteria | 2143 |
| 203 | Ga0436363_1698965 | 3300039450 | Unclassified | 3051 |
| 204 | Ga0436362_0092518 | 3300039453 | Bacteria | 2209 |
| 205 | Ga0436362_0130671 | 3300039453 | Bacteria | 2917 |
| 206 | Ga0451853_1411246 | 3300041512 | Bacteria | 1810 |
| 207 | Ga0450920_009670 | 3300042122 | Bacteria | 1777 |
| 208 | Ga0450918_009157 | 3300042531 | Bacteria | 1739 |
| 209 | Ga0466963_0163978 | 3300044694 | Bacteria | 1548 |
| 210 | Ga0495592_0020730 | 3300046454 | Bacteria | 5000 |
| 211 | Ga0495603_0049107 | 3300046455 | Bacteria | 2512 |
| 212 | Ga0495591_002794 | 3300046458 | Bacteria | 9400 |
| 213 | Ga0495629_0003133 | 3300046459 | Bacteria | 12533 |
| 214 | Ga0495629_0019447 | 3300046459 | Unclassified | 4851 |
| 215 | Ga0495629_0063205 | 3300046459 | Unclassified | 2585 |
| 216 | Ga0495651_0006074 | 3300046462 | Bacteria | 9224 |
| 217 | Ga0495653_0064552 | 3300046463 | Bacteria | 2758 |
| 218 | Ga0495580_0002294 | 3300046472 | Bacteria | 16699 |
| 219 | Ga0495582_0105466 | 3300046473 | Unclassified | 1580 |
| 220 | Ga0495662_0010299 | 3300046476 | Bacteria | 4583 |
| 221 | Ga0495662_0043077 | 3300046476 | Bacteria | 2179 |
| 222 | Ga0495594_0080365 | 3300046499 | Unclassified | 1820 |
| 223 | Ga0495596_0013347 | 3300046500 | Bacteria | 3487 |
| 224 | Ga0495608_0040336 | 3300046511 | Bacteria | 3128 |
| 225 | Ga0495608_0042099 | 3300046511 | Bacteria | 3054 |
| 226 | Ga0495618_0010744 | 3300046514 | Bacteria | 5542 |
| 227 | Ga0495628_0180160 | 3300046516 | Bacteria | 1598 |
| 228 | Ga0495630_0161566 | 3300046517 | Bacteria | 1705 |
| 229 | Ga0495648_0094922 | 3300046524 | Bacteria | 1660 |
| 230 | Ga0495666_0058950 | 3300046526 | Unclassified | 1836 |
| 231 | Ga0495642_0052160 | 3300046528 | Bacteria | 1684 |
| 232 | Ga0495652_0038329 | 3300046529 | Bacteria | 4153 |
| 233 | Ga0495652_0045242 | 3300046529 | Bacteria | 3786 |
| 234 | Ga0495652_0091588 | 3300046529 | Bacteria | 2485 |
| 235 | Ga0495665_0004423 | 3300046531 | Bacteria | 7589 |
| 236 | Ga0495640_0002950 | 3300046533 | Bacteria | 13700 |
| 237 | Ga0495640_0011330 | 3300046533 | Bacteria | 6865 |
| 238 | Ga0495640_0022197 | 3300046533 | Bacteria | 4644 |
| 239 | Ga0495586_0048793 | 3300046535 | Bacteria | 2289 |
| 240 | Ga0495587_0071315 | 3300046536 | Bacteria | 2021 |
| 241 | Ga0495587_0089279 | 3300046536 | Bacteria | 1781 |
| 242 | Ga0495598_0017973 | 3300046537 | Bacteria | 1831 |
| 243 | Ga0495598_0057063 | 3300046537 | Unclassified | 1194 |
| 244 | Ga0495622_0000147 | 3300046557 | Bacteria | 60460 |
| 245 | Ga0495633_0055644 | 3300046558 | Bacteria | 1860 |
| 246 | Ga0495667_0007523 | 3300046559 | Bacteria | 7390 |
| 247 | Ga0495667_0085598 | 3300046559 | Bacteria | 2046 |
| 248 | Ga0495634_0024812 | 3300046642 | Bacteria | 4202 |
| 249 | Ga0495634_0095750 | 3300046642 | Unclassified | 1923 |
| 250 | Ga0495634_0112068 | 3300046642 | Unclassified | 1754 |
| 251 | Ga0495659_0025306 | 3300046664 | Unclassified | 2031 |
| 252 | Ga0495661_0005088 | 3300046665 | Bacteria | 9379 |
| 253 | Ga0495623_0028374 | 3300046679 | Bacteria | 3600 |
| 254 | Ga0495646_0045983 | 3300046680 | Bacteria | 2663 |
| 255 | Ga0495647_0008569 | 3300046681 | Bacteria | 3440 |
| 256 | Ga0495658_0155674 | 3300046683 | Bacteria | 1406 |
| 257 | Ga0495658_0156594 | 3300046683 | Unclassified | 1402 |
| 258 | Ga0495613_0014563 | 3300046689 | Bacteria | 5833 |
| 259 | Ga0495613_0099895 | 3300046689 | Bacteria | 2096 |
| 260 | Ga0495624_0011365 | 3300046690 | Bacteria | 6119 |
| 261 | Ga0495624_0031688 | 3300046690 | Bacteria | 3434 |
| 262 | Ga0495589_0000876 | 3300046794 | Bacteria | 18703 |
| 263 | Ga0495600_0016171 | 3300046809 | Bacteria | 4731 |
| 264 | Ga0495600_0044459 | 3300046809 | Bacteria | 2898 |
| 265 | Ga0495581_0041984 | 3300047315 | Bacteria | 2648 |
| 266 | Ga0495581_0114247 | 3300047315 | Unclassified | 1570 |
| 267 | Ga0495604_0007948 | 3300047317 | Bacteria | 8403 |
| 268 | Ga0495604_0164695 | 3300047317 | Bacteria | 1564 |
| 269 | Ga0495674_0014327 | 3300047319 | Bacteria | 7426 |
| 270 | Ga0495674_0048721 | 3300047319 | Bacteria | 3748 |
| 271 | Ga0495676_0064093 | 3300047321 | Bacteria | 2861 |
| 272 | Ga0495680_0092189 | 3300047322 | Bacteria | 2270 |
| 273 | Ga0495675_0004093 | 3300047444 | Bacteria | 8835 |
| 274 | Ga0495679_001250 | 3300047446 | Bacteria | 15047 |
| 275 | Ga0495684_0295688 | 3300047471 | Bacteria | 1164 |
| 276 | Ga0495593_0000886 | 3300047673 | Bacteria | 17382 |
| 277 | Ga0495593_0030632 | 3300047673 | Unclassified | 2943 |
| 278 | Ga0495602_0036711 | 3300048088 | Bacteria | 4556 |
| 279 | Ga0495602_0122421 | 3300048088 | Bacteria | 2091 |
| 280 | Ga0496101_0037170 | 3300048904 | Bacteria | 3453 |
| 281 | Ga0496104_0224251 | 3300048907 | Bacteria | 1792 |
| 282 | Ga0496104_0263163 | 3300048907 | Bacteria | 1637 |
| 283 | Ga0496109_0096843 | 3300048912 | Bacteria | 2734 |
| 284 | Ga0496111_0122766 | 3300048914 | Bacteria | 1919 |
| 285 | Ga0496113_0337320 | 3300048916 | Unclassified | 1209 |
| 286 | Ga0496114_0080848 | 3300048917 | Unclassified | 2745 |
| 287 | Ga0496114_0324907 | 3300048917 | Unclassified | 1360 |
| 288 | Ga0501036_0065287 | 3300049572 | Unclassified | 3081 |
| 289 | Ga0501037_0047525 | 3300049573 | Unclassified | 3145 |
| 290 | Ga0501038_0042209 | 3300049574 | Unclassified | 3973 |
| 291 | Ga0501039_0015904 | 3300049575 | Bacteria | 5760 |
| 292 | Ga0501040_0145016 | 3300049576 | Unclassified | 1673 |
| 293 | Ga0501041_0002055 | 3300049577 | Bacteria | 11331 |
| 294 | Ga0501043_0027642 | 3300049579 | Bacteria | 4453 |
| 295 | Ga0501046_0134697 | 3300049580 | Unclassified | 1872 |
| 296 | Ga0501048_0030506 | 3300049582 | Bacteria | 3901 |
| 297 | Ga0501071_0137775 | 3300049587 | Unclassified | 1816 |
| 298 | Ga0501075_0003739 | 3300049591 | Bacteria | 10226 |
| 299 | Ga0501079_0000868 | 3300049741 | Bacteria | 20728 |
| 300 | Ga0501080_0053477 | 3300049742 | Bacteria | 3760 |
| 301 | nmdc:mga05p37_364301_c1 | 3300050507 | Bacteria | 1698 |
| 302 | nmdc:mga05p37_420903_c1 | 3300050507 | Bacteria | 1554 |
| 303 | nmdc:mga09592_1504_c1 | 3300050508 | Bacteria | 18770 |
| 304 | nmdc:mga09592_378241_c1 | 3300050508 | Bacteria | 1224 |
| 305 | nmdc:mga0qj67_143938_c1 | 3300050509 | Bacteria | 1933 |
| 306 | nmdc:mga08y16_170162_c1 | 3300050511 | Bacteria | 2263 |
| 307 | nmdc:mga0n895_112658_c1 | 3300050512 | Bacteria | 2737 |
| 308 | nmdc:mga0n895_84876_c1 | 3300050512 | Bacteria | 3160 |
| 309 | nmdc:mga0a205_262416_c1 | 3300050515 | Bacteria | 1605 |
| 310 | Ga0495601_0008273 | 3300053077 | Bacteria | 6140 |
| 311 | Ga0495601_0021941 | 3300053077 | Bacteria | 3916 |
| 312 | Ga0495601_0191634 | 3300053077 | Unclassified | 1336 |
| 313 | Ga0495595_0005079 | 3300053084 | Bacteria | 5317 |
| 314 | Ga0495595_0027107 | 3300053084 | Bacteria | 2550 |
| 315 | Ga0495595_0153335 | 3300053084 | Bacteria | 1134 |
| 316 | Ga0495619_0009052 | 3300053085 | Bacteria | 6282 |
| 317 | Ga0495619_0047037 | 3300053085 | Bacteria | 2839 |
| 318 | Ga0501084_0238918 | 3300054114 | Unclassified | 1533 |
| 319 | Ga0501082_0047469 | 3300060353 | Unclassified | 3700 |
| 320 | Ga0530510_0185029 | 3300061734 | Unclassified | 1545 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047471 | Ga0495684_0295688 | Ga0495684_0295688_35_916 | 293 |
| 2 | 3300046680 | Ga0495646_0045983 | Ga0495646_0045983_36_950 | 296 |
| 3 | 3300039437 | Ga0436365_0794783 | Ga0436365_0794783_182_1210 | 315 |
| 4 | 3300021384 | Ga0213876_10068363 | Ga0213876_100683632 | 319 |
| 5 | 3300053077 | Ga0495601_0191634 | Ga0495601_0191634_345_1313 | 322 |
| 6 | 3300009147 | Ga0114129_10679880 | Ga0114129_106798802 | 328 |
| 7 | 3300050507 | nmdc:mga05p37_420903_c1 | nmdc:mga05p37_420903_c1_493_1539 | 328 |
| 8 | 3300006871 | Ga0075434_100145431 | Ga0075434_1001454312 | 329 |
| 9 | iso_pu_bacteria | 2842324504 | 2842333170 | 329 |
| 10 | 3300009094 | Ga0111539_10032398 | Ga0111539_100323982 | 330 |
| 11 | 3300037853 | Ga0436364_0834454 | Ga0436364_0834454_10_1002 | 330 |
| 12 | 3300050512 | nmdc:mga0n895_112658_c1 | nmdc:mga0n895_112658_c1_637_1689 | 330 |
| 13 | 3300050515 | nmdc:mga0a205_262416_c1 | nmdc:mga0a205_262416_c1_189_1241 | 330 |
| 14 | 3300009147 | Ga0114129_10377033 | Ga0114129_103770332 | 333 |
| 15 | 3300034957 | Ga0373938_0023183 | Ga0373938_0023183_249_1250 | 333 |
| 16 | 3300046516 | Ga0495628_0180160 | Ga0495628_0180160_548_1573 | 333 |
| 17 | 3300050507 | nmdc:mga05p37_364301_c1 | nmdc:mga05p37_364301_c1_467_1495 | 333 |
| 18 | 3300009553 | Ga0105249_10110670 | Ga0105249_101106702 | 335 |
| 19 | 3300049572 | Ga0501036_0065287 | Ga0501036_0065287_1697_2731 | 335 |
| 20 | 3300049573 | Ga0501037_0047525 | Ga0501037_0047525_1492_2526 | 335 |
| 21 | 3300049574 | Ga0501038_0042209 | Ga0501038_0042209_217_1251 | 335 |
| 22 | 3300049575 | Ga0501039_0015904 | Ga0501039_0015904_3940_4974 | 335 |
| 23 | 3300049576 | Ga0501040_0145016 | Ga0501040_0145016_524_1558 | 335 |
| 24 | 3300049577 | Ga0501041_0002055 | Ga0501041_0002055_2061_3095 | 335 |
| 25 | 3300049579 | Ga0501043_0027642 | Ga0501043_0027642_1295_2329 | 335 |
| 26 | 3300049582 | Ga0501048_0030506 | Ga0501048_0030506_2687_3721 | 335 |
| 27 | 3300049587 | Ga0501071_0137775 | Ga0501071_0137775_127_1161 | 335 |
| 28 | 3300049591 | Ga0501075_0003739 | Ga0501075_0003739_6823_7857 | 335 |
| 29 | 3300049741 | Ga0501079_0000868 | Ga0501079_0000868_14629_15663 | 335 |
| 30 | 3300049742 | Ga0501080_0053477 | Ga0501080_0053477_2279_3313 | 335 |
| 31 | 3300054114 | Ga0501084_0238918 | Ga0501084_0238918_366_1400 | 335 |
| 32 | 3300060353 | Ga0501082_0047469 | Ga0501082_0047469_2592_3626 | 335 |
| 33 | 3300061734 | Ga0530510_0185029 | Ga0530510_0185029_324_1358 | 335 |
| 34 | 3300005546 | Ga0070696_100013297 | Ga0070696_1000132972 | 336 |
| 35 | 3300005468 | Ga0070707_100095861 | Ga0070707_1000958613 | 337 |
| 36 | 3300005471 | Ga0070698_100103157 | Ga0070698_1001031572 | 337 |
| 37 | 3300005518 | Ga0070699_100071701 | Ga0070699_1000717013 | 337 |
| 38 | 3300025910 | Ga0207684_10016219 | Ga0207684_100162198 | 337 |
| 39 | 3300025922 | Ga0207646_10047127 | Ga0207646_100471272 | 337 |
| 40 | 3300006880 | Ga0075429_100159394 | Ga0075429_1001593942 | 338 |
| 41 | 3300021358 | Ga0213873_10023608 | Ga0213873_100236082 | 339 |
| 42 | 3300039453 | Ga0436362_0092518 | Ga0436362_0092518_872_1909 | 339 |
| 43 | 3300048904 | Ga0496101_0037170 | Ga0496101_0037170_431_1468 | 339 |
| 44 | 3300005458 | Ga0070681_10065532 | Ga0070681_100655324 | 340 |
| 45 | 3300025912 | Ga0207707_10100144 | Ga0207707_101001443 | 340 |
| 46 | 3300031824 | Ga0307413_10024226 | Ga0307413_100242262 | 340 |
| 47 | 3300031903 | Ga0307407_10144067 | Ga0307407_101440671 | 340 |
| 48 | 3300031995 | Ga0307409_100348680 | Ga0307409_1003486801 | 340 |
| 49 | 3300032002 | Ga0307416_100031526 | Ga0307416_1000315262 | 340 |
| 50 | 3300032126 | Ga0307415_100072510 | Ga0307415_1000725101 | 340 |
| 51 | 3300039438 | Ga0436360_0785082 | Ga0436360_0785082_490_1515 | 340 |
| 52 | 3300039453 | Ga0436362_0130671 | Ga0436362_0130671_1218_2243 | 340 |
| 53 | 3300050508 | nmdc:mga09592_1504_c1 | nmdc:mga09592_1504_c1_15653_16678 | 340 |
| 54 | 3300005546 | Ga0070696_100036838 | Ga0070696_1000368383 | 341 |
| 55 | 3300035170 | Ga0373943_0022256 | Ga0373943_0022256_418_1446 | 341 |
| 56 | 3300035695 | Ga0373927_0080352 | Ga0373927_0080352_484_1512 | 341 |
| 57 | 3300037068 | Ga0373925_0102429 | Ga0373925_0102429_364_1392 | 341 |
| 58 | 3300046459 | Ga0495629_0063205 | Ga0495629_0063205_1067_2095 | 341 |
| 59 | 3300046476 | Ga0495662_0043077 | Ga0495662_0043077_1067_2095 | 341 |
| 60 | 3300046533 | Ga0495640_0022197 | Ga0495640_0022197_565_1593 | 341 |
| 61 | 3300046642 | Ga0495634_0095750 | Ga0495634_0095750_460_1488 | 341 |
| 62 | 3300047319 | Ga0495674_0048721 | Ga0495674_0048721_1554_2582 | 341 |
| 63 | 3300050509 | nmdc:mga0qj67_143938_c1 | nmdc:mga0qj67_143938_c1_550_1575 | 341 |
| 64 | 3300013308 | Ga0157375_10408057 | Ga0157375_104080572 | 342 |
| 65 | 3300021384 | Ga0213876_10113107 | Ga0213876_101131072 | 342 |
| 66 | 3300031238 | Ga0265332_10001552 | Ga0265332_100015522 | 342 |
| 67 | 3300031239 | Ga0265328_10011491 | Ga0265328_100114912 | 342 |
| 68 | 3300031250 | Ga0265331_10014871 | Ga0265331_100148713 | 342 |
| 69 | 3300031344 | Ga0265316_10027438 | Ga0265316_100274385 | 342 |
| 70 | 3300031595 | Ga0265313_10068657 | Ga0265313_100686572 | 342 |
| 71 | 3300031711 | Ga0265314_10012115 | Ga0265314_100121155 | 342 |
| 72 | 3300039437 | Ga0436365_1147068 | Ga0436365_1147068_386_1414 | 342 |
| 73 | 3300046511 | Ga0495608_0042099 | Ga0495608_0042099_986_2014 | 342 |
| 74 | 3300046529 | Ga0495652_0091588 | Ga0495652_0091588_582_1610 | 342 |
| 75 | 3300046559 | Ga0495667_0085598 | Ga0495667_0085598_264_1292 | 342 |
| 76 | 3300047317 | Ga0495604_0164695 | Ga0495604_0164695_242_1270 | 342 |
| 77 | 3300047673 | Ga0495593_0030632 | Ga0495593_0030632_1560_2588 | 342 |
| 78 | 3300048088 | Ga0495602_0122421 | Ga0495602_0122421_916_1944 | 342 |
| 79 | 3300005328 | Ga0070676_10154995 | Ga0070676_101549951 | 343 |
| 80 | 3300005335 | Ga0070666_10050559 | Ga0070666_100505592 | 343 |
| 81 | 3300005338 | Ga0068868_100226612 | Ga0068868_1002266122 | 343 |
| 82 | 3300005354 | Ga0070675_100089068 | Ga0070675_1000890682 | 343 |
| 83 | 3300005356 | Ga0070674_100074601 | Ga0070674_1000746012 | 343 |
| 84 | 3300005365 | Ga0070688_100238477 | Ga0070688_1002384772 | 343 |
| 85 | 3300005435 | Ga0070714_100456287 | Ga0070714_1004562871 | 343 |
| 86 | 3300005438 | Ga0070701_10112583 | Ga0070701_101125832 | 343 |
| 87 | 3300005441 | Ga0070700_100026323 | Ga0070700_1000263233 | 343 |
| 88 | 3300005456 | Ga0070678_100053566 | Ga0070678_1000535662 | 343 |
| 89 | 3300005543 | Ga0070672_100027560 | Ga0070672_1000275603 | 343 |
| 90 | 3300005544 | Ga0070686_100040253 | Ga0070686_1000402532 | 343 |
| 91 | 3300005615 | Ga0070702_100043705 | Ga0070702_1000437052 | 343 |
| 92 | 3300005618 | Ga0068864_100170291 | Ga0068864_1001702912 | 343 |
| 93 | 3300006028 | Ga0070717_10099300 | Ga0070717_100993002 | 343 |
| 94 | 3300006237 | Ga0097621_100027058 | Ga0097621_1000270582 | 343 |
| 95 | 3300009094 | Ga0111539_10046963 | Ga0111539_100469632 | 343 |
| 96 | 3300009098 | Ga0105245_10297625 | Ga0105245_102976252 | 343 |
| 97 | 3300009176 | Ga0105242_10082274 | Ga0105242_100822742 | 343 |
| 98 | 3300011119 | Ga0105246_10095664 | Ga0105246_100956642 | 343 |
| 99 | 3300013308 | Ga0157375_10267202 | Ga0157375_102672022 | 343 |
| 100 | 3300014968 | Ga0157379_10116054 | Ga0157379_101160542 | 343 |
| 101 | 3300014969 | Ga0157376_10121777 | Ga0157376_101217771 | 343 |
| 102 | 3300017792 | Ga0163161_10191247 | Ga0163161_101912472 | 343 |
| 103 | 3300025901 | Ga0207688_10055622 | Ga0207688_100556222 | 343 |
| 104 | 3300025907 | Ga0207645_10056066 | Ga0207645_100560662 | 343 |
| 105 | 3300025908 | Ga0207643_10162338 | Ga0207643_101623382 | 343 |
| 106 | 3300025918 | Ga0207662_10015700 | Ga0207662_100157002 | 343 |
| 107 | 3300025925 | Ga0207650_10063277 | Ga0207650_100632773 | 343 |
| 108 | 3300025926 | Ga0207659_10373371 | Ga0207659_103733711 | 343 |
| 109 | 3300025929 | Ga0207664_10137387 | Ga0207664_101373872 | 343 |
| 110 | 3300025931 | Ga0207644_10165099 | Ga0207644_101650992 | 343 |
| 111 | 3300025933 | Ga0207706_10014132 | Ga0207706_100141324 | 343 |
| 112 | 3300025941 | Ga0207711_10117837 | Ga0207711_101178372 | 343 |
| 113 | 3300025960 | Ga0207651_10127796 | Ga0207651_101277962 | 343 |
| 114 | 3300026075 | Ga0207708_10010096 | Ga0207708_100100964 | 343 |
| 115 | 3300026089 | Ga0207648_10024124 | Ga0207648_100241242 | 343 |
| 116 | 3300026095 | Ga0207676_10166592 | Ga0207676_101665922 | 343 |
| 117 | 3300026121 | Ga0207683_10011940 | Ga0207683_100119402 | 343 |
| 118 | 3300028380 | Ga0268265_10151380 | Ga0268265_101513802 | 343 |
| 119 | 3300031852 | Ga0307410_10342627 | Ga0307410_103426271 | 343 |
| 120 | 3300035086 | Ga0373934_0010734 | Ga0373934_0010734_1816_2850 | 343 |
| 121 | 3300035111 | Ga0373923_0047849 | Ga0373923_0047849_67_1101 | 343 |
| 122 | 3300035117 | Ga0373953_0021336 | Ga0373953_0021336_34_1068 | 343 |
| 123 | 3300035724 | Ga0373933_0060618 | Ga0373933_0060618_870_1904 | 343 |
| 124 | 3300036401 | Ga0373937_0011599 | Ga0373937_0011599_3502_4536 | 343 |
| 125 | 3300037853 | Ga0436364_1033644 | Ga0436364_1033644_2130_3164 | 343 |
| 126 | 3300039437 | Ga0436365_1397164 | Ga0436365_1397164_327_1358 | 343 |
| 127 | 3300039450 | Ga0436363_1057229 | Ga0436363_1057229_923_1957 | 343 |
| 128 | 3300046528 | Ga0495642_0052160 | Ga0495642_0052160_524_1576 | 343 |
| 129 | 3300046537 | Ga0495598_0017973 | Ga0495598_0017973_284_1336 | 343 |
| 130 | 3300046537 | Ga0495598_0057063 | Ga0495598_0057063_72_1109 | 343 |
| 131 | 3300046558 | Ga0495633_0055644 | Ga0495633_0055644_739_1791 | 343 |
| 132 | 3300046683 | Ga0495658_0155674 | Ga0495658_0155674_24_1061 | 343 |
| 133 | 3300050508 | nmdc:mga09592_378241_c1 | nmdc:mga09592_378241_c1_39_1073 | 343 |
| 134 | 3300053077 | Ga0495601_0008273 | Ga0495601_0008273_3483_4517 | 343 |
| 135 | 3300053084 | Ga0495595_0153335 | Ga0495595_0153335_22_1056 | 343 |
| 136 | 3300053085 | Ga0495619_0009052 | Ga0495619_0009052_1305_2339 | 343 |
| 137 | 3300005436 | Ga0070713_100142454 | Ga0070713_1001424542 | 344 |
| 138 | 3300005439 | Ga0070711_100062177 | Ga0070711_1000621773 | 344 |
| 139 | 3300005471 | Ga0070698_100001462 | Ga0070698_1000014629 | 344 |
| 140 | 3300006028 | Ga0070717_10000568 | Ga0070717_1000056815 | 344 |
| 141 | 3300006175 | Ga0070712_100032742 | Ga0070712_1000327422 | 344 |
| 142 | 3300006175 | Ga0070712_100065523 | Ga0070712_1000655233 | 344 |
| 143 | 3300021388 | Ga0213875_10086490 | Ga0213875_100864902 | 344 |
| 144 | 3300025915 | Ga0207693_10094327 | Ga0207693_100943273 | 344 |
| 145 | 3300025915 | Ga0207693_10106743 | Ga0207693_101067432 | 344 |
| 146 | 3300025916 | Ga0207663_10009646 | Ga0207663_100096465 | 344 |
| 147 | 3300025916 | Ga0207663_10290284 | Ga0207663_102902841 | 344 |
| 148 | 3300025928 | Ga0207700_10126453 | Ga0207700_101264533 | 344 |
| 149 | 3300035111 | Ga0373923_0052818 | Ga0373923_0052818_488_1525 | 344 |
| 150 | 3300035692 | Ga0373935_0065099 | Ga0373935_0065099_1041_2078 | 344 |
| 151 | 3300035724 | Ga0373933_0061504 | Ga0373933_0061504_206_1243 | 344 |
| 152 | 3300036401 | Ga0373937_0062219 | Ga0373937_0062219_381_1478 | 344 |
| 153 | 3300036401 | Ga0373937_0071822 | Ga0373937_0071822_806_1843 | 344 |
| 154 | 3300037068 | Ga0373925_0053397 | Ga0373925_0053397_356_1393 | 344 |
| 155 | 3300039438 | Ga0436360_0350253 | Ga0436360_0350253_2096_3184 | 344 |
| 156 | 3300039447 | Ga0436361_0716251 | Ga0436361_0716251_1071_2159 | 344 |
| 157 | 3300039447 | Ga0436361_1223713 | Ga0436361_1223713_251_1288 | 344 |
| 158 | 3300039450 | Ga0436363_1698965 | Ga0436363_1698965_1869_2906 | 344 |
| 159 | 3300046459 | Ga0495629_0019447 | Ga0495629_0019447_3636_4673 | 344 |
| 160 | 3300046473 | Ga0495582_0105466 | Ga0495582_0105466_327_1364 | 344 |
| 161 | 3300046499 | Ga0495594_0080365 | Ga0495594_0080365_423_1460 | 344 |
| 162 | 3300046526 | Ga0495666_0058950 | Ga0495666_0058950_538_1575 | 344 |
| 163 | 3300046529 | Ga0495652_0038329 | Ga0495652_0038329_1054_2091 | 344 |
| 164 | 3300046533 | Ga0495640_0011330 | Ga0495640_0011330_5340_6377 | 344 |
| 165 | 3300046536 | Ga0495587_0071315 | Ga0495587_0071315_837_1874 | 344 |
| 166 | 3300046681 | Ga0495647_0008569 | Ga0495647_0008569_1211_2248 | 344 |
| 167 | 3300046690 | Ga0495624_0031688 | Ga0495624_0031688_1002_2039 | 344 |
| 168 | 3300046809 | Ga0495600_0044459 | Ga0495600_0044459_500_1537 | 344 |
| 169 | 3300047315 | Ga0495581_0114247 | Ga0495581_0114247_230_1267 | 344 |
| 170 | 3300047319 | Ga0495674_0014327 | Ga0495674_0014327_5248_6285 | 344 |
| 171 | 3300047322 | Ga0495680_0092189 | Ga0495680_0092189_965_2002 | 344 |
| 172 | 3300053077 | Ga0495601_0021941 | Ga0495601_0021941_1513_2550 | 344 |
| 173 | 3300053084 | Ga0495595_0027107 | Ga0495595_0027107_934_1971 | 344 |
| 174 | 3300053085 | Ga0495619_0047037 | Ga0495619_0047037_16_1113 | 344 |
| 175 | 3300005336 | Ga0070680_100077985 | Ga0070680_1000779852 | 345 |
| 176 | 3300005337 | Ga0070682_100059975 | Ga0070682_1000599752 | 345 |
| 177 | 3300005441 | Ga0070700_100047281 | Ga0070700_1000472812 | 345 |
| 178 | 3300005549 | Ga0070704_100038659 | Ga0070704_1000386592 | 345 |
| 179 | 3300005937 | Ga0081455_10021275 | Ga0081455_100212755 | 345 |
| 180 | 3300006237 | Ga0097621_100214019 | Ga0097621_1002140192 | 345 |
| 181 | 3300006844 | Ga0075428_100000857 | Ga0075428_1000008573 | 345 |
| 182 | 3300006846 | Ga0075430_100188592 | Ga0075430_1001885922 | 345 |
| 183 | 3300006847 | Ga0075431_100004461 | Ga0075431_1000044612 | 345 |
| 184 | 3300006880 | Ga0075429_100001601 | Ga0075429_1000016016 | 345 |
| 185 | 3300006880 | Ga0075429_100104219 | Ga0075429_1001042192 | 345 |
| 186 | 3300009094 | Ga0111539_10009712 | Ga0111539_1000971210 | 345 |
| 187 | 3300009094 | Ga0111539_10016463 | Ga0111539_1001646310 | 345 |
| 188 | 3300013297 | Ga0157378_10118488 | Ga0157378_101184882 | 345 |
| 189 | 3300014969 | Ga0157376_10045191 | Ga0157376_100451913 | 345 |
| 190 | 3300027907 | Ga0207428_10003881 | Ga0207428_1000388111 | 345 |
| 191 | 3300028381 | Ga0268264_10212582 | Ga0268264_102125821 | 345 |
| 192 | 3300028800 | Ga0265338_10115685 | Ga0265338_101156852 | 345 |
| 193 | 3300035114 | Ga0373939_0039189 | Ga0373939_0039189_44_1081 | 345 |
| 194 | 3300035121 | Ga0373960_0030157 | Ga0373960_0030157_145_1182 | 345 |
| 195 | 3300035170 | Ga0373943_0116936 | Ga0373943_0116936_322_1359 | 345 |
| 196 | 3300035691 | Ga0373931_0058713 | Ga0373931_0058713_219_1256 | 345 |
| 197 | 3300035695 | Ga0373927_0060689 | Ga0373927_0060689_66_1103 | 345 |
| 198 | 3300035695 | Ga0373927_0088144 | Ga0373927_0088144_938_1975 | 345 |
| 199 | 3300035695 | Ga0373927_0124422 | Ga0373927_0124422_310_1353 | 345 |
| 200 | 3300036401 | Ga0373937_0007631 | Ga0373937_0007631_1077_2114 | 345 |
| 201 | 3300042122 | Ga0450920_009670 | Ga0450920_009670_510_1547 | 345 |
| 202 | 3300042531 | Ga0450918_009157 | Ga0450918_009157_210_1247 | 345 |
| 203 | 3300044694 | Ga0466963_0163978 | Ga0466963_0163978_351_1400 | 345 |
| 204 | 3300046683 | Ga0495658_0156594 | Ga0495658_0156594_198_1235 | 345 |
| 205 | 3300048907 | Ga0496104_0263163 | Ga0496104_0263163_574_1611 | 345 |
| 206 | 3300048916 | Ga0496113_0337320 | Ga0496113_0337320_41_1078 | 345 |
| 207 | 3300048917 | Ga0496114_0324907 | Ga0496114_0324907_199_1236 | 345 |
| 208 | 3300050511 | nmdc:mga08y16_170162_c1 | nmdc:mga08y16_170162_c1_594_1631 | 345 |
| 209 | 3300006237 | Ga0097621_100308965 | Ga0097621_1003089652 | 346 |
| 210 | 3300026078 | Ga0207702_10164069 | Ga0207702_101640692 | 346 |
| 211 | 3300028800 | Ga0265338_10017696 | Ga0265338_100176967 | 346 |
| 212 | 3300035692 | Ga0373935_0188106 | Ga0373935_0188106_350_1390 | 346 |
| 213 | 3300037068 | Ga0373925_0028491 | Ga0373925_0028491_1761_2801 | 346 |
| 214 | 3300046454 | Ga0495592_0020730 | Ga0495592_0020730_3786_4850 | 346 |
| 215 | 3300046455 | Ga0495603_0049107 | Ga0495603_0049107_1126_2190 | 346 |
| 216 | 3300046458 | Ga0495591_002794 | Ga0495591_002794_6277_7341 | 346 |
| 217 | 3300046459 | Ga0495629_0003133 | Ga0495629_0003133_2517_3581 | 346 |
| 218 | 3300046462 | Ga0495651_0006074 | Ga0495651_0006074_2100_3164 | 346 |
| 219 | 3300046463 | Ga0495653_0064552 | Ga0495653_0064552_183_1247 | 346 |
| 220 | 3300046472 | Ga0495580_0002294 | Ga0495580_0002294_6644_7708 | 346 |
| 221 | 3300046476 | Ga0495662_0010299 | Ga0495662_0010299_3109_4203 | 346 |
| 222 | 3300046500 | Ga0495596_0013347 | Ga0495596_0013347_675_1739 | 346 |
| 223 | 3300046511 | Ga0495608_0040336 | Ga0495608_0040336_1994_3058 | 346 |
| 224 | 3300046514 | Ga0495618_0010744 | Ga0495618_0010744_3534_4598 | 346 |
| 225 | 3300046517 | Ga0495630_0161566 | Ga0495630_0161566_332_1396 | 346 |
| 226 | 3300046524 | Ga0495648_0094922 | Ga0495648_0094922_311_1375 | 346 |
| 227 | 3300046529 | Ga0495652_0045242 | Ga0495652_0045242_1337_2401 | 346 |
| 228 | 3300046531 | Ga0495665_0004423 | Ga0495665_0004423_5732_6796 | 346 |
| 229 | 3300046533 | Ga0495640_0002950 | Ga0495640_0002950_10668_11732 | 346 |
| 230 | 3300046536 | Ga0495587_0089279 | Ga0495587_0089279_535_1599 | 346 |
| 231 | 3300046557 | Ga0495622_0000147 | Ga0495622_0000147_12190_13254 | 346 |
| 232 | 3300046642 | Ga0495634_0024812 | Ga0495634_0024812_1802_2866 | 346 |
| 233 | 3300046642 | Ga0495634_0112068 | Ga0495634_0112068_635_1675 | 346 |
| 234 | 3300046664 | Ga0495659_0025306 | Ga0495659_0025306_466_1518 | 346 |
| 235 | 3300046665 | Ga0495661_0005088 | Ga0495661_0005088_4684_5748 | 346 |
| 236 | 3300046679 | Ga0495623_0028374 | Ga0495623_0028374_1249_2313 | 346 |
| 237 | 3300046689 | Ga0495613_0014563 | Ga0495613_0014563_1832_2896 | 346 |
| 238 | 3300046689 | Ga0495613_0099895 | Ga0495613_0099895_145_1185 | 346 |
| 239 | 3300046690 | Ga0495624_0011365 | Ga0495624_0011365_2078_3142 | 346 |
| 240 | 3300046794 | Ga0495589_0000876 | Ga0495589_0000876_16618_17682 | 346 |
| 241 | 3300046809 | Ga0495600_0016171 | Ga0495600_0016171_1713_2777 | 346 |
| 242 | 3300047315 | Ga0495581_0041984 | Ga0495581_0041984_583_1647 | 346 |
| 243 | 3300047317 | Ga0495604_0007948 | Ga0495604_0007948_5825_6889 | 346 |
| 244 | 3300047321 | Ga0495676_0064093 | Ga0495676_0064093_543_1607 | 346 |
| 245 | 3300047444 | Ga0495675_0004093 | Ga0495675_0004093_5948_7012 | 346 |
| 246 | 3300047446 | Ga0495679_001250 | Ga0495679_001250_4793_5857 | 346 |
| 247 | 3300047673 | Ga0495593_0000886 | Ga0495593_0000886_10989_12053 | 346 |
| 248 | 3300048088 | Ga0495602_0036711 | Ga0495602_0036711_676_1740 | 346 |
| 249 | 3300048907 | Ga0496104_0224251 | Ga0496104_0224251_212_1255 | 346 |
| 250 | 3300050512 | nmdc:mga0n895_84876_c1 | nmdc:mga0n895_84876_c1_383_1423 | 346 |
| 251 | 3300005327 | Ga0070658_10007666 | Ga0070658_100076665 | 347 |
| 252 | 3300005329 | Ga0070683_100017888 | Ga0070683_1000178885 | 347 |
| 253 | 3300005330 | Ga0070690_100067813 | Ga0070690_1000678132 | 347 |
| 254 | 3300005333 | Ga0070677_10063967 | Ga0070677_100639672 | 347 |
| 255 | 3300005338 | Ga0068868_100023165 | Ga0068868_1000231652 | 347 |
| 256 | 3300005343 | Ga0070687_100021981 | Ga0070687_1000219813 | 347 |
| 257 | 3300005354 | Ga0070675_100188231 | Ga0070675_1001882311 | 347 |
| 258 | 3300005355 | Ga0070671_100029630 | Ga0070671_1000296302 | 347 |
| 259 | 3300005356 | Ga0070674_100129606 | Ga0070674_1001296062 | 347 |
| 260 | 3300005364 | Ga0070673_100291783 | Ga0070673_1002917832 | 347 |
| 261 | 3300005445 | Ga0070708_100099686 | Ga0070708_1000996862 | 347 |
| 262 | 3300005456 | Ga0070678_100004539 | Ga0070678_1000045397 | 347 |
| 263 | 3300005457 | Ga0070662_100185824 | Ga0070662_1001858241 | 347 |
| 264 | 3300005458 | Ga0070681_10000920 | Ga0070681_1000092014 | 347 |
| 265 | 3300005459 | Ga0068867_100226421 | Ga0068867_1002264212 | 347 |
| 266 | 3300005467 | Ga0070706_100011693 | Ga0070706_1000116936 | 347 |
| 267 | 3300005468 | Ga0070707_100010363 | Ga0070707_1000103636 | 347 |
| 268 | 3300005543 | Ga0070672_100144067 | Ga0070672_1001440671 | 347 |
| 269 | 3300005543 | Ga0070672_100204612 | Ga0070672_1002046122 | 347 |
| 270 | 3300005548 | Ga0070665_100550276 | Ga0070665_1005502762 | 347 |
| 271 | 3300005564 | Ga0070664_100027923 | Ga0070664_1000279234 | 347 |
| 272 | 3300005578 | Ga0068854_100019269 | Ga0068854_1000192696 | 347 |
| 273 | 3300005840 | Ga0068870_10042390 | Ga0068870_100423901 | 347 |
| 274 | 3300005842 | Ga0068858_100310578 | Ga0068858_1003105782 | 347 |
| 275 | 3300006237 | Ga0097621_100004863 | Ga0097621_1000048634 | 347 |
| 276 | 3300006358 | Ga0068871_100076966 | Ga0068871_1000769663 | 347 |
| 277 | 3300006871 | Ga0075434_100115104 | Ga0075434_1001151042 | 347 |
| 278 | 3300009177 | Ga0105248_10355495 | Ga0105248_103554951 | 347 |
| 279 | 3300013296 | Ga0157374_10088275 | Ga0157374_100882753 | 347 |
| 280 | 3300017792 | Ga0163161_10054270 | Ga0163161_100542703 | 347 |
| 281 | 3300025315 | Ga0207697_10023817 | Ga0207697_100238172 | 347 |
| 282 | 3300025315 | Ga0207697_10042903 | Ga0207697_100429031 | 347 |
| 283 | 3300025893 | Ga0207682_10000519 | Ga0207682_100005197 | 347 |
| 284 | 3300025901 | Ga0207688_10084716 | Ga0207688_100847162 | 347 |
| 285 | 3300025903 | Ga0207680_10058155 | Ga0207680_100581552 | 347 |
| 286 | 3300025907 | Ga0207645_10005927 | Ga0207645_100059273 | 347 |
| 287 | 3300025908 | Ga0207643_10047372 | Ga0207643_100473722 | 347 |
| 288 | 3300025912 | Ga0207707_10049533 | Ga0207707_100495333 | 347 |
| 289 | 3300025917 | Ga0207660_10085405 | Ga0207660_100854052 | 347 |
| 290 | 3300025918 | Ga0207662_10017298 | Ga0207662_100172982 | 347 |
| 291 | 3300025919 | Ga0207657_10075940 | Ga0207657_100759401 | 347 |
| 292 | 3300025925 | Ga0207650_10006514 | Ga0207650_100065147 | 347 |
| 293 | 3300025926 | Ga0207659_10051636 | Ga0207659_100516363 | 347 |
| 294 | 3300025931 | Ga0207644_10020518 | Ga0207644_100205182 | 347 |
| 295 | 3300025933 | Ga0207706_10109124 | Ga0207706_101091241 | 347 |
| 296 | 3300025934 | Ga0207686_10062933 | Ga0207686_100629332 | 347 |
| 297 | 3300025940 | Ga0207691_10003725 | Ga0207691_100037256 | 347 |
| 298 | 3300025944 | Ga0207661_10042613 | Ga0207661_100426133 | 347 |
| 299 | 3300026023 | Ga0207677_10002838 | Ga0207677_100028381 | 347 |
| 300 | 3300026075 | Ga0207708_10020135 | Ga0207708_100201351 | 347 |
| 301 | 3300026089 | Ga0207648_10017184 | Ga0207648_100171846 | 347 |
| 302 | 3300026089 | Ga0207648_10024090 | Ga0207648_100240905 | 347 |
| 303 | 3300026118 | Ga0207675_100038244 | Ga0207675_1000382441 | 347 |
| 304 | 3300026121 | Ga0207683_10005652 | Ga0207683_100056522 | 347 |
| 305 | 3300026142 | Ga0207698_10093660 | Ga0207698_100936603 | 347 |
| 306 | 3300028577 | Ga0265318_10002477 | Ga0265318_100024778 | 347 |
| 307 | 3300031235 | Ga0265330_10012334 | Ga0265330_100123342 | 347 |
| 308 | 3300031238 | Ga0265332_10001467 | Ga0265332_100014676 | 347 |
| 309 | 3300031242 | Ga0265329_10008629 | Ga0265329_100086292 | 347 |
| 310 | 3300031250 | Ga0265331_10002735 | Ga0265331_1000273510 | 347 |
| 311 | 3300031711 | Ga0265314_10000220 | Ga0265314_1000022071 | 347 |
| 312 | 3300035120 | Ga0373957_0037517 | Ga0373957_0037517_232_1308 | 347 |
| 313 | 3300036401 | Ga0373937_0011042 | Ga0373937_0011042_5183_6259 | 347 |
| 314 | 3300041512 | Ga0451853_1411246 | Ga0451853_1411246_293_1336 | 347 |
| 315 | 3300046535 | Ga0495586_0048793 | Ga0495586_0048793_913_1989 | 347 |
| 316 | 3300046559 | Ga0495667_0007523 | Ga0495667_0007523_4493_5569 | 347 |
| 317 | 3300048912 | Ga0496109_0096843 | Ga0496109_0096843_669_1769 | 347 |
| 318 | 3300048914 | Ga0496111_0122766 | Ga0496111_0122766_728_1828 | 347 |
| 319 | 3300048917 | Ga0496114_0080848 | Ga0496114_0080848_1575_2621 | 347 |
| 320 | 3300049580 | Ga0501046_0134697 | Ga0501046_0134697_548_1594 | 347 |
| 321 | 3300053084 | Ga0495595_0005079 | Ga0495595_0005079_1216_2292 | 347 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8gqb-assembly1.cif.gz_A | crystal structure of lasso peptide epimerase mslh d11a mutant | 0.8295 | 2 | 345 |
| 8gq9-assembly1.cif.gz_A | crystal structure of lasso peptide epimerase mslh | 0.8259 | 2 | 345 |
| 8ith-assembly1.cif.gz_A | crystal structure of lasso peptide epimerase mslh h295n | 0.8257 | 2 | 345 |
| 8itg-assembly1.cif.gz_A | crystal structure of lasso peptide epimerase mslh in complexed with precursor peptide variant mslaw21g | 0.8237 | 2 | 345 |
| 8gqb-assembly1.cif.gz_A | crystal structure of lasso peptide epimerase mslh d11a mutant | 0.821 | 2 | 345 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WM79_84_289_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8329 | 41 | 263 | 3.60.21.10 |
| af_P9WM79_84_289_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8062 | 41 | 263 | 3.60.21.10 |
| af_P9WM79_290_380_3.10.28.10 | Alpha Beta;Roll;Endonuclease I-creI;Homing endonucleases | 0.7707 | 280 | 345 | 3.10.28.10 |
| af_Q2FWL2_132_323_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.7206 | 62 | 104 | 3.30.420.40 |
| af_P77215_158_345_3.30.390.10 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.6941 | 188 | 240 | 3.30.390.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E5LMY0-F1-model_v4 | Capsule synthesis protein CapA domain-containing protein | 0.9517 | 1 | 346 |
|
| AF-A0A2E5P8D7-F1-model_v4 | Poly-gamma-glutamate biosynthesis protein | 0.9516 | 1 | 345 |
|
| AF-A0A2E5LMY0-F1-model_v4 | Capsule synthesis protein CapA domain-containing protein | 0.949 | 1 | 346 |
|
| AF-A0A1F4B9Z2-F1-model_v4 | Capsule synthesis protein CapA domain-containing protein | 0.9358 | 1 | 346 |
|
| AF-A0A0Q9H849-F1-model_v4 | Capsule synthesis protein CapA domain-containing protein | 0.9352 | 1 | 347 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar