F405956

General Info

Members Datasets Scaffolds Average Seq Length
321 222 320 346

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10355495|Ga0105248_103554951
Length 366
Sequence VGANHRRYNRRSINYRPQAMPATMILTGDVNLMNVTDPDVPFKRVADEFRTTDVVFSNLECCLYHPPGGHSVDTEGFFADPLAGGDTLKRAGIHAVGIANNVNYGEAAIRSSIARLDELGIPHTGAGANRAAARAPVVLNRNGVRYGFLQRTSVYWPTNHEAAENAPGVAVIRGHTAYQLPLHKTRPEIPPANRPGLPPVIITWADAKYLQQYKEDVTALRSQCDILVASCHWGLHQDVLDYMPEIAHAAIDAGADIVIGHGPHYSLPVEAYKGKPIYYGLGSFSFHTGHGGRKHGDWVGMMARVRVDGKTIKHATFQFVRHNDANESVLCALTNEQATLEDITARSAKFGSKLKVEGDQVSIALS

Samples

Sample ID Description Type Environment
1 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
107 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
108 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
109 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
124 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
125 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
126 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
142 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.31
Rhizoplane 2.49
Rhizosphere 93.77
Stem 0
Stem Tuber 0
Unclassified 3.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10007666 3300005327 Bacteria 8700
2 Ga0070676_10154995 3300005328 Bacteria 1469
3 Ga0070683_100017888 3300005329 Bacteria 6266
4 Ga0070690_100067813 3300005330 Bacteria 2312
5 Ga0070677_10063967 3300005333 Bacteria 1526
6 Ga0070666_10050559 3300005335 Bacteria 2796
7 Ga0070680_100077985 3300005336 Bacteria 2729
8 Ga0070682_100059975 3300005337 Bacteria 2405
9 Ga0068868_100023165 3300005338 Bacteria 4697
10 Ga0068868_100226612 3300005338 Bacteria 1566
11 Ga0070687_100021981 3300005343 Bacteria 3008
12 Ga0070675_100089068 3300005354 Bacteria 2583
13 Ga0070675_100188231 3300005354 Bacteria 1787
14 Ga0070671_100029630 3300005355 Bacteria 4513
15 Ga0070674_100074601 3300005356 Bacteria 2407
16 Ga0070674_100129606 3300005356 Bacteria 1878
17 Ga0070673_100291783 3300005364 Bacteria 1433
18 Ga0070688_100238477 3300005365 Unclassified 1289
19 Ga0070714_100456287 3300005435 Bacteria 1214
20 Ga0070713_100142454 3300005436 Unclassified 2125
21 Ga0070701_10112583 3300005438 Unclassified 1523
22 Ga0070711_100062177 3300005439 Bacteria 2602
23 Ga0070700_100026323 3300005441 Bacteria 3434
24 Ga0070700_100047281 3300005441 Bacteria 2662
25 Ga0070708_100099686 3300005445 Bacteria 2658
26 Ga0070678_100004539 3300005456 Bacteria 7885
27 Ga0070678_100053566 3300005456 Bacteria 2934
28 Ga0070662_100185824 3300005457 Bacteria 1641
29 Ga0070681_10000920 3300005458 Bacteria 24878
30 Ga0070681_10065532 3300005458 Bacteria 3601
31 Ga0068867_100226421 3300005459 Bacteria 1509
32 Ga0070706_100011693 3300005467 Bacteria 8147
33 Ga0070707_100010363 3300005468 Bacteria 8680
34 Ga0070707_100095861 3300005468 Bacteria 2873
35 Ga0070698_100001462 3300005471 Bacteria 26223
36 Ga0070698_100103157 3300005471 Bacteria 2822
37 Ga0070699_100071701 3300005518 Bacteria 3013
38 Ga0070672_100027560 3300005543 Bacteria 4239
39 Ga0070672_100144067 3300005543 Bacteria 1968
40 Ga0070672_100204612 3300005543 Bacteria 1651
41 Ga0070686_100040253 3300005544 Bacteria 2915
42 Ga0070696_100013297 3300005546 Bacteria 5522
43 Ga0070696_100036838 3300005546 Bacteria 3374
44 Ga0070665_100550276 3300005548 Unclassified 1166
45 Ga0070704_100038659 3300005549 Bacteria 3271
46 Ga0070664_100027923 3300005564 Bacteria 4693
47 Ga0068854_100019269 3300005578 Bacteria 4595
48 Ga0070702_100043705 3300005615 Bacteria 2526
49 Ga0068864_100170291 3300005618 Bacteria 1985
50 Ga0068870_10042390 3300005840 Bacteria 2369
51 Ga0068858_100310578 3300005842 Bacteria 1505
52 Ga0081455_10021275 3300005937 Bacteria 6087
53 Ga0070717_10000568 3300006028 Bacteria 23584
54 Ga0070717_10099300 3300006028 Bacteria 2470
55 Ga0070712_100032742 3300006175 Bacteria 3512
56 Ga0070712_100065523 3300006175 Bacteria 2579
57 Ga0097621_100004863 3300006237 Bacteria 9415
58 Ga0097621_100027058 3300006237 Bacteria 4506
59 Ga0097621_100214019 3300006237 Unclassified 1677
60 Ga0097621_100308965 3300006237 Unclassified 1398
61 Ga0068871_100076966 3300006358 Bacteria 2756
62 Ga0075428_100000857 3300006844 Bacteria 31999
63 Ga0075430_100188592 3300006846 Bacteria 1714
64 Ga0075431_100004461 3300006847 Bacteria 13732
65 Ga0075434_100115104 3300006871 Bacteria 2702
66 Ga0075434_100145431 3300006871 Bacteria 2391
67 Ga0075429_100001601 3300006880 Bacteria 18663
68 Ga0075429_100104219 3300006880 Bacteria 2477
69 Ga0075429_100159394 3300006880 Bacteria 1976
70 Ga0111539_10009712 3300009094 Bacteria 12144
71 Ga0111539_10016463 3300009094 Bacteria 9168
72 Ga0111539_10032398 3300009094 Bacteria 6346
73 Ga0111539_10046963 3300009094 Bacteria 5162
74 Ga0105245_10297625 3300009098 Bacteria 1582
75 Ga0114129_10377033 3300009147 Bacteria 1874
76 Ga0114129_10679880 3300009147 Bacteria 1325
77 Ga0105242_10082274 3300009176 Bacteria 2694
78 Ga0105248_10355495 3300009177 Unclassified 1649
79 Ga0105249_10110670 3300009553 Bacteria 2596
80 Ga0105246_10095664 3300011119 Bacteria 2151
81 Ga0157374_10088275 3300013296 Bacteria 2953
82 Ga0157378_10118488 3300013297 Bacteria 2437
83 Ga0157375_10267202 3300013308 Bacteria 1872
84 Ga0157375_10408057 3300013308 Bacteria 1525
85 Ga0157379_10116054 3300014968 Bacteria 2407
86 Ga0157376_10045191 3300014969 Bacteria 3624
87 Ga0157376_10121777 3300014969 Bacteria 2313
88 Ga0163161_10054270 3300017792 Bacteria 2908
89 Ga0163161_10191247 3300017792 Bacteria 1573
90 Ga0213873_10023608 3300021358 Unclassified 1468
91 Ga0213876_10068363 3300021384 Bacteria 1877
92 Ga0213876_10113107 3300021384 Bacteria 1441
93 Ga0213875_10086490 3300021388 Bacteria 1462
94 Ga0207697_10023817 3300025315 Bacteria 2507
95 Ga0207697_10042903 3300025315 Bacteria 1859
96 Ga0207682_10000519 3300025893 Bacteria 17710
97 Ga0207688_10055622 3300025901 Unclassified 2221
98 Ga0207688_10084716 3300025901 Bacteria 1815
99 Ga0207680_10058155 3300025903 Bacteria 2342
100 Ga0207645_10005927 3300025907 Bacteria 8805
101 Ga0207645_10056066 3300025907 Bacteria 2516
102 Ga0207643_10047372 3300025908 Bacteria 2432
103 Ga0207643_10162338 3300025908 Bacteria 1345
104 Ga0207684_10016219 3300025910 Bacteria 6400
105 Ga0207707_10049533 3300025912 Bacteria 3660
106 Ga0207707_10100144 3300025912 Bacteria 2533
107 Ga0207693_10094327 3300025915 Bacteria 2345
108 Ga0207693_10106743 3300025915 Bacteria 2197
109 Ga0207663_10009646 3300025916 Bacteria 5108
110 Ga0207663_10290284 3300025916 Bacteria 1218
111 Ga0207660_10085405 3300025917 Bacteria 2328
112 Ga0207662_10015700 3300025918 Bacteria 4264
113 Ga0207662_10017298 3300025918 Bacteria 4077
114 Ga0207657_10075940 3300025919 Bacteria 2836
115 Ga0207646_10047127 3300025922 Bacteria 3866
116 Ga0207650_10006514 3300025925 Bacteria 7961
117 Ga0207650_10063277 3300025925 Unclassified 2766
118 Ga0207659_10051636 3300025926 Bacteria 2925
119 Ga0207659_10373371 3300025926 Unclassified 1188
120 Ga0207700_10126453 3300025928 Unclassified 2080
121 Ga0207664_10137387 3300025929 Unclassified 2064
122 Ga0207644_10020518 3300025931 Bacteria 4493
123 Ga0207644_10165099 3300025931 Bacteria 1724
124 Ga0207706_10014132 3300025933 Bacteria 7238
125 Ga0207706_10109124 3300025933 Bacteria 2435
126 Ga0207686_10062933 3300025934 Bacteria 2358
127 Ga0207691_10003725 3300025940 Bacteria 14795
128 Ga0207711_10117837 3300025941 Bacteria 2368
129 Ga0207661_10042613 3300025944 Bacteria 3579
130 Ga0207651_10127796 3300025960 Bacteria 1940
131 Ga0207677_10002838 3300026023 Bacteria 9133
132 Ga0207708_10010096 3300026075 Bacteria 7009
133 Ga0207708_10020135 3300026075 Bacteria 5031
134 Ga0207702_10164069 3300026078 Bacteria 2031
135 Ga0207648_10017184 3300026089 Bacteria 6591
136 Ga0207648_10024090 3300026089 Bacteria 5439
137 Ga0207648_10024124 3300026089 Bacteria 5434
138 Ga0207676_10166592 3300026095 Bacteria 1915
139 Ga0207675_100038244 3300026118 Bacteria 4477
140 Ga0207683_10005652 3300026121 Bacteria 10722
141 Ga0207683_10011940 3300026121 Bacteria 7414
142 Ga0207698_10093660 3300026142 Bacteria 2467
143 Ga0207428_10003881 3300027907 Bacteria 14333
144 Ga0268265_10151380 3300028380 Unclassified 1957
145 Ga0268264_10212582 3300028381 Bacteria 1776
146 Ga0265318_10002477 3300028577 Bacteria 9859
147 Ga0265338_10017696 3300028800 Bacteria 7664
148 Ga0265338_10115685 3300028800 Bacteria 2150
149 Ga0265330_10012334 3300031235 Bacteria 3999
150 Ga0265332_10001467 3300031238 Bacteria 13174
151 Ga0265332_10001552 3300031238 Bacteria 12630
152 Ga0265328_10011491 3300031239 Bacteria 3536
153 Ga0265329_10008629 3300031242 Bacteria 3850
154 Ga0265331_10002735 3300031250 Bacteria 11739
155 Ga0265331_10014871 3300031250 Bacteria 4128
156 Ga0265316_10027438 3300031344 Bacteria 4715
157 Ga0265313_10068657 3300031595 Unclassified 1637
158 Ga0265314_10000220 3300031711 Bacteria 84921
159 Ga0265314_10012115 3300031711 Bacteria 7063
160 Ga0307413_10024226 3300031824 Bacteria 3306
161 Ga0307410_10342627 3300031852 Unclassified 1192
162 Ga0307407_10144067 3300031903 Bacteria 1541
163 Ga0307409_100348680 3300031995 Bacteria 1396
164 Ga0307416_100031526 3300032002 Bacteria 3992
165 Ga0307415_100072510 3300032126 Unclassified 2426
166 Ga0373938_0023183 3300034957 Unclassified 1274
167 Ga0373934_0010734 3300035086 Unclassified 3440
168 Ga0373923_0047849 3300035111 Unclassified 1784
169 Ga0373923_0052818 3300035111 Unclassified 1708
170 Ga0373939_0039189 3300035114 Unclassified 1417
171 Ga0373953_0021336 3300035117 Bacteria 2429
172 Ga0373957_0037517 3300035120 Bacteria 1811
173 Ga0373960_0030157 3300035121 Unclassified 1509
174 Ga0373943_0022256 3300035170 Bacteria 2935
175 Ga0373943_0116936 3300035170 Unclassified 1413
176 Ga0373931_0058713 3300035691 Bacteria 2067
177 Ga0373935_0065099 3300035692 Unclassified 2338
178 Ga0373935_0188106 3300035692 Bacteria 1421
179 Ga0373927_0060689 3300035695 Bacteria 2447
180 Ga0373927_0080352 3300035695 Bacteria 2113
181 Ga0373927_0088144 3300035695 Bacteria 2014
182 Ga0373927_0124422 3300035695 Bacteria 1683
183 Ga0373933_0060618 3300035724 Unclassified 2281
184 Ga0373933_0061504 3300035724 Bacteria 2266
185 Ga0373937_0007631 3300036401 Bacteria 9373
186 Ga0373937_0011042 3300036401 Bacteria 7918
187 Ga0373937_0011599 3300036401 Bacteria 7739
188 Ga0373937_0062219 3300036401 Bacteria 3431
189 Ga0373937_0071822 3300036401 Bacteria 3192
190 Ga0373925_0028491 3300037068 Bacteria 4093
191 Ga0373925_0053397 3300037068 Unclassified 3021
192 Ga0373925_0102429 3300037068 Bacteria 2202
193 Ga0436364_0834454 3300037853 Unclassified 1027
194 Ga0436364_1033644 3300037853 Bacteria 4694
195 Ga0436365_0794783 3300039437 Bacteria 1891
196 Ga0436365_1147068 3300039437 Bacteria 1431
197 Ga0436365_1397164 3300039437 Bacteria 5679
198 Ga0436360_0350253 3300039438 Bacteria 4829
199 Ga0436360_0785082 3300039438 Bacteria 1805
200 Ga0436361_0716251 3300039447 Bacteria 4927
201 Ga0436361_1223713 3300039447 Bacteria 1927
202 Ga0436363_1057229 3300039450 Bacteria 2143
203 Ga0436363_1698965 3300039450 Unclassified 3051
204 Ga0436362_0092518 3300039453 Bacteria 2209
205 Ga0436362_0130671 3300039453 Bacteria 2917
206 Ga0451853_1411246 3300041512 Bacteria 1810
207 Ga0450920_009670 3300042122 Bacteria 1777
208 Ga0450918_009157 3300042531 Bacteria 1739
209 Ga0466963_0163978 3300044694 Bacteria 1548
210 Ga0495592_0020730 3300046454 Bacteria 5000
211 Ga0495603_0049107 3300046455 Bacteria 2512
212 Ga0495591_002794 3300046458 Bacteria 9400
213 Ga0495629_0003133 3300046459 Bacteria 12533
214 Ga0495629_0019447 3300046459 Unclassified 4851
215 Ga0495629_0063205 3300046459 Unclassified 2585
216 Ga0495651_0006074 3300046462 Bacteria 9224
217 Ga0495653_0064552 3300046463 Bacteria 2758
218 Ga0495580_0002294 3300046472 Bacteria 16699
219 Ga0495582_0105466 3300046473 Unclassified 1580
220 Ga0495662_0010299 3300046476 Bacteria 4583
221 Ga0495662_0043077 3300046476 Bacteria 2179
222 Ga0495594_0080365 3300046499 Unclassified 1820
223 Ga0495596_0013347 3300046500 Bacteria 3487
224 Ga0495608_0040336 3300046511 Bacteria 3128
225 Ga0495608_0042099 3300046511 Bacteria 3054
226 Ga0495618_0010744 3300046514 Bacteria 5542
227 Ga0495628_0180160 3300046516 Bacteria 1598
228 Ga0495630_0161566 3300046517 Bacteria 1705
229 Ga0495648_0094922 3300046524 Bacteria 1660
230 Ga0495666_0058950 3300046526 Unclassified 1836
231 Ga0495642_0052160 3300046528 Bacteria 1684
232 Ga0495652_0038329 3300046529 Bacteria 4153
233 Ga0495652_0045242 3300046529 Bacteria 3786
234 Ga0495652_0091588 3300046529 Bacteria 2485
235 Ga0495665_0004423 3300046531 Bacteria 7589
236 Ga0495640_0002950 3300046533 Bacteria 13700
237 Ga0495640_0011330 3300046533 Bacteria 6865
238 Ga0495640_0022197 3300046533 Bacteria 4644
239 Ga0495586_0048793 3300046535 Bacteria 2289
240 Ga0495587_0071315 3300046536 Bacteria 2021
241 Ga0495587_0089279 3300046536 Bacteria 1781
242 Ga0495598_0017973 3300046537 Bacteria 1831
243 Ga0495598_0057063 3300046537 Unclassified 1194
244 Ga0495622_0000147 3300046557 Bacteria 60460
245 Ga0495633_0055644 3300046558 Bacteria 1860
246 Ga0495667_0007523 3300046559 Bacteria 7390
247 Ga0495667_0085598 3300046559 Bacteria 2046
248 Ga0495634_0024812 3300046642 Bacteria 4202
249 Ga0495634_0095750 3300046642 Unclassified 1923
250 Ga0495634_0112068 3300046642 Unclassified 1754
251 Ga0495659_0025306 3300046664 Unclassified 2031
252 Ga0495661_0005088 3300046665 Bacteria 9379
253 Ga0495623_0028374 3300046679 Bacteria 3600
254 Ga0495646_0045983 3300046680 Bacteria 2663
255 Ga0495647_0008569 3300046681 Bacteria 3440
256 Ga0495658_0155674 3300046683 Bacteria 1406
257 Ga0495658_0156594 3300046683 Unclassified 1402
258 Ga0495613_0014563 3300046689 Bacteria 5833
259 Ga0495613_0099895 3300046689 Bacteria 2096
260 Ga0495624_0011365 3300046690 Bacteria 6119
261 Ga0495624_0031688 3300046690 Bacteria 3434
262 Ga0495589_0000876 3300046794 Bacteria 18703
263 Ga0495600_0016171 3300046809 Bacteria 4731
264 Ga0495600_0044459 3300046809 Bacteria 2898
265 Ga0495581_0041984 3300047315 Bacteria 2648
266 Ga0495581_0114247 3300047315 Unclassified 1570
267 Ga0495604_0007948 3300047317 Bacteria 8403
268 Ga0495604_0164695 3300047317 Bacteria 1564
269 Ga0495674_0014327 3300047319 Bacteria 7426
270 Ga0495674_0048721 3300047319 Bacteria 3748
271 Ga0495676_0064093 3300047321 Bacteria 2861
272 Ga0495680_0092189 3300047322 Bacteria 2270
273 Ga0495675_0004093 3300047444 Bacteria 8835
274 Ga0495679_001250 3300047446 Bacteria 15047
275 Ga0495684_0295688 3300047471 Bacteria 1164
276 Ga0495593_0000886 3300047673 Bacteria 17382
277 Ga0495593_0030632 3300047673 Unclassified 2943
278 Ga0495602_0036711 3300048088 Bacteria 4556
279 Ga0495602_0122421 3300048088 Bacteria 2091
280 Ga0496101_0037170 3300048904 Bacteria 3453
281 Ga0496104_0224251 3300048907 Bacteria 1792
282 Ga0496104_0263163 3300048907 Bacteria 1637
283 Ga0496109_0096843 3300048912 Bacteria 2734
284 Ga0496111_0122766 3300048914 Bacteria 1919
285 Ga0496113_0337320 3300048916 Unclassified 1209
286 Ga0496114_0080848 3300048917 Unclassified 2745
287 Ga0496114_0324907 3300048917 Unclassified 1360
288 Ga0501036_0065287 3300049572 Unclassified 3081
289 Ga0501037_0047525 3300049573 Unclassified 3145
290 Ga0501038_0042209 3300049574 Unclassified 3973
291 Ga0501039_0015904 3300049575 Bacteria 5760
292 Ga0501040_0145016 3300049576 Unclassified 1673
293 Ga0501041_0002055 3300049577 Bacteria 11331
294 Ga0501043_0027642 3300049579 Bacteria 4453
295 Ga0501046_0134697 3300049580 Unclassified 1872
296 Ga0501048_0030506 3300049582 Bacteria 3901
297 Ga0501071_0137775 3300049587 Unclassified 1816
298 Ga0501075_0003739 3300049591 Bacteria 10226
299 Ga0501079_0000868 3300049741 Bacteria 20728
300 Ga0501080_0053477 3300049742 Bacteria 3760
301 nmdc:mga05p37_364301_c1 3300050507 Bacteria 1698
302 nmdc:mga05p37_420903_c1 3300050507 Bacteria 1554
303 nmdc:mga09592_1504_c1 3300050508 Bacteria 18770
304 nmdc:mga09592_378241_c1 3300050508 Bacteria 1224
305 nmdc:mga0qj67_143938_c1 3300050509 Bacteria 1933
306 nmdc:mga08y16_170162_c1 3300050511 Bacteria 2263
307 nmdc:mga0n895_112658_c1 3300050512 Bacteria 2737
308 nmdc:mga0n895_84876_c1 3300050512 Bacteria 3160
309 nmdc:mga0a205_262416_c1 3300050515 Bacteria 1605
310 Ga0495601_0008273 3300053077 Bacteria 6140
311 Ga0495601_0021941 3300053077 Bacteria 3916
312 Ga0495601_0191634 3300053077 Unclassified 1336
313 Ga0495595_0005079 3300053084 Bacteria 5317
314 Ga0495595_0027107 3300053084 Bacteria 2550
315 Ga0495595_0153335 3300053084 Bacteria 1134
316 Ga0495619_0009052 3300053085 Bacteria 6282
317 Ga0495619_0047037 3300053085 Bacteria 2839
318 Ga0501084_0238918 3300054114 Unclassified 1533
319 Ga0501082_0047469 3300060353 Unclassified 3700
320 Ga0530510_0185029 3300061734 Unclassified 1545

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047471 Ga0495684_0295688 Ga0495684_0295688_35_916 293
2 3300046680 Ga0495646_0045983 Ga0495646_0045983_36_950 296
3 3300039437 Ga0436365_0794783 Ga0436365_0794783_182_1210 315
4 3300021384 Ga0213876_10068363 Ga0213876_100683632 319
5 3300053077 Ga0495601_0191634 Ga0495601_0191634_345_1313 322
6 3300009147 Ga0114129_10679880 Ga0114129_106798802 328
7 3300050507 nmdc:mga05p37_420903_c1 nmdc:mga05p37_420903_c1_493_1539 328
8 3300006871 Ga0075434_100145431 Ga0075434_1001454312 329
9 iso_pu_bacteria 2842324504 2842333170 329
10 3300009094 Ga0111539_10032398 Ga0111539_100323982 330
11 3300037853 Ga0436364_0834454 Ga0436364_0834454_10_1002 330
12 3300050512 nmdc:mga0n895_112658_c1 nmdc:mga0n895_112658_c1_637_1689 330
13 3300050515 nmdc:mga0a205_262416_c1 nmdc:mga0a205_262416_c1_189_1241 330
14 3300009147 Ga0114129_10377033 Ga0114129_103770332 333
15 3300034957 Ga0373938_0023183 Ga0373938_0023183_249_1250 333
16 3300046516 Ga0495628_0180160 Ga0495628_0180160_548_1573 333
17 3300050507 nmdc:mga05p37_364301_c1 nmdc:mga05p37_364301_c1_467_1495 333
18 3300009553 Ga0105249_10110670 Ga0105249_101106702 335
19 3300049572 Ga0501036_0065287 Ga0501036_0065287_1697_2731 335
20 3300049573 Ga0501037_0047525 Ga0501037_0047525_1492_2526 335
21 3300049574 Ga0501038_0042209 Ga0501038_0042209_217_1251 335
22 3300049575 Ga0501039_0015904 Ga0501039_0015904_3940_4974 335
23 3300049576 Ga0501040_0145016 Ga0501040_0145016_524_1558 335
24 3300049577 Ga0501041_0002055 Ga0501041_0002055_2061_3095 335
25 3300049579 Ga0501043_0027642 Ga0501043_0027642_1295_2329 335
26 3300049582 Ga0501048_0030506 Ga0501048_0030506_2687_3721 335
27 3300049587 Ga0501071_0137775 Ga0501071_0137775_127_1161 335
28 3300049591 Ga0501075_0003739 Ga0501075_0003739_6823_7857 335
29 3300049741 Ga0501079_0000868 Ga0501079_0000868_14629_15663 335
30 3300049742 Ga0501080_0053477 Ga0501080_0053477_2279_3313 335
31 3300054114 Ga0501084_0238918 Ga0501084_0238918_366_1400 335
32 3300060353 Ga0501082_0047469 Ga0501082_0047469_2592_3626 335
33 3300061734 Ga0530510_0185029 Ga0530510_0185029_324_1358 335
34 3300005546 Ga0070696_100013297 Ga0070696_1000132972 336
35 3300005468 Ga0070707_100095861 Ga0070707_1000958613 337
36 3300005471 Ga0070698_100103157 Ga0070698_1001031572 337
37 3300005518 Ga0070699_100071701 Ga0070699_1000717013 337
38 3300025910 Ga0207684_10016219 Ga0207684_100162198 337
39 3300025922 Ga0207646_10047127 Ga0207646_100471272 337
40 3300006880 Ga0075429_100159394 Ga0075429_1001593942 338
41 3300021358 Ga0213873_10023608 Ga0213873_100236082 339
42 3300039453 Ga0436362_0092518 Ga0436362_0092518_872_1909 339
43 3300048904 Ga0496101_0037170 Ga0496101_0037170_431_1468 339
44 3300005458 Ga0070681_10065532 Ga0070681_100655324 340
45 3300025912 Ga0207707_10100144 Ga0207707_101001443 340
46 3300031824 Ga0307413_10024226 Ga0307413_100242262 340
47 3300031903 Ga0307407_10144067 Ga0307407_101440671 340
48 3300031995 Ga0307409_100348680 Ga0307409_1003486801 340
49 3300032002 Ga0307416_100031526 Ga0307416_1000315262 340
50 3300032126 Ga0307415_100072510 Ga0307415_1000725101 340
51 3300039438 Ga0436360_0785082 Ga0436360_0785082_490_1515 340
52 3300039453 Ga0436362_0130671 Ga0436362_0130671_1218_2243 340
53 3300050508 nmdc:mga09592_1504_c1 nmdc:mga09592_1504_c1_15653_16678 340
54 3300005546 Ga0070696_100036838 Ga0070696_1000368383 341
55 3300035170 Ga0373943_0022256 Ga0373943_0022256_418_1446 341
56 3300035695 Ga0373927_0080352 Ga0373927_0080352_484_1512 341
57 3300037068 Ga0373925_0102429 Ga0373925_0102429_364_1392 341
58 3300046459 Ga0495629_0063205 Ga0495629_0063205_1067_2095 341
59 3300046476 Ga0495662_0043077 Ga0495662_0043077_1067_2095 341
60 3300046533 Ga0495640_0022197 Ga0495640_0022197_565_1593 341
61 3300046642 Ga0495634_0095750 Ga0495634_0095750_460_1488 341
62 3300047319 Ga0495674_0048721 Ga0495674_0048721_1554_2582 341
63 3300050509 nmdc:mga0qj67_143938_c1 nmdc:mga0qj67_143938_c1_550_1575 341
64 3300013308 Ga0157375_10408057 Ga0157375_104080572 342
65 3300021384 Ga0213876_10113107 Ga0213876_101131072 342
66 3300031238 Ga0265332_10001552 Ga0265332_100015522 342
67 3300031239 Ga0265328_10011491 Ga0265328_100114912 342
68 3300031250 Ga0265331_10014871 Ga0265331_100148713 342
69 3300031344 Ga0265316_10027438 Ga0265316_100274385 342
70 3300031595 Ga0265313_10068657 Ga0265313_100686572 342
71 3300031711 Ga0265314_10012115 Ga0265314_100121155 342
72 3300039437 Ga0436365_1147068 Ga0436365_1147068_386_1414 342
73 3300046511 Ga0495608_0042099 Ga0495608_0042099_986_2014 342
74 3300046529 Ga0495652_0091588 Ga0495652_0091588_582_1610 342
75 3300046559 Ga0495667_0085598 Ga0495667_0085598_264_1292 342
76 3300047317 Ga0495604_0164695 Ga0495604_0164695_242_1270 342
77 3300047673 Ga0495593_0030632 Ga0495593_0030632_1560_2588 342
78 3300048088 Ga0495602_0122421 Ga0495602_0122421_916_1944 342
79 3300005328 Ga0070676_10154995 Ga0070676_101549951 343
80 3300005335 Ga0070666_10050559 Ga0070666_100505592 343
81 3300005338 Ga0068868_100226612 Ga0068868_1002266122 343
82 3300005354 Ga0070675_100089068 Ga0070675_1000890682 343
83 3300005356 Ga0070674_100074601 Ga0070674_1000746012 343
84 3300005365 Ga0070688_100238477 Ga0070688_1002384772 343
85 3300005435 Ga0070714_100456287 Ga0070714_1004562871 343
86 3300005438 Ga0070701_10112583 Ga0070701_101125832 343
87 3300005441 Ga0070700_100026323 Ga0070700_1000263233 343
88 3300005456 Ga0070678_100053566 Ga0070678_1000535662 343
89 3300005543 Ga0070672_100027560 Ga0070672_1000275603 343
90 3300005544 Ga0070686_100040253 Ga0070686_1000402532 343
91 3300005615 Ga0070702_100043705 Ga0070702_1000437052 343
92 3300005618 Ga0068864_100170291 Ga0068864_1001702912 343
93 3300006028 Ga0070717_10099300 Ga0070717_100993002 343
94 3300006237 Ga0097621_100027058 Ga0097621_1000270582 343
95 3300009094 Ga0111539_10046963 Ga0111539_100469632 343
96 3300009098 Ga0105245_10297625 Ga0105245_102976252 343
97 3300009176 Ga0105242_10082274 Ga0105242_100822742 343
98 3300011119 Ga0105246_10095664 Ga0105246_100956642 343
99 3300013308 Ga0157375_10267202 Ga0157375_102672022 343
100 3300014968 Ga0157379_10116054 Ga0157379_101160542 343
101 3300014969 Ga0157376_10121777 Ga0157376_101217771 343
102 3300017792 Ga0163161_10191247 Ga0163161_101912472 343
103 3300025901 Ga0207688_10055622 Ga0207688_100556222 343
104 3300025907 Ga0207645_10056066 Ga0207645_100560662 343
105 3300025908 Ga0207643_10162338 Ga0207643_101623382 343
106 3300025918 Ga0207662_10015700 Ga0207662_100157002 343
107 3300025925 Ga0207650_10063277 Ga0207650_100632773 343
108 3300025926 Ga0207659_10373371 Ga0207659_103733711 343
109 3300025929 Ga0207664_10137387 Ga0207664_101373872 343
110 3300025931 Ga0207644_10165099 Ga0207644_101650992 343
111 3300025933 Ga0207706_10014132 Ga0207706_100141324 343
112 3300025941 Ga0207711_10117837 Ga0207711_101178372 343
113 3300025960 Ga0207651_10127796 Ga0207651_101277962 343
114 3300026075 Ga0207708_10010096 Ga0207708_100100964 343
115 3300026089 Ga0207648_10024124 Ga0207648_100241242 343
116 3300026095 Ga0207676_10166592 Ga0207676_101665922 343
117 3300026121 Ga0207683_10011940 Ga0207683_100119402 343
118 3300028380 Ga0268265_10151380 Ga0268265_101513802 343
119 3300031852 Ga0307410_10342627 Ga0307410_103426271 343
120 3300035086 Ga0373934_0010734 Ga0373934_0010734_1816_2850 343
121 3300035111 Ga0373923_0047849 Ga0373923_0047849_67_1101 343
122 3300035117 Ga0373953_0021336 Ga0373953_0021336_34_1068 343
123 3300035724 Ga0373933_0060618 Ga0373933_0060618_870_1904 343
124 3300036401 Ga0373937_0011599 Ga0373937_0011599_3502_4536 343
125 3300037853 Ga0436364_1033644 Ga0436364_1033644_2130_3164 343
126 3300039437 Ga0436365_1397164 Ga0436365_1397164_327_1358 343
127 3300039450 Ga0436363_1057229 Ga0436363_1057229_923_1957 343
128 3300046528 Ga0495642_0052160 Ga0495642_0052160_524_1576 343
129 3300046537 Ga0495598_0017973 Ga0495598_0017973_284_1336 343
130 3300046537 Ga0495598_0057063 Ga0495598_0057063_72_1109 343
131 3300046558 Ga0495633_0055644 Ga0495633_0055644_739_1791 343
132 3300046683 Ga0495658_0155674 Ga0495658_0155674_24_1061 343
133 3300050508 nmdc:mga09592_378241_c1 nmdc:mga09592_378241_c1_39_1073 343
134 3300053077 Ga0495601_0008273 Ga0495601_0008273_3483_4517 343
135 3300053084 Ga0495595_0153335 Ga0495595_0153335_22_1056 343
136 3300053085 Ga0495619_0009052 Ga0495619_0009052_1305_2339 343
137 3300005436 Ga0070713_100142454 Ga0070713_1001424542 344
138 3300005439 Ga0070711_100062177 Ga0070711_1000621773 344
139 3300005471 Ga0070698_100001462 Ga0070698_1000014629 344
140 3300006028 Ga0070717_10000568 Ga0070717_1000056815 344
141 3300006175 Ga0070712_100032742 Ga0070712_1000327422 344
142 3300006175 Ga0070712_100065523 Ga0070712_1000655233 344
143 3300021388 Ga0213875_10086490 Ga0213875_100864902 344
144 3300025915 Ga0207693_10094327 Ga0207693_100943273 344
145 3300025915 Ga0207693_10106743 Ga0207693_101067432 344
146 3300025916 Ga0207663_10009646 Ga0207663_100096465 344
147 3300025916 Ga0207663_10290284 Ga0207663_102902841 344
148 3300025928 Ga0207700_10126453 Ga0207700_101264533 344
149 3300035111 Ga0373923_0052818 Ga0373923_0052818_488_1525 344
150 3300035692 Ga0373935_0065099 Ga0373935_0065099_1041_2078 344
151 3300035724 Ga0373933_0061504 Ga0373933_0061504_206_1243 344
152 3300036401 Ga0373937_0062219 Ga0373937_0062219_381_1478 344
153 3300036401 Ga0373937_0071822 Ga0373937_0071822_806_1843 344
154 3300037068 Ga0373925_0053397 Ga0373925_0053397_356_1393 344
155 3300039438 Ga0436360_0350253 Ga0436360_0350253_2096_3184 344
156 3300039447 Ga0436361_0716251 Ga0436361_0716251_1071_2159 344
157 3300039447 Ga0436361_1223713 Ga0436361_1223713_251_1288 344
158 3300039450 Ga0436363_1698965 Ga0436363_1698965_1869_2906 344
159 3300046459 Ga0495629_0019447 Ga0495629_0019447_3636_4673 344
160 3300046473 Ga0495582_0105466 Ga0495582_0105466_327_1364 344
161 3300046499 Ga0495594_0080365 Ga0495594_0080365_423_1460 344
162 3300046526 Ga0495666_0058950 Ga0495666_0058950_538_1575 344
163 3300046529 Ga0495652_0038329 Ga0495652_0038329_1054_2091 344
164 3300046533 Ga0495640_0011330 Ga0495640_0011330_5340_6377 344
165 3300046536 Ga0495587_0071315 Ga0495587_0071315_837_1874 344
166 3300046681 Ga0495647_0008569 Ga0495647_0008569_1211_2248 344
167 3300046690 Ga0495624_0031688 Ga0495624_0031688_1002_2039 344
168 3300046809 Ga0495600_0044459 Ga0495600_0044459_500_1537 344
169 3300047315 Ga0495581_0114247 Ga0495581_0114247_230_1267 344
170 3300047319 Ga0495674_0014327 Ga0495674_0014327_5248_6285 344
171 3300047322 Ga0495680_0092189 Ga0495680_0092189_965_2002 344
172 3300053077 Ga0495601_0021941 Ga0495601_0021941_1513_2550 344
173 3300053084 Ga0495595_0027107 Ga0495595_0027107_934_1971 344
174 3300053085 Ga0495619_0047037 Ga0495619_0047037_16_1113 344
175 3300005336 Ga0070680_100077985 Ga0070680_1000779852 345
176 3300005337 Ga0070682_100059975 Ga0070682_1000599752 345
177 3300005441 Ga0070700_100047281 Ga0070700_1000472812 345
178 3300005549 Ga0070704_100038659 Ga0070704_1000386592 345
179 3300005937 Ga0081455_10021275 Ga0081455_100212755 345
180 3300006237 Ga0097621_100214019 Ga0097621_1002140192 345
181 3300006844 Ga0075428_100000857 Ga0075428_1000008573 345
182 3300006846 Ga0075430_100188592 Ga0075430_1001885922 345
183 3300006847 Ga0075431_100004461 Ga0075431_1000044612 345
184 3300006880 Ga0075429_100001601 Ga0075429_1000016016 345
185 3300006880 Ga0075429_100104219 Ga0075429_1001042192 345
186 3300009094 Ga0111539_10009712 Ga0111539_1000971210 345
187 3300009094 Ga0111539_10016463 Ga0111539_1001646310 345
188 3300013297 Ga0157378_10118488 Ga0157378_101184882 345
189 3300014969 Ga0157376_10045191 Ga0157376_100451913 345
190 3300027907 Ga0207428_10003881 Ga0207428_1000388111 345
191 3300028381 Ga0268264_10212582 Ga0268264_102125821 345
192 3300028800 Ga0265338_10115685 Ga0265338_101156852 345
193 3300035114 Ga0373939_0039189 Ga0373939_0039189_44_1081 345
194 3300035121 Ga0373960_0030157 Ga0373960_0030157_145_1182 345
195 3300035170 Ga0373943_0116936 Ga0373943_0116936_322_1359 345
196 3300035691 Ga0373931_0058713 Ga0373931_0058713_219_1256 345
197 3300035695 Ga0373927_0060689 Ga0373927_0060689_66_1103 345
198 3300035695 Ga0373927_0088144 Ga0373927_0088144_938_1975 345
199 3300035695 Ga0373927_0124422 Ga0373927_0124422_310_1353 345
200 3300036401 Ga0373937_0007631 Ga0373937_0007631_1077_2114 345
201 3300042122 Ga0450920_009670 Ga0450920_009670_510_1547 345
202 3300042531 Ga0450918_009157 Ga0450918_009157_210_1247 345
203 3300044694 Ga0466963_0163978 Ga0466963_0163978_351_1400 345
204 3300046683 Ga0495658_0156594 Ga0495658_0156594_198_1235 345
205 3300048907 Ga0496104_0263163 Ga0496104_0263163_574_1611 345
206 3300048916 Ga0496113_0337320 Ga0496113_0337320_41_1078 345
207 3300048917 Ga0496114_0324907 Ga0496114_0324907_199_1236 345
208 3300050511 nmdc:mga08y16_170162_c1 nmdc:mga08y16_170162_c1_594_1631 345
209 3300006237 Ga0097621_100308965 Ga0097621_1003089652 346
210 3300026078 Ga0207702_10164069 Ga0207702_101640692 346
211 3300028800 Ga0265338_10017696 Ga0265338_100176967 346
212 3300035692 Ga0373935_0188106 Ga0373935_0188106_350_1390 346
213 3300037068 Ga0373925_0028491 Ga0373925_0028491_1761_2801 346
214 3300046454 Ga0495592_0020730 Ga0495592_0020730_3786_4850 346
215 3300046455 Ga0495603_0049107 Ga0495603_0049107_1126_2190 346
216 3300046458 Ga0495591_002794 Ga0495591_002794_6277_7341 346
217 3300046459 Ga0495629_0003133 Ga0495629_0003133_2517_3581 346
218 3300046462 Ga0495651_0006074 Ga0495651_0006074_2100_3164 346
219 3300046463 Ga0495653_0064552 Ga0495653_0064552_183_1247 346
220 3300046472 Ga0495580_0002294 Ga0495580_0002294_6644_7708 346
221 3300046476 Ga0495662_0010299 Ga0495662_0010299_3109_4203 346
222 3300046500 Ga0495596_0013347 Ga0495596_0013347_675_1739 346
223 3300046511 Ga0495608_0040336 Ga0495608_0040336_1994_3058 346
224 3300046514 Ga0495618_0010744 Ga0495618_0010744_3534_4598 346
225 3300046517 Ga0495630_0161566 Ga0495630_0161566_332_1396 346
226 3300046524 Ga0495648_0094922 Ga0495648_0094922_311_1375 346
227 3300046529 Ga0495652_0045242 Ga0495652_0045242_1337_2401 346
228 3300046531 Ga0495665_0004423 Ga0495665_0004423_5732_6796 346
229 3300046533 Ga0495640_0002950 Ga0495640_0002950_10668_11732 346
230 3300046536 Ga0495587_0089279 Ga0495587_0089279_535_1599 346
231 3300046557 Ga0495622_0000147 Ga0495622_0000147_12190_13254 346
232 3300046642 Ga0495634_0024812 Ga0495634_0024812_1802_2866 346
233 3300046642 Ga0495634_0112068 Ga0495634_0112068_635_1675 346
234 3300046664 Ga0495659_0025306 Ga0495659_0025306_466_1518 346
235 3300046665 Ga0495661_0005088 Ga0495661_0005088_4684_5748 346
236 3300046679 Ga0495623_0028374 Ga0495623_0028374_1249_2313 346
237 3300046689 Ga0495613_0014563 Ga0495613_0014563_1832_2896 346
238 3300046689 Ga0495613_0099895 Ga0495613_0099895_145_1185 346
239 3300046690 Ga0495624_0011365 Ga0495624_0011365_2078_3142 346
240 3300046794 Ga0495589_0000876 Ga0495589_0000876_16618_17682 346
241 3300046809 Ga0495600_0016171 Ga0495600_0016171_1713_2777 346
242 3300047315 Ga0495581_0041984 Ga0495581_0041984_583_1647 346
243 3300047317 Ga0495604_0007948 Ga0495604_0007948_5825_6889 346
244 3300047321 Ga0495676_0064093 Ga0495676_0064093_543_1607 346
245 3300047444 Ga0495675_0004093 Ga0495675_0004093_5948_7012 346
246 3300047446 Ga0495679_001250 Ga0495679_001250_4793_5857 346
247 3300047673 Ga0495593_0000886 Ga0495593_0000886_10989_12053 346
248 3300048088 Ga0495602_0036711 Ga0495602_0036711_676_1740 346
249 3300048907 Ga0496104_0224251 Ga0496104_0224251_212_1255 346
250 3300050512 nmdc:mga0n895_84876_c1 nmdc:mga0n895_84876_c1_383_1423 346
251 3300005327 Ga0070658_10007666 Ga0070658_100076665 347
252 3300005329 Ga0070683_100017888 Ga0070683_1000178885 347
253 3300005330 Ga0070690_100067813 Ga0070690_1000678132 347
254 3300005333 Ga0070677_10063967 Ga0070677_100639672 347
255 3300005338 Ga0068868_100023165 Ga0068868_1000231652 347
256 3300005343 Ga0070687_100021981 Ga0070687_1000219813 347
257 3300005354 Ga0070675_100188231 Ga0070675_1001882311 347
258 3300005355 Ga0070671_100029630 Ga0070671_1000296302 347
259 3300005356 Ga0070674_100129606 Ga0070674_1001296062 347
260 3300005364 Ga0070673_100291783 Ga0070673_1002917832 347
261 3300005445 Ga0070708_100099686 Ga0070708_1000996862 347
262 3300005456 Ga0070678_100004539 Ga0070678_1000045397 347
263 3300005457 Ga0070662_100185824 Ga0070662_1001858241 347
264 3300005458 Ga0070681_10000920 Ga0070681_1000092014 347
265 3300005459 Ga0068867_100226421 Ga0068867_1002264212 347
266 3300005467 Ga0070706_100011693 Ga0070706_1000116936 347
267 3300005468 Ga0070707_100010363 Ga0070707_1000103636 347
268 3300005543 Ga0070672_100144067 Ga0070672_1001440671 347
269 3300005543 Ga0070672_100204612 Ga0070672_1002046122 347
270 3300005548 Ga0070665_100550276 Ga0070665_1005502762 347
271 3300005564 Ga0070664_100027923 Ga0070664_1000279234 347
272 3300005578 Ga0068854_100019269 Ga0068854_1000192696 347
273 3300005840 Ga0068870_10042390 Ga0068870_100423901 347
274 3300005842 Ga0068858_100310578 Ga0068858_1003105782 347
275 3300006237 Ga0097621_100004863 Ga0097621_1000048634 347
276 3300006358 Ga0068871_100076966 Ga0068871_1000769663 347
277 3300006871 Ga0075434_100115104 Ga0075434_1001151042 347
278 3300009177 Ga0105248_10355495 Ga0105248_103554951 347
279 3300013296 Ga0157374_10088275 Ga0157374_100882753 347
280 3300017792 Ga0163161_10054270 Ga0163161_100542703 347
281 3300025315 Ga0207697_10023817 Ga0207697_100238172 347
282 3300025315 Ga0207697_10042903 Ga0207697_100429031 347
283 3300025893 Ga0207682_10000519 Ga0207682_100005197 347
284 3300025901 Ga0207688_10084716 Ga0207688_100847162 347
285 3300025903 Ga0207680_10058155 Ga0207680_100581552 347
286 3300025907 Ga0207645_10005927 Ga0207645_100059273 347
287 3300025908 Ga0207643_10047372 Ga0207643_100473722 347
288 3300025912 Ga0207707_10049533 Ga0207707_100495333 347
289 3300025917 Ga0207660_10085405 Ga0207660_100854052 347
290 3300025918 Ga0207662_10017298 Ga0207662_100172982 347
291 3300025919 Ga0207657_10075940 Ga0207657_100759401 347
292 3300025925 Ga0207650_10006514 Ga0207650_100065147 347
293 3300025926 Ga0207659_10051636 Ga0207659_100516363 347
294 3300025931 Ga0207644_10020518 Ga0207644_100205182 347
295 3300025933 Ga0207706_10109124 Ga0207706_101091241 347
296 3300025934 Ga0207686_10062933 Ga0207686_100629332 347
297 3300025940 Ga0207691_10003725 Ga0207691_100037256 347
298 3300025944 Ga0207661_10042613 Ga0207661_100426133 347
299 3300026023 Ga0207677_10002838 Ga0207677_100028381 347
300 3300026075 Ga0207708_10020135 Ga0207708_100201351 347
301 3300026089 Ga0207648_10017184 Ga0207648_100171846 347
302 3300026089 Ga0207648_10024090 Ga0207648_100240905 347
303 3300026118 Ga0207675_100038244 Ga0207675_1000382441 347
304 3300026121 Ga0207683_10005652 Ga0207683_100056522 347
305 3300026142 Ga0207698_10093660 Ga0207698_100936603 347
306 3300028577 Ga0265318_10002477 Ga0265318_100024778 347
307 3300031235 Ga0265330_10012334 Ga0265330_100123342 347
308 3300031238 Ga0265332_10001467 Ga0265332_100014676 347
309 3300031242 Ga0265329_10008629 Ga0265329_100086292 347
310 3300031250 Ga0265331_10002735 Ga0265331_1000273510 347
311 3300031711 Ga0265314_10000220 Ga0265314_1000022071 347
312 3300035120 Ga0373957_0037517 Ga0373957_0037517_232_1308 347
313 3300036401 Ga0373937_0011042 Ga0373937_0011042_5183_6259 347
314 3300041512 Ga0451853_1411246 Ga0451853_1411246_293_1336 347
315 3300046535 Ga0495586_0048793 Ga0495586_0048793_913_1989 347
316 3300046559 Ga0495667_0007523 Ga0495667_0007523_4493_5569 347
317 3300048912 Ga0496109_0096843 Ga0496109_0096843_669_1769 347
318 3300048914 Ga0496111_0122766 Ga0496111_0122766_728_1828 347
319 3300048917 Ga0496114_0080848 Ga0496114_0080848_1575_2621 347
320 3300049580 Ga0501046_0134697 Ga0501046_0134697_548_1594 347
321 3300053084 Ga0495595_0005079 Ga0495595_0005079_1216_2292 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09587

PGA_cap

Bacterial capsule synthesis protein PGA_cap

8

288

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gqb-assembly1.cif.gz_A crystal structure of lasso peptide epimerase mslh d11a mutant 0.8295 2 345
8gq9-assembly1.cif.gz_A crystal structure of lasso peptide epimerase mslh 0.8259 2 345
8ith-assembly1.cif.gz_A crystal structure of lasso peptide epimerase mslh h295n 0.8257 2 345
8itg-assembly1.cif.gz_A crystal structure of lasso peptide epimerase mslh in complexed with precursor peptide variant mslaw21g 0.8237 2 345
8gqb-assembly1.cif.gz_A crystal structure of lasso peptide epimerase mslh d11a mutant 0.821 2 345
ID Description Score Start End Superfamily
af_P9WM79_84_289_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8329 41 263 3.60.21.10
af_P9WM79_84_289_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8062 41 263 3.60.21.10
af_P9WM79_290_380_3.10.28.10 Alpha Beta;Roll;Endonuclease I-creI;Homing endonucleases 0.7707 280 345 3.10.28.10
af_Q2FWL2_132_323_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7206 62 104 3.30.420.40
af_P77215_158_345_3.30.390.10 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.6941 188 240 3.30.390.10
ID Description Score Start End GO Terms
AF-A0A2E5LMY0-F1-model_v4 Capsule synthesis protein CapA domain-containing protein 0.9517 1 346
AF-A0A2E5P8D7-F1-model_v4 Poly-gamma-glutamate biosynthesis protein 0.9516 1 345
AF-A0A2E5LMY0-F1-model_v4 Capsule synthesis protein CapA domain-containing protein 0.949 1 346
AF-A0A1F4B9Z2-F1-model_v4 Capsule synthesis protein CapA domain-containing protein 0.9358 1 346
AF-A0A0Q9H849-F1-model_v4 Capsule synthesis protein CapA domain-containing protein 0.9352 1 347

Feature Viewer

pLDDT pTM Quality
89.93 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map