F405930

General Info

Members Datasets Scaffolds Average Seq Length
321 147 642 304

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10000938|Ga0105240_1000093819
Length 350
Sequence MEGLYRTSCGQVQLRNVVGLPFTRLSKSIYLDAASNYEVDMNRKLIVTAGVAAWCIGTVAVNAQERPKITGISHLAVYTSDAAATEHYYTAVMGAAKEADPENPAGTKYAFSATQYVEVLPLPANAGINRMDHAAFNTSDAEGMRKYLVTKGWKTPSSVTKGKDGSKRFSVTDPEGNKIEFVQPVANAKAVKAPNVIGSHLIHVGFLVHSREAEDKFYRDLLGFRPYWFGGMNDDKIDWVSQQVPDGHDWLEYMVSGGPGTGIPASMSQQTLGVLDHFAVGEVSVPDAFKKLTAENRLGTGRHDQAPKIGKDGKYQFNMYDPDGIRAELMNFKATEKPCCSPFTAEDPAE

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
111 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
120 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
144 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.49
Rhizosphere 95.02
Stem 0
Stem Tuber 0
Unclassified 11.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10000938 3300009093 Bacteria 51767
2 JGI24739J22299_10000460 3300001989 Bacteria 14314
3 JGI24737J22298_10005850 3300001990 Bacteria 4234
4 JGI24735J21928_10003592 3300002067 Bacteria 5264
5 JGI24738J21930_10013374 3300002075 Bacteria 1777
6 rootH2_10102866 3300003320 Bacteria 2752
7 rootH2_10190948 3300003320 Bacteria 4189
8 Ga0070658_10305974 3300005327 Bacteria 1356
9 Ga0070683_100011532 3300005329 Bacteria 7646
10 Ga0070683_100019436 3300005329 Bacteria 6034
11 Ga0070683_100037207 3300005329 Bacteria 4455
12 Ga0070683_100123836 3300005329 Bacteria 2443
13 Ga0070683_100312063 3300005329 Bacteria 1496
14 Ga0070683_100433058 3300005329 Bacteria 1255
15 Ga0070670_100004364 3300005331 Bacteria 11837
16 Ga0070670_100271145 3300005331 Bacteria 1481
17 Ga0070670_100424204 3300005331 Bacteria 1176
18 Ga0068869_100008695 3300005334 Bacteria 6558
19 Ga0068869_100146202 3300005334 Unclassified 1830
20 Ga0070682_100317517 3300005337 Unclassified 1149
21 Ga0068868_100003964 3300005338 Bacteria 10335
22 Ga0068868_100024273 3300005338 Bacteria 4599
23 Ga0070660_100050733 3300005339 Bacteria 3193
24 Ga0070661_100009973 3300005344 Bacteria 6591
25 Ga0070668_100162844 3300005347 Bacteria 1811
26 Ga0070675_100105512 3300005354 Unclassified 2377
27 Ga0070671_100008931 3300005355 Bacteria 8042
28 Ga0070659_100232882 3300005366 Unclassified 1522
29 Ga0070659_100315208 3300005366 Bacteria 1306
30 Ga0070667_100002324 3300005367 Bacteria 16650
31 Ga0070714_100126565 3300005435 Bacteria 2279
32 Ga0070714_100214231 3300005435 Bacteria 1767
33 Ga0070714_100226766 3300005435 Bacteria 1720
34 Ga0070663_100011143 3300005455 Bacteria 5630
35 Ga0070662_100007993 3300005457 Bacteria 6881
36 Ga0070662_100021236 3300005457 Bacteria 4431
37 Ga0070679_100074843 3300005530 Bacteria 3377
38 Ga0070684_100008981 3300005535 Bacteria 7852
39 Ga0070684_100011117 3300005535 Bacteria 7163
40 Ga0070684_100028604 3300005535 Bacteria 4716
41 Ga0070684_100157825 3300005535 Unclassified 2057
42 Ga0068853_100019021 3300005539 Bacteria 5691
43 Ga0068853_100064934 3300005539 Bacteria 3166
44 Ga0068853_100313570 3300005539 Bacteria 1453
45 Ga0070672_100269229 3300005543 Bacteria 1438
46 Ga0070695_100206656 3300005545 Bacteria 1407
47 Ga0068855_100001135 3300005563 Bacteria 32999
48 Ga0068855_100002456 3300005563 Bacteria 22901
49 Ga0068855_100031174 3300005563 Bacteria 6368
50 Ga0068855_100055730 3300005563 Bacteria 4641
51 Ga0068855_100138024 3300005563 Bacteria 2781
52 Ga0068855_100168906 3300005563 Unclassified 2478
53 Ga0068855_100279441 3300005563 Bacteria 1854
54 Ga0070664_100203633 3300005564 Unclassified 1767
55 Ga0068857_100001794 3300005577 Bacteria 17284
56 Ga0068857_100005959 3300005577 Bacteria 10414
57 Ga0068857_100457988 3300005577 Bacteria 1193
58 Ga0068854_100379213 3300005578 Bacteria 1165
59 Ga0068856_100001460 3300005614 Bacteria 24761
60 Ga0068856_100030838 3300005614 Bacteria 5243
61 Ga0068856_100042053 3300005614 Unclassified 4494
62 Ga0068856_100135142 3300005614 Bacteria 2471
63 Ga0068852_100000099 3300005616 Bacteria 58503
64 Ga0068852_100000576 3300005616 Bacteria 24128
65 Ga0068852_100054725 3300005616 Bacteria 3441
66 Ga0068852_100146957 3300005616 Bacteria 2187
67 Ga0068859_100021845 3300005617 Bacteria 6418
68 Ga0068864_100006785 3300005618 Bacteria 9374
69 Ga0068851_10006872 3300005834 Bacteria 5213
70 Ga0068851_10009859 3300005834 Bacteria 4449
71 Ga0068851_10015675 3300005834 Bacteria 3614
72 Ga0068851_10053947 3300005834 Unclassified 2047
73 Ga0068851_10108488 3300005834 Unclassified 1480
74 Ga0068863_100012074 3300005841 Bacteria 8344
75 Ga0068863_100184595 3300005841 Unclassified 2003
76 Ga0068858_100001620 3300005842 Bacteria 22964
77 Ga0068860_100000996 3300005843 Bacteria 31353
78 Ga0068860_100121126 3300005843 Unclassified 2505
79 Ga0068862_100060597 3300005844 Bacteria 3251
80 Ga0070717_10221574 3300006028 Bacteria 1663
81 Ga0097621_100045534 3300006237 Bacteria 3544
82 Ga0068871_100047112 3300006358 Bacteria 3475
83 Ga0075436_100014686 3300006914 Bacteria 5368
84 Ga0097620_100021845 3300006931 Bacteria 6418
85 Ga0105240_10000001 3300009093 Bacteria 2887840
86 Ga0105240_10000437 3300009093 Bacteria 76980
87 Ga0105240_10000763 3300009093 Bacteria 58506
88 Ga0105240_10001274 3300009093 Bacteria 43595
89 Ga0105240_10006673 3300009093 Bacteria 16921
90 Ga0105240_10038986 3300009093 Bacteria 6089
91 Ga0105240_10073244 3300009093 Bacteria 4230
92 Ga0105240_10095998 3300009093 Bacteria 3614
93 Ga0105240_10208388 3300009093 Bacteria 2286
94 Ga0105240_10600985 3300009093 Unclassified 1211
95 Ga0105245_10012923 3300009098 Bacteria 7277
96 Ga0105245_10042200 3300009098 Bacteria 4069
97 Ga0105245_10086098 3300009098 Bacteria 2881
98 Ga0105247_10005544 3300009101 Bacteria 7934
99 Ga0105247_10021685 3300009101 Unclassified 3865
100 Ga0105241_10000378 3300009174 Bacteria 33925
101 Ga0105241_10000566 3300009174 Bacteria 27839
102 Ga0105241_10004600 3300009174 Bacteria 10206
103 Ga0105241_10192866 3300009174 Bacteria 1697
104 Ga0105241_10193082 3300009174 Unclassified 1696
105 Ga0105241_10213976 3300009174 Bacteria 1616
106 Ga0105242_10017443 3300009176 Bacteria 5596
107 Ga0105248_10000049 3300009177 Bacteria 153741
108 Ga0105248_10000635 3300009177 Bacteria 39916
109 Ga0105248_10099099 3300009177 Bacteria 3284
110 Ga0105248_10118947 3300009177 Bacteria 2980
111 Ga0105237_10005645 3300009545 Bacteria 14089
112 Ga0105237_10034088 3300009545 Bacteria 5157
113 Ga0105237_10150059 3300009545 Bacteria 2327
114 Ga0105237_10328861 3300009545 Bacteria 1532
115 Ga0105238_10000739 3300009551 Bacteria 34142
116 Ga0105238_10001413 3300009551 Bacteria 24050
117 Ga0105238_10006433 3300009551 Bacteria 11685
118 Ga0105238_10068099 3300009551 Bacteria 3561
119 Ga0105238_10149920 3300009551 Bacteria 2307
120 Ga0105238_10156791 3300009551 Bacteria 2252
121 Ga0105238_10488699 3300009551 Bacteria 1231
122 Ga0105239_10001295 3300010375 Bacteria 33721
123 Ga0105239_10007922 3300010375 Bacteria 12146
124 Ga0105239_10048175 3300010375 Bacteria 4672
125 Ga0105239_10144794 3300010375 Unclassified 2649
126 Ga0105239_10183088 3300010375 Bacteria 2344
127 Ga0105246_10004561 3300011119 Bacteria 8432
128 Ga0157373_10022490 3300013100 Bacteria 4575
129 Ga0157373_10081793 3300013100 Bacteria 2277
130 Ga0157370_10000525 3300013104 Bacteria 47845
131 Ga0157370_10008004 3300013104 Bacteria 11452
132 Ga0157369_10000586 3300013105 Bacteria 47526
133 Ga0157369_10002759 3300013105 Bacteria 20968
134 Ga0157369_10012980 3300013105 Bacteria 9438
135 Ga0157369_10042351 3300013105 Bacteria 4967
136 Ga0157369_10043798 3300013105 Bacteria 4877
137 Ga0157369_10056575 3300013105 Bacteria 4232
138 Ga0157369_10068408 3300013105 Bacteria 3815
139 Ga0157369_10148982 3300013105 Unclassified 2473
140 Ga0157369_10260572 3300013105 Bacteria 1808
141 Ga0157374_10002855 3300013296 Bacteria 14495
142 Ga0157374_10003001 3300013296 Bacteria 14126
143 Ga0157374_10180899 3300013296 Bacteria 2059
144 Ga0157378_10050876 3300013297 Bacteria 3686
145 Ga0157378_10053683 3300013297 Bacteria 3588
146 Ga0157378_10064643 3300013297 Bacteria 3273
147 Ga0157378_10128537 3300013297 Bacteria 2342
148 Ga0163162_10139773 3300013306 Unclassified 2534
149 Ga0157372_10000259 3300013307 Bacteria 58487
150 Ga0157372_10010022 3300013307 Bacteria 10077
151 Ga0157372_10017475 3300013307 Bacteria 7699
152 Ga0157372_10018599 3300013307 Bacteria 7474
153 Ga0157372_10028141 3300013307 Bacteria 6132
154 Ga0157372_10028915 3300013307 Bacteria 6048
155 Ga0157372_10031706 3300013307 Bacteria 5788
156 Ga0157372_10088127 3300013307 Bacteria 3523
157 Ga0157372_10110388 3300013307 Bacteria 3150
158 Ga0157372_10190686 3300013307 Bacteria 2374
159 Ga0157375_10005768 3300013308 Bacteria 10772
160 Ga0157375_10106391 3300013308 Bacteria 2897
161 Ga0157375_10262433 3300013308 Bacteria 1889
162 Ga0163163_10008116 3300014325 Bacteria 9305
163 Ga0157379_10002128 3300014968 Bacteria 16417
164 Ga0157379_10029109 3300014968 Bacteria 4912
165 Ga0157379_10091516 3300014968 Bacteria 2728
166 Ga0157379_10166637 3300014968 Bacteria 1989
167 Ga0157379_10392242 3300014968 Bacteria 1275
168 Ga0157376_10019394 3300014969 Bacteria 5241
169 Ga0157376_10061990 3300014969 Bacteria 3145
170 Ga0213872_10001391 3300021361 Bacteria 15936
171 Ga0213872_10053440 3300021361 Bacteria 1832
172 Ga0213874_10030714 3300021377 Unclassified 1550
173 Ga0207697_10158105 3300025315 Bacteria 988
174 Ga0207656_10016641 3300025321 Bacteria 2866
175 Ga0207656_10031687 3300025321 Bacteria 2192
176 Ga0207656_10056183 3300025321 Bacteria 1715
177 Ga0207656_10109273 3300025321 Unclassified 1276
178 Ga0207710_10007570 3300025900 Bacteria 4593
179 Ga0207647_10001420 3300025904 Bacteria 18375
180 Ga0207647_10003013 3300025904 Bacteria 12669
181 Ga0207699_10260827 3300025906 Unclassified 1198
182 Ga0207645_10017294 3300025907 Bacteria 4764
183 Ga0207705_10015276 3300025909 Bacteria 5513
184 Ga0207705_10044275 3300025909 Bacteria 3198
185 Ga0207705_10067197 3300025909 Bacteria 2594
186 Ga0207654_10000853 3300025911 Bacteria 16833
187 Ga0207654_10036966 3300025911 Bacteria 2731
188 Ga0207695_10000001 3300025913 Bacteria 2888630
189 Ga0207695_10000086 3300025913 Bacteria 278055
190 Ga0207695_10000432 3300025913 Bacteria 91934
191 Ga0207695_10000798 3300025913 Bacteria 59005
192 Ga0207695_10001290 3300025913 Bacteria 42540
193 Ga0207695_10001337 3300025913 Bacteria 41864
194 Ga0207695_10041489 3300025913 Bacteria 4925
195 Ga0207695_10419787 3300025913 Bacteria 1222
196 Ga0207671_10000693 3300025914 Bacteria 43565
197 Ga0207671_10000720 3300025914 Bacteria 42179
198 Ga0207657_10022732 3300025919 Bacteria 5858
199 Ga0207649_10021830 3300025920 Bacteria 3693
200 Ga0207649_10226029 3300025920 Unclassified 1336
201 Ga0207652_10032688 3300025921 Bacteria 4376
202 Ga0207694_10000276 3300025924 Bacteria 48688
203 Ga0207694_10000318 3300025924 Bacteria 45372
204 Ga0207694_10001748 3300025924 Bacteria 18228
205 Ga0207694_10041576 3300025924 Bacteria 3542
206 Ga0207650_10016084 3300025925 Bacteria 5223
207 Ga0207659_10123214 3300025926 Bacteria 1989
208 Ga0207687_10011050 3300025927 Bacteria 5903
209 Ga0207687_10020236 3300025927 Bacteria 4414
210 Ga0207687_10047769 3300025927 Bacteria 2969
211 Ga0207664_10162528 3300025929 Bacteria 1905
212 Ga0207664_10201830 3300025929 Bacteria 1717
213 Ga0207644_10018073 3300025931 Bacteria 4767
214 Ga0207706_10005347 3300025933 Bacteria 11968
215 Ga0207706_10005484 3300025933 Bacteria 11830
216 Ga0207706_10020562 3300025933 Bacteria 5933
217 Ga0207686_10102346 3300025934 Unclassified 1915
218 Ga0207691_10183962 3300025940 Bacteria 1825
219 Ga0207711_10000033 3300025941 Bacteria 193513
220 Ga0207711_10002506 3300025941 Bacteria 16369
221 Ga0207711_10019085 3300025941 Bacteria 5705
222 Ga0207711_10098418 3300025941 Bacteria 2584
223 Ga0207689_10001488 3300025942 Bacteria 22408
224 Ga0207661_10004146 3300025944 Bacteria 10134
225 Ga0207661_10037069 3300025944 Bacteria 3810
226 Ga0207679_10053822 3300025945 Bacteria 2960
227 Ga0207679_10234673 3300025945 Bacteria 1551
228 Ga0207667_10006392 3300025949 Bacteria 14283
229 Ga0207667_10006727 3300025949 Bacteria 13885
230 Ga0207667_10007641 3300025949 Bacteria 12950
231 Ga0207667_10009295 3300025949 Bacteria 11595
232 Ga0207667_10146454 3300025949 Bacteria 2431
233 Ga0207667_10151222 3300025949 Unclassified 2389
234 Ga0207658_10000185 3300025986 Bacteria 66636
235 Ga0207677_10002396 3300026023 Bacteria 9826
236 Ga0207703_10002736 3300026035 Bacteria 15104
237 Ga0207703_10282454 3300026035 Bacteria 1508
238 Ga0207639_10000402 3300026041 Bacteria 29850
239 Ga0207639_10041692 3300026041 Bacteria 3436
240 Ga0207678_10017770 3300026067 Bacteria 6244
241 Ga0207678_10260074 3300026067 Bacteria 1487
242 Ga0207678_10282141 3300026067 Bacteria 1426
243 Ga0207702_10004170 3300026078 Bacteria 12943
244 Ga0207702_10006749 3300026078 Bacteria 9852
245 Ga0207702_10078026 3300026078 Bacteria 2866
246 Ga0207702_10101973 3300026078 Bacteria 2535
247 Ga0207702_10103455 3300026078 Bacteria 2519
248 Ga0207676_10003166 3300026095 Bacteria 11736
249 Ga0207676_10040157 3300026095 Bacteria 3585
250 Ga0207674_10011660 3300026116 Bacteria 9869
251 Ga0207674_10042418 3300026116 Bacteria 4699
252 Ga0207683_10000680 3300026121 Bacteria 31209
253 Ga0207698_10000345 3300026142 Bacteria 27416
254 Ga0207698_10001419 3300026142 Bacteria 13908
255 Ga0207698_10166511 3300026142 Bacteria 1935
256 Ga0207698_10190250 3300026142 Bacteria 1827
257 Ga0207698_10196332 3300026142 Bacteria 1803
258 Ga0207698_10199697 3300026142 Unclassified 1789
259 Ga0268265_10120172 3300028380 Bacteria 2163
260 Ga0268264_10063398 3300028381 Bacteria 3106
261 Ga0265336_10002364 3300028666 Bacteria 7831
262 Ga0265338_10001174 3300028800 Bacteria 43228
263 Ga0265338_10056862 3300028800 Bacteria 3465
264 Ga0265765_1009714 3300030879 Unclassified 1062
265 Ga0265330_10014040 3300031235 Bacteria 3720
266 Ga0265330_10029209 3300031235 Bacteria 2481
267 Ga0265330_10036848 3300031235 Unclassified 2179
268 Ga0265328_10007607 3300031239 Bacteria 4507
269 Ga0265325_10038499 3300031241 Bacteria 2524
270 Ga0265325_10061609 3300031241 Bacteria 1902
271 Ga0265340_10010228 3300031247 Bacteria 5021
272 Ga0265340_10079967 3300031247 Unclassified 1540
273 Ga0265340_10096552 3300031247 Bacteria 1377
274 Ga0265339_10000012 3300031249 Bacteria 203469
275 Ga0265339_10000541 3300031249 Bacteria 29498
276 Ga0265339_10017542 3300031249 Bacteria 4237
277 Ga0265316_10002481 3300031344 Bacteria 19119
278 Ga0265316_10005484 3300031344 Bacteria 12312
279 Ga0265316_10016348 3300031344 Bacteria 6438
280 Ga0265316_10025892 3300031344 Bacteria 4888
281 Ga0265316_10047859 3300031344 Bacteria 3380
282 Ga0265316_10262885 3300031344 Bacteria 1265
283 Ga0265313_10015716 3300031595 Bacteria 4389
284 Ga0265314_10130115 3300031711 Bacteria 1571
285 Ga0265314_10180250 3300031711 Bacteria 1266
286 Ga0265342_10001196 3300031712 Bacteria 24662
287 Ga0265342_10028991 3300031712 Bacteria 3441
288 Ga0265342_10083748 3300031712 Unclassified 1837
289 Ga0265342_10129436 3300031712 Bacteria 1415
290 Ga0316583_10031683 3300032133 Bacteria 1882
291 Ga0436360_0057883 3300039438 Unclassified 2962
292 Ga0436361_0267704 3300039447 Bacteria 23699
293 Ga0436361_0568151 3300039447 Bacteria 10484
294 Ga0436363_1647789 3300039450 Bacteria 1408
295 Ga0439458_0002786 3300042157 Bacteria 4208
296 Ga0466966_0058399 3300044684 Bacteria 2438
297 Ga0466963_0008096 3300044694 Bacteria 6294
298 Ga0466959_0083326 3300045049 Unclassified 2303
299 Ga0466967_0004166 3300045976 Bacteria 9678
300 Ga0495617_036361 3300046452 Bacteria 1651
301 Ga0495629_0042000 3300046459 Bacteria 3215
302 Ga0495580_0240216 3300046472 Bacteria 1242
303 Ga0495652_0022698 3300046529 Bacteria 5569
304 Ga0495587_0062760 3300046536 Bacteria 2175
305 Ga0495587_0142318 3300046536 Bacteria 1368
306 Ga0495645_0030508 3300046543 Unclassified 3926
307 Ga0495649_0028383 3300046694 Bacteria 3102
308 Ga0495602_0217241 3300048088 Bacteria 1446
309 Ga0496100_0090523 3300048903 Bacteria 2086
310 Ga0496101_0055412 3300048904 Unclassified 2864
311 Ga0496104_0116997 3300048907 Unclassified 2558
312 Ga0496105_0005465 3300048908 Bacteria 9642
313 Ga0496106_0123333 3300048909 Unclassified 2027
314 Ga0496107_0006284 3300048910 Bacteria 8166
315 Ga0496115_0004644 3300048918 Bacteria 9939
316 Ga0496115_0124523 3300048918 Unclassified 2123
317 Ga0496122_0002984 3300048925 Bacteria 23033
318 Ga0496123_0009579 3300048926 Bacteria 8700
319 Ga0496124_0006845 3300048927 Bacteria 12278
320 Ga0496126_0020900 3300048929 Bacteria 6408
321 Ga0495601_0022207 3300053077 Bacteria 3894
322 Ga0105240_10000938
323 JGI24739J22299_10000460
324 JGI24737J22298_10005850
325 JGI24735J21928_10003592
326 JGI24738J21930_10013374
327 rootH2_10102866
328 rootH2_10190948
329 Ga0070658_10305974
330 Ga0070683_100011532
331 Ga0070683_100019436
332 Ga0070683_100037207
333 Ga0070683_100123836
334 Ga0070683_100312063
335 Ga0070683_100433058
336 Ga0070670_100004364
337 Ga0070670_100271145
338 Ga0070670_100424204
339 Ga0068869_100008695
340 Ga0068869_100146202
341 Ga0070682_100317517
342 Ga0068868_100003964
343 Ga0068868_100024273
344 Ga0070660_100050733
345 Ga0070661_100009973
346 Ga0070668_100162844
347 Ga0070675_100105512
348 Ga0070671_100008931
349 Ga0070659_100232882
350 Ga0070659_100315208
351 Ga0070667_100002324
352 Ga0070714_100126565
353 Ga0070714_100214231
354 Ga0070714_100226766
355 Ga0070663_100011143
356 Ga0070662_100007993
357 Ga0070662_100021236
358 Ga0070679_100074843
359 Ga0070684_100008981
360 Ga0070684_100011117
361 Ga0070684_100028604
362 Ga0070684_100157825
363 Ga0068853_100019021
364 Ga0068853_100064934
365 Ga0068853_100313570
366 Ga0070672_100269229
367 Ga0070695_100206656
368 Ga0068855_100001135
369 Ga0068855_100002456
370 Ga0068855_100031174
371 Ga0068855_100055730
372 Ga0068855_100138024
373 Ga0068855_100168906
374 Ga0068855_100279441
375 Ga0070664_100203633
376 Ga0068857_100001794
377 Ga0068857_100005959
378 Ga0068857_100457988
379 Ga0068854_100379213
380 Ga0068856_100001460
381 Ga0068856_100030838
382 Ga0068856_100042053
383 Ga0068856_100135142
384 Ga0068852_100000099
385 Ga0068852_100000576
386 Ga0068852_100054725
387 Ga0068852_100146957
388 Ga0068859_100021845
389 Ga0068864_100006785
390 Ga0068851_10006872
391 Ga0068851_10009859
392 Ga0068851_10015675
393 Ga0068851_10053947
394 Ga0068851_10108488
395 Ga0068863_100012074
396 Ga0068863_100184595
397 Ga0068858_100001620
398 Ga0068860_100000996
399 Ga0068860_100121126
400 Ga0068862_100060597
401 Ga0070717_10221574
402 Ga0097621_100045534
403 Ga0068871_100047112
404 Ga0075436_100014686
405 Ga0097620_100021845
406 Ga0105240_10000001
407 Ga0105240_10000437
408 Ga0105240_10000763
409 Ga0105240_10001274
410 Ga0105240_10006673
411 Ga0105240_10038986
412 Ga0105240_10073244
413 Ga0105240_10095998
414 Ga0105240_10208388
415 Ga0105240_10600985
416 Ga0105245_10012923
417 Ga0105245_10042200
418 Ga0105245_10086098
419 Ga0105247_10005544
420 Ga0105247_10021685
421 Ga0105241_10000378
422 Ga0105241_10000566
423 Ga0105241_10004600
424 Ga0105241_10192866
425 Ga0105241_10193082
426 Ga0105241_10213976
427 Ga0105242_10017443
428 Ga0105248_10000049
429 Ga0105248_10000635
430 Ga0105248_10099099
431 Ga0105248_10118947
432 Ga0105237_10005645
433 Ga0105237_10034088
434 Ga0105237_10150059
435 Ga0105237_10328861
436 Ga0105238_10000739
437 Ga0105238_10001413
438 Ga0105238_10006433
439 Ga0105238_10068099
440 Ga0105238_10149920
441 Ga0105238_10156791
442 Ga0105238_10488699
443 Ga0105239_10001295
444 Ga0105239_10007922
445 Ga0105239_10048175
446 Ga0105239_10144794
447 Ga0105239_10183088
448 Ga0105246_10004561
449 Ga0157373_10022490
450 Ga0157373_10081793
451 Ga0157370_10000525
452 Ga0157370_10008004
453 Ga0157369_10000586
454 Ga0157369_10002759
455 Ga0157369_10012980
456 Ga0157369_10042351
457 Ga0157369_10043798
458 Ga0157369_10056575
459 Ga0157369_10068408
460 Ga0157369_10148982
461 Ga0157369_10260572
462 Ga0157374_10002855
463 Ga0157374_10003001
464 Ga0157374_10180899
465 Ga0157378_10050876
466 Ga0157378_10053683
467 Ga0157378_10064643
468 Ga0157378_10128537
469 Ga0163162_10139773
470 Ga0157372_10000259
471 Ga0157372_10010022
472 Ga0157372_10017475
473 Ga0157372_10018599
474 Ga0157372_10028141
475 Ga0157372_10028915
476 Ga0157372_10031706
477 Ga0157372_10088127
478 Ga0157372_10110388
479 Ga0157372_10190686
480 Ga0157375_10005768
481 Ga0157375_10106391
482 Ga0157375_10262433
483 Ga0163163_10008116
484 Ga0157379_10002128
485 Ga0157379_10029109
486 Ga0157379_10091516
487 Ga0157379_10166637
488 Ga0157379_10392242
489 Ga0157376_10019394
490 Ga0157376_10061990
491 Ga0213872_10001391
492 Ga0213872_10053440
493 Ga0213874_10030714
494 Ga0207697_10158105
495 Ga0207656_10016641
496 Ga0207656_10031687
497 Ga0207656_10056183
498 Ga0207656_10109273
499 Ga0207710_10007570
500 Ga0207647_10001420
501 Ga0207647_10003013
502 Ga0207699_10260827
503 Ga0207645_10017294
504 Ga0207705_10015276
505 Ga0207705_10044275
506 Ga0207705_10067197
507 Ga0207654_10000853
508 Ga0207654_10036966
509 Ga0207695_10000001
510 Ga0207695_10000086
511 Ga0207695_10000432
512 Ga0207695_10000798
513 Ga0207695_10001290
514 Ga0207695_10001337
515 Ga0207695_10041489
516 Ga0207695_10419787
517 Ga0207671_10000693
518 Ga0207671_10000720
519 Ga0207657_10022732
520 Ga0207649_10021830
521 Ga0207649_10226029
522 Ga0207652_10032688
523 Ga0207694_10000276
524 Ga0207694_10000318
525 Ga0207694_10001748
526 Ga0207694_10041576
527 Ga0207650_10016084
528 Ga0207659_10123214
529 Ga0207687_10011050
530 Ga0207687_10020236
531 Ga0207687_10047769
532 Ga0207664_10162528
533 Ga0207664_10201830
534 Ga0207644_10018073
535 Ga0207706_10005347
536 Ga0207706_10005484
537 Ga0207706_10020562
538 Ga0207686_10102346
539 Ga0207691_10183962
540 Ga0207711_10000033
541 Ga0207711_10002506
542 Ga0207711_10019085
543 Ga0207711_10098418
544 Ga0207689_10001488
545 Ga0207661_10004146
546 Ga0207661_10037069
547 Ga0207679_10053822
548 Ga0207679_10234673
549 Ga0207667_10006392
550 Ga0207667_10006727
551 Ga0207667_10007641
552 Ga0207667_10009295
553 Ga0207667_10146454
554 Ga0207667_10151222
555 Ga0207658_10000185
556 Ga0207677_10002396
557 Ga0207703_10002736
558 Ga0207703_10282454
559 Ga0207639_10000402
560 Ga0207639_10041692
561 Ga0207678_10017770
562 Ga0207678_10260074
563 Ga0207678_10282141
564 Ga0207702_10004170
565 Ga0207702_10006749
566 Ga0207702_10078026
567 Ga0207702_10101973
568 Ga0207702_10103455
569 Ga0207676_10003166
570 Ga0207676_10040157
571 Ga0207674_10011660
572 Ga0207674_10042418
573 Ga0207683_10000680
574 Ga0207698_10000345
575 Ga0207698_10001419
576 Ga0207698_10166511
577 Ga0207698_10190250
578 Ga0207698_10196332
579 Ga0207698_10199697
580 Ga0268265_10120172
581 Ga0268264_10063398
582 Ga0265336_10002364
583 Ga0265338_10001174
584 Ga0265338_10056862
585 Ga0265765_1009714
586 Ga0265330_10014040
587 Ga0265330_10029209
588 Ga0265330_10036848
589 Ga0265328_10007607
590 Ga0265325_10038499
591 Ga0265325_10061609
592 Ga0265340_10010228
593 Ga0265340_10079967
594 Ga0265340_10096552
595 Ga0265339_10000012
596 Ga0265339_10000541
597 Ga0265339_10017542
598 Ga0265316_10002481
599 Ga0265316_10005484
600 Ga0265316_10016348
601 Ga0265316_10025892
602 Ga0265316_10047859
603 Ga0265316_10262885
604 Ga0265313_10015716
605 Ga0265314_10130115
606 Ga0265314_10180250
607 Ga0265342_10001196
608 Ga0265342_10028991
609 Ga0265342_10083748
610 Ga0265342_10129436
611 Ga0316583_10031683
612 Ga0436360_0057883
613 Ga0436361_0267704
614 Ga0436361_0568151
615 Ga0436363_1647789
616 Ga0439458_0002786
617 Ga0466966_0058399
618 Ga0466963_0008096
619 Ga0466959_0083326
620 Ga0466967_0004166
621 Ga0495617_036361
622 Ga0495629_0042000
623 Ga0495580_0240216
624 Ga0495652_0022698
625 Ga0495587_0062760
626 Ga0495587_0142318
627 Ga0495645_0030508
628 Ga0495649_0028383
629 Ga0495602_0217241
630 Ga0496100_0090523
631 Ga0496101_0055412
632 Ga0496104_0116997
633 Ga0496105_0005465
634 Ga0496106_0123333
635 Ga0496107_0006284
636 Ga0496115_0004644
637 Ga0496115_0124523
638 Ga0496122_0002984
639 Ga0496123_0009579
640 Ga0496124_0006845
641 Ga0496126_0020900
642 Ga0495601_0022207

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

71

181

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rt5-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase protein from planctomyces limnophilus dsm 3776 0.7564 26 139
3rmu-assembly2.cif.gz_D crystal structure of human methylmalonyl-coa epimerase, mcee 0.7367 24 138
6bu2-assembly1.cif.gz_A crystal structure of methylmalonyl-coa epimerase from mycobacterium tuberculosis 0.7361 20 141
2pm7-assembly1.cif.gz_D crystal structure of yeast sec13/31 edge element of the copii vesicular coat, selenomethionine version 0.7262 245 273
6qh4-assembly1.cif.gz_A crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.7129 23 138
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8628 92 139 3.30.720.110
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.767 219 268 3.10.180.10
3hq0A02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7655 27 143 3.10.180.10
3oajB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7647 24 141 3.10.180.10
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7643 90 145 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A248JUP5-F1-model_v4 Glyoxalase 0.9065 13 288 GO:0004493
GO:0046491
GO:0046872
AF-A0A7W8INA2-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9028 21 288 GO:0004493
GO:0016829
GO:0046491
GO:0046872
GO:0051213
AF-A0A520JQA6-F1-model_v4 VOC family protein 0.8961 14 80
AF-E6PWV4-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.8932 1 288 GO:0004493
GO:0046491
GO:0046872
GO:0051213
AF-E6PWV4-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.8902 1 288 GO:0004493
GO:0046491
GO:0046872
GO:0051213

Map