F405863

General Info

Members Datasets Scaffolds Average Seq Length
321 171 642 212

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100002039|Ga0070708_10000203912
Length 254
Sequence MPAAAMLAIAGAVVPSGEAISSVAPLASTRSLYFGSVADLPLDLPEAAASALLAALDREGKIGRALEALGPIAGRDVLVVGAGSAERARLASAGARVADVSLDVGRSIWPVPDSSADAVVSAWSGFRGVSPGELVEADRVLRPGGRLLVIHDYGRDDVSRLRGDLPEYGAWSRRDGPFVRNGFRIRVLHCFWTFDTIEAAAVFLGDAFGEAGRTLAAGLKRPRLTYNVAIYHRARGGRTAVAGSQALRSATAER

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
122 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
123 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 14.95
Rhizosphere 84.11
Stem 0
Stem Tuber 0
Unclassified 8.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100002039 3300005445 Bacteria 15552
2 Ga0070683_100069799 3300005329 Bacteria 3277
3 Ga0070683_100142316 3300005329 Bacteria 2272
4 Ga0070683_100985121 3300005329 Unclassified 809
5 Ga0070690_100033251 3300005330 Bacteria 3227
6 Ga0070690_100101186 3300005330 Bacteria 1911
7 Ga0070670_100131702 3300005331 Bacteria 2160
8 Ga0068869_100225294 3300005334 Bacteria 1488
9 Ga0070666_10196539 3300005335 Bacteria 1418
10 Ga0070680_100233118 3300005336 Bacteria 1555
11 Ga0070680_100302466 3300005336 Bacteria 1357
12 Ga0068868_100284014 3300005338 Bacteria 1402
13 Ga0068868_100390025 3300005338 Bacteria 1200
14 Ga0068868_100515507 3300005338 Bacteria 1049
15 Ga0070660_100025781 3300005339 Bacteria 4372
16 Ga0070689_100075269 3300005340 Bacteria 2643
17 Ga0070691_10058960 3300005341 Bacteria 1844
18 Ga0070687_100147665 3300005343 Bacteria 1376
19 Ga0070687_100471237 3300005343 Bacteria 839
20 Ga0070661_100151734 3300005344 Bacteria 1752
21 Ga0070692_10003822 3300005345 Bacteria 6195
22 Ga0070675_100105546 3300005354 Bacteria 2377
23 Ga0070674_100495714 3300005356 Unclassified 1016
24 Ga0070673_100463086 3300005364 Bacteria 1142
25 Ga0070659_100243255 3300005366 Bacteria 1490
26 Ga0070667_100076270 3300005367 Bacteria 2862
27 Ga0070703_10010826 3300005406 Unclassified 2573
28 Ga0070701_10107426 3300005438 Bacteria 1555
29 Ga0070705_100112883 3300005440 Bacteria 1740
30 Ga0070705_100143461 3300005440 Bacteria 1575
31 Ga0070705_100716798 3300005440 Archaea 787
32 Ga0070700_100184718 3300005441 Bacteria 1454
33 Ga0070694_100001130 3300005444 Bacteria 15290
34 Ga0070694_100066003 3300005444 Bacteria 2482
35 Ga0070694_100147917 3300005444 Bacteria 1713
36 Ga0070708_100202974 3300005445 Unclassified 1856
37 Ga0070663_100139320 3300005455 Bacteria 1850
38 Ga0070662_100799672 3300005457 Bacteria 802
39 Ga0068867_100725118 3300005459 Unclassified 880
40 Ga0070706_100002573 3300005467 Bacteria 18233
41 Ga0070706_100007856 3300005467 Bacteria 9969
42 Ga0070706_100621198 3300005467 Archaea 1004
43 Ga0070707_100002692 3300005468 Bacteria 16892
44 Ga0070698_100009990 3300005471 Bacteria 10144
45 Ga0070698_100078468 3300005471 Bacteria 3300
46 Ga0070698_100814999 3300005471 Bacteria 878
47 Ga0070699_100102723 3300005518 Bacteria 2506
48 Ga0070699_100443717 3300005518 Archaea 1176
49 Ga0070684_100027314 3300005535 Bacteria 4815
50 Ga0070684_100293329 3300005535 Bacteria 1491
51 Ga0070697_100470351 3300005536 Bacteria 1097
52 Ga0068853_100204668 3300005539 Bacteria 1797
53 Ga0068853_100386820 3300005539 Bacteria 1307
54 Ga0068853_101025374 3300005539 Bacteria 795
55 Ga0070686_100038845 3300005544 Bacteria 2962
56 Ga0070686_100139395 3300005544 Bacteria 1686
57 Ga0070695_100010212 3300005545 Bacteria 5602
58 Ga0070695_100019768 3300005545 Bacteria 4106
59 Ga0070695_100069960 3300005545 Bacteria 2294
60 Ga0070695_100095533 3300005545 Unclassified 1992
61 Ga0070696_100005667 3300005546 Bacteria 8341
62 Ga0070696_100006192 3300005546 Bacteria 8001
63 Ga0070696_100047643 3300005546 Bacteria 2974
64 Ga0070696_100149515 3300005546 Unclassified 1713
65 Ga0070693_100008950 3300005547 Bacteria 4967
66 Ga0070693_100217180 3300005547 Unclassified 1251
67 Ga0070704_100004920 3300005549 Bacteria 7755
68 Ga0070704_100073696 3300005549 Bacteria 2488
69 Ga0070704_100395590 3300005549 Bacteria 1178
70 Ga0070664_100023904 3300005564 Bacteria 5049
71 Ga0070664_100246418 3300005564 Bacteria 1605
72 Ga0070664_100415913 3300005564 Bacteria 1231
73 Ga0068854_100218207 3300005578 Bacteria 1508
74 Ga0068856_100543980 3300005614 Unclassified 1182
75 Ga0070702_100117297 3300005615 Bacteria 1661
76 Ga0068852_100282483 3300005616 Bacteria 1601
77 Ga0068852_100664919 3300005616 Bacteria 1050
78 Ga0068859_100008208 3300005617 Bacteria 10593
79 Ga0068859_100065076 3300005617 Bacteria 3680
80 Ga0068864_100096064 3300005618 Bacteria 2622
81 Ga0068864_100172366 3300005618 Bacteria 1974
82 Ga0068864_100484611 3300005618 Bacteria 1187
83 Ga0068863_100167201 3300005841 Bacteria 2109
84 Ga0068858_100273401 3300005842 Bacteria 1608
85 Ga0068858_100501056 3300005842 Unclassified 1173
86 Ga0068860_100015308 3300005843 Bacteria 7491
87 Ga0068860_100024499 3300005843 Bacteria 5830
88 Ga0081455_10195922 3300005937 Bacteria 1517
89 Ga0075365_10091614 3300006038 Bacteria 2071
90 Ga0070712_100289069 3300006175 Unclassified 1323
91 Ga0070712_100421873 3300006175 Bacteria 1106
92 Ga0068871_100322999 3300006358 Bacteria 1360
93 Ga0075428_100151175 3300006844 Unclassified 2522
94 Ga0075428_100508609 3300006844 Bacteria 1289
95 Ga0075431_100371579 3300006847 Bacteria 1435
96 Ga0075433_10023679 3300006852 Bacteria 5171
97 Ga0075433_10087323 3300006852 Bacteria 2754
98 Ga0075433_10250990 3300006852 Bacteria 1570
99 Ga0075434_100645233 3300006871 Bacteria 1077
100 Ga0075429_100041036 3300006880 Bacteria 4030
101 Ga0068865_100055756 3300006881 Bacteria 2751
102 Ga0097620_100008208 3300006931 Bacteria 10593
103 Ga0097620_100065077 3300006931 Bacteria 3680
104 Ga0097620_100318299 3300006931 Bacteria 1650
105 Ga0075435_100102551 3300007076 Bacteria 2372
106 Ga0111539_10387535 3300009094 Bacteria 1627
107 Ga0111539_10689870 3300009094 Bacteria 1189
108 Ga0105245_10019254 3300009098 Bacteria 5977
109 Ga0105245_10066405 3300009098 Bacteria 3265
110 Ga0105245_10308866 3300009098 Bacteria 1554
111 Ga0105245_10334675 3300009098 Unclassified 1495
112 Ga0105245_10583009 3300009098 Bacteria 1143
113 Ga0105247_10113767 3300009101 Bacteria 1745
114 Ga0105247_10409491 3300009101 Unclassified 968
115 Ga0114129_10015193 3300009147 Bacteria 10958
116 Ga0114129_10053856 3300009147 Bacteria 5643
117 Ga0114129_10184413 3300009147 Bacteria 2837
118 Ga0105243_10008875 3300009148 Bacteria 7693
119 Ga0105243_10891618 3300009148 Bacteria 884
120 Ga0105243_11286657 3300009148 Bacteria 748
121 Ga0105242_10004638 3300009176 Bacteria 10653
122 Ga0105242_11041401 3300009176 Bacteria 829
123 Ga0105248_10181944 3300009177 Bacteria 2368
124 Ga0105248_10810892 3300009177 Bacteria 1056
125 Ga0105249_10010979 3300009553 Bacteria 7958
126 Ga0105249_10012552 3300009553 Bacteria 7468
127 Ga0105249_10166754 3300009553 Bacteria 2133
128 Ga0105249_10679925 3300009553 Bacteria 1088
129 Ga0105239_10057873 3300010375 Bacteria 4252
130 Ga0157378_10086198 3300013297 Bacteria 2847
131 Ga0163162_10184125 3300013306 Bacteria 2215
132 Ga0163162_10838626 3300013306 Bacteria 1035
133 Ga0157375_10010060 3300013308 Bacteria 8317
134 Ga0157375_10027300 3300013308 Bacteria 5335
135 Ga0157375_10047816 3300013308 Bacteria 4180
136 Ga0163163_10007093 3300014325 Bacteria 9853
137 Ga0157380_10012373 3300014326 Bacteria 6190
138 Ga0157377_10109307 3300014745 Bacteria 1659
139 Ga0157377_10125349 3300014745 Bacteria 1562
140 Ga0157377_10168686 3300014745 Bacteria 1367
141 Ga0157379_10012339 3300014968 Bacteria 7465
142 Ga0157379_10029029 3300014968 Bacteria 4918
143 Ga0157376_10041544 3300014969 Bacteria 3766
144 Ga0163161_10136432 3300017792 Bacteria 1855
145 Ga0207653_10011378 3300025885 Bacteria 2776
146 Ga0207642_10153799 3300025899 Bacteria 1228
147 Ga0207688_10010872 3300025901 Bacteria 4953
148 Ga0207680_10355575 3300025903 Bacteria 1029
149 Ga0207647_10133585 3300025904 Bacteria 1457
150 Ga0207684_10002573 3300025910 Bacteria 18206
151 Ga0207684_10019102 3300025910 Bacteria 5862
152 Ga0207684_10481848 3300025910 Archaea 1064
153 Ga0207693_10332409 3300025915 Unclassified 1190
154 Ga0207663_10207232 3300025916 Bacteria 1418
155 Ga0207660_10099703 3300025917 Bacteria 2168
156 Ga0207662_10000687 3300025918 Bacteria 15401
157 Ga0207657_10043795 3300025919 Bacteria 3939
158 Ga0207646_10003449 3300025922 Bacteria 17855
159 Ga0207646_10006179 3300025922 Bacteria 12451
160 Ga0207681_10019035 3300025923 Bacteria 4334
161 Ga0207659_10134676 3300025926 Bacteria 1911
162 Ga0207687_10035026 3300025927 Bacteria 3413
163 Ga0207687_10399042 3300025927 Bacteria 1131
164 Ga0207690_10165061 3300025932 Bacteria 1654
165 Ga0207706_10137614 3300025933 Bacteria 2148
166 Ga0207709_10158880 3300025935 Bacteria 1574
167 Ga0207669_10124948 3300025937 Bacteria 1755
168 Ga0207704_10030650 3300025938 Bacteria 3018
169 Ga0207711_10077725 3300025941 Bacteria 2894
170 Ga0207711_10168970 3300025941 Bacteria 1983
171 Ga0207689_10008768 3300025942 Bacteria 8792
172 Ga0207689_10032132 3300025942 Bacteria 4366
173 Ga0207661_10271595 3300025944 Unclassified 1513
174 Ga0207661_10348065 3300025944 Bacteria 1336
175 Ga0207661_10477412 3300025944 Bacteria 1138
176 Ga0207679_10245471 3300025945 Bacteria 1519
177 Ga0207712_10070753 3300025961 Bacteria 2507
178 Ga0207712_10081228 3300025961 Bacteria 2360
179 Ga0207640_10220611 3300025981 Bacteria 1451
180 Ga0207658_10433161 3300025986 Bacteria 1162
181 Ga0207639_10161958 3300026041 Bacteria 1886
182 Ga0207639_10448329 3300026041 Archaea 1171
183 Ga0207678_10085994 3300026067 Bacteria 2687
184 Ga0207678_10185864 3300026067 Bacteria 1775
185 Ga0207708_10001746 3300026075 Bacteria 16058
186 Ga0207641_10273403 3300026088 Bacteria 1586
187 Ga0207648_10018550 3300026089 Bacteria 6297
188 Ga0207676_10386362 3300026095 Bacteria 1304
189 Ga0207676_10969624 3300026095 Unclassified 837
190 Ga0207676_11138849 3300026095 Unclassified 772
191 Ga0207683_10012931 3300026121 Bacteria 7127
192 Ga0268265_10162714 3300028380 Bacteria 1898
193 Ga0268265_10470896 3300028380 Bacteria 1178
194 Ga0268264_10097255 3300028381 Bacteria 2551
195 Ga0268264_10311929 3300028381 Bacteria 1484
196 Ga0265325_10051512 3300031241 Bacteria 2116
197 Ga0307409_100109404 3300031995 Bacteria 2314
198 Ga0373931_0110298 3300035691 Bacteria 1560
199 Ga0436365_1177170 3300039437 Bacteria 1966
200 Ga0451853_0741425 3300041512 Bacteria 1402
201 Ga0450914_013996 3300042118 Unclassified 823
202 Ga0439446_0010207 3300042156 Bacteria 2527
203 Ga0439458_0029341 3300042157 Bacteria 1305
204 Ga0495629_0369624 3300046459 Bacteria 977
205 Ga0495630_0154134 3300046517 Bacteria 1749
206 Ga0495676_0403487 3300047321 Bacteria 907
207 Ga0496101_0180512 3300048904 Bacteria 1625
208 Ga0496101_0390697 3300048904 Bacteria 1095
209 Ga0496102_0145827 3300048905 Bacteria 2222
210 Ga0496102_0186090 3300048905 Bacteria 1957
211 Ga0496102_0195368 3300048905 Bacteria 1907
212 Ga0496102_0284776 3300048905 Bacteria 1558
213 Ga0496102_0329485 3300048905 Bacteria 1438
214 Ga0496103_0150445 3300048906 Bacteria 1491
215 Ga0496103_0377978 3300048906 Bacteria 910
216 Ga0496104_0004813 3300048907 Bacteria 11765
217 Ga0496104_0008542 3300048907 Bacteria 9104
218 Ga0496104_0013733 3300048907 Bacteria 7305
219 Ga0496104_0176002 3300048907 Bacteria 2050
220 Ga0496105_0009236 3300048908 Bacteria 7700
221 Ga0496105_0050219 3300048908 Bacteria 3446
222 Ga0496105_0297604 3300048908 Bacteria 1298
223 Ga0496106_0013022 3300048909 Bacteria 6137
224 Ga0496107_0184139 3300048910 Bacteria 1551
225 Ga0496107_0551284 3300048910 Unclassified 854
226 Ga0496108_0003687 3300048911 Bacteria 12288
227 Ga0496108_0045418 3300048911 Bacteria 3669
228 Ga0496108_0071666 3300048911 Bacteria 2924
229 Ga0496108_0154085 3300048911 Bacteria 1984
230 Ga0496108_0253362 3300048911 Bacteria 1531
231 Ga0496108_0272134 3300048911 Bacteria 1474
232 Ga0496108_0342096 3300048911 Bacteria 1305
233 Ga0496109_0003073 3300048912 Bacteria 13920
234 Ga0496109_0010194 3300048912 Bacteria 8021
235 Ga0496109_0081142 3300048912 Bacteria 2989
236 Ga0496109_0189132 3300048912 Bacteria 1934
237 Ga0496109_0212522 3300048912 Bacteria 1819
238 Ga0496109_0397945 3300048912 Bacteria 1301
239 Ga0496109_0568938 3300048912 Bacteria 1068
240 Ga0496110_0006712 3300048913 Bacteria 9151
241 Ga0496110_0034732 3300048913 Bacteria 4370
242 Ga0496110_0548747 3300048913 Bacteria 1050
243 Ga0496111_0006446 3300048914 Bacteria 7621
244 Ga0496111_0050971 3300048914 Bacteria 2988
245 Ga0496111_0056610 3300048914 Bacteria 2837
246 Ga0496111_0115618 3300048914 Bacteria 1978
247 Ga0496111_0215951 3300048914 Bacteria 1425
248 Ga0496112_0001390 3300048915 Bacteria 18472
249 Ga0496112_0163292 3300048915 Bacteria 2193
250 Ga0496112_0335031 3300048915 Bacteria 1457
251 Ga0496113_0011801 3300048916 Bacteria 5851
252 Ga0496113_0020858 3300048916 Bacteria 4614
253 Ga0496113_0085585 3300048916 Bacteria 2422
254 Ga0496113_0299162 3300048916 Bacteria 1288
255 Ga0501037_0099884 3300049573 Bacteria 2096
256 Ga0501038_0399872 3300049574 Bacteria 1063
257 Ga0501038_0616740 3300049574 Bacteria 819
258 Ga0501039_0226553 3300049575 Bacteria 1469
259 Ga0501039_0405906 3300049575 Bacteria 1070
260 Ga0501040_0031023 3300049576 Bacteria 3612
261 Ga0501040_0160218 3300049576 Bacteria 1590
262 Ga0501041_0080298 3300049577 Bacteria 2008
263 Ga0501042_0058387 3300049578 Bacteria 2754
264 Ga0501042_0196371 3300049578 Bacteria 1455
265 Ga0501046_0055670 3300049580 Bacteria 3107
266 Ga0501048_0143155 3300049582 Bacteria 1690
267 Ga0501048_0317564 3300049582 Bacteria 1109
268 Ga0501067_0031440 3300049583 Bacteria 2945
269 Ga0501067_0042734 3300049583 Bacteria 2516
270 Ga0501068_0028815 3300049584 Bacteria 3286
271 Ga0501068_0078284 3300049584 Bacteria 2026
272 Ga0501068_0299235 3300049584 Unclassified 1030
273 Ga0501069_0043237 3300049585 Bacteria 2493
274 Ga0501070_0243197 3300049586 Bacteria 1473
275 Ga0501071_0050929 3300049587 Bacteria 2983
276 Ga0501072_0025059 3300049588 Bacteria 4644
277 Ga0501072_0029461 3300049588 Bacteria 4289
278 Ga0501072_0115117 3300049588 Bacteria 2141
279 Ga0501072_0270444 3300049588 Bacteria 1352
280 Ga0501072_0275156 3300049588 Bacteria 1339
281 Ga0501074_0142372 3300049590 Unclassified 1715
282 Ga0501074_0161755 3300049590 Bacteria 1599
283 Ga0501074_0255664 3300049590 Bacteria 1246
284 Ga0501075_0058750 3300049591 Bacteria 2896
285 Ga0501076_0005886 3300049592 Bacteria 8845
286 Ga0501076_0018760 3300049592 Bacteria 5280
287 Ga0501076_0026802 3300049592 Bacteria 4467
288 Ga0501076_0097572 3300049592 Bacteria 2367
289 Ga0501077_0077447 3300049593 Bacteria 2106
290 Ga0501077_0092549 3300049593 Bacteria 1916
291 Ga0501079_0052549 3300049741 Bacteria 3144
292 Ga0501079_0239836 3300049741 Bacteria 1416
293 Ga0501079_0340948 3300049741 Bacteria 1174
294 Ga0501081_0030280 3300049743 Bacteria 3663
295 Ga0501081_0032193 3300049743 Bacteria 3556
296 Ga0501083_0171538 3300049744 Bacteria 1418
297 Ga0501083_0337013 3300049744 Unclassified 981
298 Ga0501083_0528121 3300049744 Bacteria 768
299 Ga0501035_0297644 3300049822 Bacteria 1360
300 Ga0501035_0765632 3300049822 Bacteria 774
301 Ga0501045_0010480 3300049824 Bacteria 6493
302 Ga0501045_0023722 3300049824 Bacteria 4401
303 Ga0501045_0099869 3300049824 Bacteria 2148
304 nmdc:mga05p37_13_c1 3300050507 Bacteria 139062
305 nmdc:mga05p37_27029_c1 3300050507 Bacteria 6983
306 nmdc:mga05p37_294594_c1 3300050507 Bacteria 1930
307 nmdc:mga05p37_47070_c1 3300050507 Bacteria 5304
308 nmdc:mga09592_54991_c1 3300050508 Bacteria 3363
309 nmdc:mga06r32_62889_c1 3300050510 Bacteria 3576
310 nmdc:mga08y16_329632_c1 3300050511 Bacteria 1570
311 nmdc:mga08y16_835230_c1 3300050511 Unclassified 912
312 nmdc:mga0a205_321472_c1 3300050515 Unclassified 1418
313 Ga0495612_0000450 3300053078 Bacteria 16446
314 Ga0501084_0017353 3300054114 Bacteria 5982
315 Ga0501084_0045755 3300054114 Bacteria 3663
316 Ga0501084_0094271 3300054114 Bacteria 2513
317 Ga0501084_0178762 3300054114 Bacteria 1791
318 Ga0501082_0028051 3300060353 Bacteria 4850
319 Ga0501082_0197876 3300060353 Bacteria 1748
320 Ga0501082_0398370 3300060353 Unclassified 1201
321 Ga0530510_0158711 3300061734 Bacteria 1672
322 Ga0070708_100002039
323 Ga0070683_100069799
324 Ga0070683_100142316
325 Ga0070683_100985121
326 Ga0070690_100033251
327 Ga0070690_100101186
328 Ga0070670_100131702
329 Ga0068869_100225294
330 Ga0070666_10196539
331 Ga0070680_100233118
332 Ga0070680_100302466
333 Ga0068868_100284014
334 Ga0068868_100390025
335 Ga0068868_100515507
336 Ga0070660_100025781
337 Ga0070689_100075269
338 Ga0070691_10058960
339 Ga0070687_100147665
340 Ga0070687_100471237
341 Ga0070661_100151734
342 Ga0070692_10003822
343 Ga0070675_100105546
344 Ga0070674_100495714
345 Ga0070673_100463086
346 Ga0070659_100243255
347 Ga0070667_100076270
348 Ga0070703_10010826
349 Ga0070701_10107426
350 Ga0070705_100112883
351 Ga0070705_100143461
352 Ga0070705_100716798
353 Ga0070700_100184718
354 Ga0070694_100001130
355 Ga0070694_100066003
356 Ga0070694_100147917
357 Ga0070708_100202974
358 Ga0070663_100139320
359 Ga0070662_100799672
360 Ga0068867_100725118
361 Ga0070706_100002573
362 Ga0070706_100007856
363 Ga0070706_100621198
364 Ga0070707_100002692
365 Ga0070698_100009990
366 Ga0070698_100078468
367 Ga0070698_100814999
368 Ga0070699_100102723
369 Ga0070699_100443717
370 Ga0070684_100027314
371 Ga0070684_100293329
372 Ga0070697_100470351
373 Ga0068853_100204668
374 Ga0068853_100386820
375 Ga0068853_101025374
376 Ga0070686_100038845
377 Ga0070686_100139395
378 Ga0070695_100010212
379 Ga0070695_100019768
380 Ga0070695_100069960
381 Ga0070695_100095533
382 Ga0070696_100005667
383 Ga0070696_100006192
384 Ga0070696_100047643
385 Ga0070696_100149515
386 Ga0070693_100008950
387 Ga0070693_100217180
388 Ga0070704_100004920
389 Ga0070704_100073696
390 Ga0070704_100395590
391 Ga0070664_100023904
392 Ga0070664_100246418
393 Ga0070664_100415913
394 Ga0068854_100218207
395 Ga0068856_100543980
396 Ga0070702_100117297
397 Ga0068852_100282483
398 Ga0068852_100664919
399 Ga0068859_100008208
400 Ga0068859_100065076
401 Ga0068864_100096064
402 Ga0068864_100172366
403 Ga0068864_100484611
404 Ga0068863_100167201
405 Ga0068858_100273401
406 Ga0068858_100501056
407 Ga0068860_100015308
408 Ga0068860_100024499
409 Ga0081455_10195922
410 Ga0075365_10091614
411 Ga0070712_100289069
412 Ga0070712_100421873
413 Ga0068871_100322999
414 Ga0075428_100151175
415 Ga0075428_100508609
416 Ga0075431_100371579
417 Ga0075433_10023679
418 Ga0075433_10087323
419 Ga0075433_10250990
420 Ga0075434_100645233
421 Ga0075429_100041036
422 Ga0068865_100055756
423 Ga0097620_100008208
424 Ga0097620_100065077
425 Ga0097620_100318299
426 Ga0075435_100102551
427 Ga0111539_10387535
428 Ga0111539_10689870
429 Ga0105245_10019254
430 Ga0105245_10066405
431 Ga0105245_10308866
432 Ga0105245_10334675
433 Ga0105245_10583009
434 Ga0105247_10113767
435 Ga0105247_10409491
436 Ga0114129_10015193
437 Ga0114129_10053856
438 Ga0114129_10184413
439 Ga0105243_10008875
440 Ga0105243_10891618
441 Ga0105243_11286657
442 Ga0105242_10004638
443 Ga0105242_11041401
444 Ga0105248_10181944
445 Ga0105248_10810892
446 Ga0105249_10010979
447 Ga0105249_10012552
448 Ga0105249_10166754
449 Ga0105249_10679925
450 Ga0105239_10057873
451 Ga0157378_10086198
452 Ga0163162_10184125
453 Ga0163162_10838626
454 Ga0157375_10010060
455 Ga0157375_10027300
456 Ga0157375_10047816
457 Ga0163163_10007093
458 Ga0157380_10012373
459 Ga0157377_10109307
460 Ga0157377_10125349
461 Ga0157377_10168686
462 Ga0157379_10012339
463 Ga0157379_10029029
464 Ga0157376_10041544
465 Ga0163161_10136432
466 Ga0207653_10011378
467 Ga0207642_10153799
468 Ga0207688_10010872
469 Ga0207680_10355575
470 Ga0207647_10133585
471 Ga0207684_10002573
472 Ga0207684_10019102
473 Ga0207684_10481848
474 Ga0207693_10332409
475 Ga0207663_10207232
476 Ga0207660_10099703
477 Ga0207662_10000687
478 Ga0207657_10043795
479 Ga0207646_10003449
480 Ga0207646_10006179
481 Ga0207681_10019035
482 Ga0207659_10134676
483 Ga0207687_10035026
484 Ga0207687_10399042
485 Ga0207690_10165061
486 Ga0207706_10137614
487 Ga0207709_10158880
488 Ga0207669_10124948
489 Ga0207704_10030650
490 Ga0207711_10077725
491 Ga0207711_10168970
492 Ga0207689_10008768
493 Ga0207689_10032132
494 Ga0207661_10271595
495 Ga0207661_10348065
496 Ga0207661_10477412
497 Ga0207679_10245471
498 Ga0207712_10070753
499 Ga0207712_10081228
500 Ga0207640_10220611
501 Ga0207658_10433161
502 Ga0207639_10161958
503 Ga0207639_10448329
504 Ga0207678_10085994
505 Ga0207678_10185864
506 Ga0207708_10001746
507 Ga0207641_10273403
508 Ga0207648_10018550
509 Ga0207676_10386362
510 Ga0207676_10969624
511 Ga0207676_11138849
512 Ga0207683_10012931
513 Ga0268265_10162714
514 Ga0268265_10470896
515 Ga0268264_10097255
516 Ga0268264_10311929
517 Ga0265325_10051512
518 Ga0307409_100109404
519 Ga0373931_0110298
520 Ga0436365_1177170
521 Ga0451853_0741425
522 Ga0450914_013996
523 Ga0439446_0010207
524 Ga0439458_0029341
525 Ga0495629_0369624
526 Ga0495630_0154134
527 Ga0495676_0403487
528 Ga0496101_0180512
529 Ga0496101_0390697
530 Ga0496102_0145827
531 Ga0496102_0186090
532 Ga0496102_0195368
533 Ga0496102_0284776
534 Ga0496102_0329485
535 Ga0496103_0150445
536 Ga0496103_0377978
537 Ga0496104_0004813
538 Ga0496104_0008542
539 Ga0496104_0013733
540 Ga0496104_0176002
541 Ga0496105_0009236
542 Ga0496105_0050219
543 Ga0496105_0297604
544 Ga0496106_0013022
545 Ga0496107_0184139
546 Ga0496107_0551284
547 Ga0496108_0003687
548 Ga0496108_0045418
549 Ga0496108_0071666
550 Ga0496108_0154085
551 Ga0496108_0253362
552 Ga0496108_0272134
553 Ga0496108_0342096
554 Ga0496109_0003073
555 Ga0496109_0010194
556 Ga0496109_0081142
557 Ga0496109_0189132
558 Ga0496109_0212522
559 Ga0496109_0397945
560 Ga0496109_0568938
561 Ga0496110_0006712
562 Ga0496110_0034732
563 Ga0496110_0548747
564 Ga0496111_0006446
565 Ga0496111_0050971
566 Ga0496111_0056610
567 Ga0496111_0115618
568 Ga0496111_0215951
569 Ga0496112_0001390
570 Ga0496112_0163292
571 Ga0496112_0335031
572 Ga0496113_0011801
573 Ga0496113_0020858
574 Ga0496113_0085585
575 Ga0496113_0299162
576 Ga0501037_0099884
577 Ga0501038_0399872
578 Ga0501038_0616740
579 Ga0501039_0226553
580 Ga0501039_0405906
581 Ga0501040_0031023
582 Ga0501040_0160218
583 Ga0501041_0080298
584 Ga0501042_0058387
585 Ga0501042_0196371
586 Ga0501046_0055670
587 Ga0501048_0143155
588 Ga0501048_0317564
589 Ga0501067_0031440
590 Ga0501067_0042734
591 Ga0501068_0028815
592 Ga0501068_0078284
593 Ga0501068_0299235
594 Ga0501069_0043237
595 Ga0501070_0243197
596 Ga0501071_0050929
597 Ga0501072_0025059
598 Ga0501072_0029461
599 Ga0501072_0115117
600 Ga0501072_0270444
601 Ga0501072_0275156
602 Ga0501074_0142372
603 Ga0501074_0161755
604 Ga0501074_0255664
605 Ga0501075_0058750
606 Ga0501076_0005886
607 Ga0501076_0018760
608 Ga0501076_0026802
609 Ga0501076_0097572
610 Ga0501077_0077447
611 Ga0501077_0092549
612 Ga0501079_0052549
613 Ga0501079_0239836
614 Ga0501079_0340948
615 Ga0501081_0030280
616 Ga0501081_0032193
617 Ga0501083_0171538
618 Ga0501083_0337013
619 Ga0501083_0528121
620 Ga0501035_0297644
621 Ga0501035_0765632
622 Ga0501045_0010480
623 Ga0501045_0023722
624 Ga0501045_0099869
625 nmdc:mga05p37_13_c1
626 nmdc:mga05p37_27029_c1
627 nmdc:mga05p37_294594_c1
628 nmdc:mga05p37_47070_c1
629 nmdc:mga09592_54991_c1
630 nmdc:mga06r32_62889_c1
631 nmdc:mga08y16_329632_c1
632 nmdc:mga08y16_835230_c1
633 nmdc:mga0a205_321472_c1
634 Ga0495612_0000450
635 Ga0501084_0017353
636 Ga0501084_0045755
637 Ga0501084_0094271
638 Ga0501084_0178762
639 Ga0501082_0028051
640 Ga0501082_0197876
641 Ga0501082_0398370
642 Ga0530510_0158711

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bwt-assembly1.cif.gz_C 2.45 angstrom resolution crystal structure thioredoxin reductase from francisella tularensis. 0.7684 30 62
3dlc-assembly1.cif.gz_A crystal structure of a putative s-adenosyl-l-methionine-dependent methyltransferase (mmp1179) from methanococcus maripaludis at 1.15 a resolution 0.686 5 109
7cpx-assembly1.cif.gz_A lovastatin nonaketide synthase 0.6815 23 110
4hg2-assembly1.cif.gz_A the structure of a putative type ii methyltransferase from anaeromyxobacter dehalogenans. 0.6473 20 194
6de8-assembly1.cif.gz_A crystal structure of bifunctional enzyme fold-methylenetetrahydrofolate dehydrogenase/cyclohydrolase from campylobacter jejuni 0.5975 19 81
ID Description Score Start End Superfamily
af_Q54ZX6_3_276_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7718 71 115 3.40.50.150
af_P49326_179_277_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.741 30 57 3.50.50.60
af_A0A1D6K4G6_220_423_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6729 18 113 3.40.50.150
af_Q7ZVJ8_3_201_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6656 17 114 3.40.50.150
af_P9WK01_14_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6632 21 121 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1F8S8R9-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9585 1 199
AF-A0A0T5ZCG4-F1-model_v4 Class I SAM-dependent methyltransferase 0.8901 1 194
AF-A0A536ND78-F1-model_v4 Class I SAM-dependent methyltransferase 0.8891 1 202 GO:0008757
GO:0032259
AF-A0A536ND78-F1-model_v4 Class I SAM-dependent methyltransferase 0.8807 1 202 GO:0008757
GO:0032259
AF-A0A535PCV1-F1-model_v4 Methyltransferase domain-containing protein 0.862 1 203 GO:0008757
GO:0032259

Map