F405727

General Info

Members Datasets Scaffolds Average Seq Length
320 187 640 205

Family's Representative Sequence

Representative Sequence 3300049582|Ga0501048_0281152|Ga0501048_0281152_187_864
Length 225
Sequence MPTGAAAVTVRTMKRFLAALAVLTGLGAAYARRLREPILTWGATAEEAAARLPGDELLEDADGVATRAITVDAPASAVWPWLAQMGPSPRGGAYTYDWIENLLRLDMHSVDRVLPEFQHPRLGEGFGFGENQMRYALVHPEHVLALRSRNGNWVWSFVLREEDGHTRLISRNRFRLPRLRDRLGMLPMEPGSLVMERKMLRGIKERAERLAAERPAEAPRYQRRG

Samples

Sample ID Description Type Environment
1 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
117 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 15
Rhizosphere 84.38
Stem 0
Stem Tuber 0
Unclassified 3.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501048_0281152 3300049582 Bacteria 1183
2 Ga0070676_10142971 3300005328 Bacteria 1525
3 Ga0070683_100011821 3300005329 Bacteria 7562
4 Ga0070683_100089736 3300005329 Bacteria 2885
5 Ga0070683_100151588 3300005329 Bacteria 2198
6 Ga0068869_100582677 3300005334 Unclassified 943
7 Ga0070680_100020067 3300005336 Bacteria 5300
8 Ga0070680_100303297 3300005336 Bacteria 1354
9 Ga0070680_100676725 3300005336 Bacteria 887
10 Ga0070682_100005842 3300005337 Bacteria 6874
11 Ga0070682_100195950 3300005337 Bacteria 1422
12 Ga0070682_100833587 3300005337 Bacteria 752
13 Ga0070660_100109141 3300005339 Bacteria 2200
14 Ga0070661_100027163 3300005344 Bacteria 4119
15 Ga0070669_100055078 3300005353 Bacteria 2914
16 Ga0070675_100052944 3300005354 Bacteria 3338
17 Ga0070675_100627080 3300005354 Bacteria 976
18 Ga0070714_100007848 3300005435 Bacteria 8313
19 Ga0070714_100022837 3300005435 Bacteria 5133
20 Ga0070714_100437678 3300005435 Bacteria 1240
21 Ga0070713_100251660 3300005436 Bacteria 1611
22 Ga0070713_100637998 3300005436 Unclassified 1014
23 Ga0070710_10028766 3300005437 Bacteria 2975
24 Ga0070710_10088487 3300005437 Bacteria 1822
25 Ga0070711_100672884 3300005439 Bacteria 869
26 Ga0070705_100562727 3300005440 Bacteria 876
27 Ga0070694_100050472 3300005444 Bacteria 2805
28 Ga0070678_100142670 3300005456 Bacteria 1919
29 Ga0070678_100265856 3300005456 Bacteria 1444
30 Ga0070662_100013263 3300005457 Bacteria 5480
31 Ga0070681_10052312 3300005458 Bacteria 4072
32 Ga0070681_10062064 3300005458 Bacteria 3711
33 Ga0070681_10749028 3300005458 Bacteria 893
34 Ga0070681_10766410 3300005458 Unclassified 881
35 Ga0070681_10990009 3300005458 Bacteria 760
36 Ga0068867_100058020 3300005459 Bacteria 2868
37 Ga0070679_100015071 3300005530 Bacteria 7429
38 Ga0070679_100788334 3300005530 Bacteria 893
39 Ga0070684_100076709 3300005535 Bacteria 2950
40 Ga0070684_100098436 3300005535 Bacteria 2609
41 Ga0070686_100458090 3300005544 Bacteria 982
42 Ga0070693_100028359 3300005547 Bacteria 3043
43 Ga0070693_100090172 3300005547 Bacteria 1846
44 Ga0070704_100203254 3300005549 Bacteria 1601
45 Ga0070664_100008179 3300005564 Bacteria 8456
46 Ga0070664_100204849 3300005564 Bacteria 1761
47 Ga0070664_100985463 3300005564 Bacteria 792
48 Ga0068857_100009512 3300005577 Bacteria 8439
49 Ga0068857_100340048 3300005577 Bacteria 1388
50 Ga0068857_100520403 3300005577 Bacteria 1118
51 Ga0068854_100653661 3300005578 Bacteria 903
52 Ga0068856_100023964 3300005614 Bacteria 5936
53 Ga0070702_100087514 3300005615 Bacteria 1882
54 Ga0068852_100363619 3300005616 Bacteria 1416
55 Ga0068852_100496955 3300005616 Bacteria 1214
56 Ga0068859_100234609 3300005617 Bacteria 1923
57 Ga0068861_100155081 3300005719 Bacteria 1883
58 Ga0068858_100128218 3300005842 Bacteria 2378
59 Ga0068862_100505453 3300005844 Bacteria 1148
60 Ga0070717_10031334 3300006028 Bacteria 4277
61 Ga0070717_10076547 3300006028 Bacteria 2801
62 Ga0070717_10435271 3300006028 Bacteria 1181
63 Ga0070712_100145356 3300006175 Bacteria 1814
64 Ga0068871_100296672 3300006358 Bacteria 1418
65 Ga0075431_100421654 3300006847 Bacteria 1334
66 Ga0075434_100467639 3300006871 Bacteria 1282
67 Ga0075429_100297865 3300006880 Bacteria 1412
68 Ga0068865_100172347 3300006881 Bacteria 1660
69 Ga0097620_100234611 3300006931 Bacteria 1923
70 Ga0111539_10000449 3300009094 Bacteria 51659
71 Ga0105245_10013563 3300009098 Bacteria 7098
72 Ga0105245_10015293 3300009098 Bacteria 6687
73 Ga0105245_10440801 3300009098 Bacteria 1309
74 Ga0114129_10158007 3300009147 Bacteria 3099
75 Ga0105243_10042065 3300009148 Bacteria 3576
76 Ga0105241_10020476 3300009174 Bacteria 4886
77 Ga0105241_10740935 3300009174 Bacteria 900
78 Ga0105242_10008934 3300009176 Bacteria 7692
79 Ga0105242_10549684 3300009176 Unclassified 1107
80 Ga0105248_11512634 3300009177 Bacteria 760
81 Ga0105237_10204194 3300009545 Bacteria 1976
82 Ga0105237_10865308 3300009545 Bacteria 911
83 Ga0105238_10560748 3300009551 Bacteria 1147
84 Ga0105238_11043795 3300009551 Bacteria 839
85 Ga0105239_10104614 3300010375 Bacteria 3134
86 Ga0105239_10197418 3300010375 Bacteria 2253
87 Ga0157373_10119845 3300013100 Bacteria 1849
88 Ga0157371_10107608 3300013102 Bacteria 1979
89 Ga0157370_11078869 3300013104 Bacteria 726
90 Ga0157369_10076067 3300013105 Bacteria 3599
91 Ga0157372_10027057 3300013307 Bacteria 6243
92 Ga0157372_10539220 3300013307 Bacteria 1360
93 Ga0157372_11817895 3300013307 Bacteria 701
94 Ga0157375_10654766 3300013308 Bacteria 1206
95 Ga0182008_10016340 3300014497 Bacteria 3857
96 Ga0182008_10026428 3300014497 Bacteria 2944
97 Ga0157377_10112144 3300014745 Bacteria 1641
98 Ga0157377_10132530 3300014745 Bacteria 1524
99 Ga0157379_10932757 3300014968 Bacteria 825
100 Ga0157376_10452072 3300014969 Bacteria 1253
101 Ga0182007_10048962 3300015262 Bacteria 1396
102 Ga0206350_11313306 3300020080 Bacteria 805
103 Ga0224712_10055140 3300022467 Bacteria 1563
104 Ga0207692_10016891 3300025898 Bacteria 3243
105 Ga0207692_10228709 3300025898 Bacteria 1106
106 Ga0207688_10027741 3300025901 Bacteria 3114
107 Ga0207699_10144112 3300025906 Bacteria 1569
108 Ga0207654_10178189 3300025911 Bacteria 1385
109 Ga0207707_10330934 3300025912 Bacteria 1314
110 Ga0207707_10342413 3300025912 Unclassified 1289
111 Ga0207707_10434593 3300025912 Bacteria 1124
112 Ga0207693_10171259 3300025915 Bacteria 1709
113 Ga0207663_10013347 3300025916 Bacteria 4463
114 Ga0207663_10064251 3300025916 Bacteria 2341
115 Ga0207660_10063189 3300025917 Bacteria 2669
116 Ga0207660_10317104 3300025917 Bacteria 1244
117 Ga0207660_10716650 3300025917 Bacteria 816
118 Ga0207657_10137924 3300025919 Bacteria 1995
119 Ga0207649_10297401 3300025920 Bacteria 1179
120 Ga0207652_10162002 3300025921 Bacteria 2005
121 Ga0207652_10223525 3300025921 Bacteria 1696
122 Ga0207652_10757433 3300025921 Bacteria 864
123 Ga0207659_10113026 3300025926 Bacteria 2067
124 Ga0207687_10335334 3300025927 Bacteria 1228
125 Ga0207687_10528426 3300025927 Bacteria 987
126 Ga0207700_10201506 3300025928 Unclassified 1677
127 Ga0207664_10000742 3300025929 Bacteria 22181
128 Ga0207664_10030945 3300025929 Bacteria 4091
129 Ga0207664_10153497 3300025929 Bacteria 1958
130 Ga0207706_10037028 3300025933 Bacteria 4333
131 Ga0207686_10412794 3300025934 Unclassified 1031
132 Ga0207709_10880842 3300025935 Bacteria 727
133 Ga0207665_10446440 3300025939 Bacteria 992
134 Ga0207661_10775879 3300025944 Bacteria 882
135 Ga0207679_10157862 3300025945 Bacteria 1854
136 Ga0207668_10049994 3300025972 Bacteria 2878
137 Ga0207640_10197235 3300025981 Bacteria 1522
138 Ga0207703_10123919 3300026035 Bacteria 2222
139 Ga0207678_10289597 3300026067 Bacteria 1406
140 Ga0207708_10017557 3300026075 Bacteria 5386
141 Ga0207702_10049838 3300026078 Bacteria 3534
142 Ga0207702_10053471 3300026078 Bacteria 3418
143 Ga0207641_10210147 3300026088 Bacteria 1799
144 Ga0207674_10086568 3300026116 Bacteria 3128
145 Ga0207675_100145310 3300026118 Bacteria 2255
146 Ga0207683_10162156 3300026121 Bacteria 2022
147 Ga0207683_10233439 3300026121 Bacteria 1678
148 Ga0207428_10004703 3300027907 Bacteria 12918
149 Ga0207428_10043725 3300027907 Bacteria 3617
150 Ga0265318_10069837 3300028577 Bacteria 1302
151 Ga0307416_100454833 3300032002 Bacteria 1334
152 Ga0373941_0100110 3300035115 Bacteria 1008
153 Ga0373945_0061148 3300035116 Bacteria 1406
154 Ga0373943_0334379 3300035170 Bacteria 865
155 Ga0373946_0250005 3300035171 Bacteria 864
156 Ga0373955_0059088 3300035172 Bacteria 2111
157 Ga0373924_0078924 3300035410 Bacteria 1398
158 Ga0373935_0085628 3300035692 Unclassified 2055
159 Ga0373947_0002898 3300035725 Bacteria 10246
160 Ga0373947_0076908 3300035725 Unclassified 2058
161 Ga0373947_0133826 3300035725 Bacteria 1585
162 Ga0373925_0000592 3300037068 Bacteria 34869
163 Ga0395899_0006857 3300037312 Bacteria 8823
164 Ga0395899_0007569 3300037312 Bacteria 8380
165 Ga0395899_0039764 3300037312 Bacteria 3519
166 Ga0395900_0006383 3300037418 Bacteria 12293
167 Ga0395900_0009163 3300037418 Bacteria 10142
168 Ga0395900_0018573 3300037418 Bacteria 7091
169 Ga0395898_0015317 3300037466 Bacteria 7865
170 Ga0395898_0079029 3300037466 Bacteria 3173
171 Ga0395898_0356865 3300037466 Bacteria 1394
172 Ga0395905_0003925 3300037471 Bacteria 15644
173 Ga0395905_0069933 3300037471 Bacteria 3288
174 Ga0395905_0111383 3300037471 Bacteria 2570
175 Ga0395905_0503648 3300037471 Bacteria 1111
176 Ga0395901_0027118 3300038443 Bacteria 5883
177 Ga0395901_0070788 3300038443 Bacteria 3634
178 Ga0436363_0984092 3300039450 Bacteria 1383
179 Ga0450906_054241 3300042145 Bacteria 709
180 Ga0450918_018446 3300042531 Bacteria 1217
181 Ga0466963_0000683 3300044694 Bacteria 16485
182 Ga0466957_0117584 3300044842 Bacteria 1692
183 Ga0451576_0009850 3300045051 Bacteria 11042
184 Ga0466967_0013497 3300045976 Bacteria 6316
185 Ga0495592_0073279 3300046454 Bacteria 2490
186 Ga0495603_0000523 3300046455 Bacteria 21326
187 Ga0495641_0005787 3300046461 Bacteria 8207
188 Ga0495641_0212074 3300046461 Bacteria 868
189 Ga0495653_0651923 3300046463 Bacteria 643
190 Ga0495582_0266153 3300046473 Bacteria 983
191 Ga0495664_0053223 3300046477 Bacteria 2407
192 Ga0495594_0000753 3300046499 Bacteria 16608
193 Ga0495594_0070382 3300046499 Bacteria 1945
194 Ga0495628_0213393 3300046516 Bacteria 1451
195 Ga0495630_0196800 3300046517 Bacteria 1538
196 Ga0495666_0151298 3300046526 Bacteria 1079
197 Ga0495666_0369597 3300046526 Bacteria 645
198 Ga0495652_0208300 3300046529 Bacteria 1478
199 Ga0495652_0220930 3300046529 Bacteria 1424
200 Ga0495665_0288843 3300046531 Bacteria 841
201 Ga0495587_0115616 3300046536 Bacteria 1539
202 Ga0495645_0431644 3300046543 Bacteria 834
203 Ga0495588_0015583 3300046674 Bacteria 3662
204 Ga0495599_0318695 3300046678 Bacteria 936
205 Ga0495599_0457494 3300046678 Bacteria 755
206 Ga0495647_0003403 3300046681 Bacteria 5092
207 Ga0495647_0030883 3300046681 Bacteria 1990
208 Ga0495647_0035738 3300046681 Bacteria 1867
209 Ga0495581_0000604 3300047315 Bacteria 18816
210 Ga0495676_0005187 3300047321 Bacteria 11921
211 Ga0495676_0040507 3300047321 Bacteria 3844
212 Ga0495676_0244242 3300047321 Bacteria 1228
213 Ga0496100_0005632 3300048903 Bacteria 6770
214 Ga0496100_0012167 3300048903 Bacteria 4923
215 Ga0496100_0045174 3300048903 Bacteria 2826
216 Ga0496101_0097360 3300048904 Bacteria 2197
217 Ga0496101_0127116 3300048904 Bacteria 1932
218 Ga0496101_0478420 3300048904 Bacteria 983
219 Ga0496102_0041563 3300048905 Bacteria 4163
220 Ga0496102_0183493 3300048905 Bacteria 1971
221 Ga0496102_0525870 3300048905 Bacteria 1105
222 Ga0496103_0154084 3300048906 Bacteria 1472
223 Ga0496103_0287965 3300048906 Bacteria 1057
224 Ga0496104_0030059 3300048907 Bacteria 5045
225 Ga0496104_0228606 3300048907 Bacteria 1772
226 Ga0496104_0265174 3300048907 Unclassified 1630
227 Ga0496105_0025579 3300048908 Bacteria 4807
228 Ga0496105_0033426 3300048908 Bacteria 4223
229 Ga0496106_0148085 3300048909 Bacteria 1850
230 Ga0496107_0095795 3300048910 Bacteria 2171
231 Ga0496107_0195017 3300048910 Bacteria 1505
232 Ga0496107_0244471 3300048910 Bacteria 1335
233 Ga0496107_0519329 3300048910 Bacteria 883
234 Ga0496108_0011668 3300048911 Bacteria 7150
235 Ga0496108_0037284 3300048911 Bacteria 4048
236 Ga0496108_0094792 3300048911 Bacteria 2541
237 Ga0496108_0295248 3300048911 Bacteria 1411
238 Ga0496108_0497574 3300048911 Bacteria 1065
239 Ga0496109_0001074 3300048912 Bacteria 22668
240 Ga0496109_0110991 3300048912 Unclassified 2550
241 Ga0496109_0292392 3300048912 Bacteria 1536
242 Ga0496110_0000072 3300048913 Bacteria 51313
243 Ga0496110_0004031 3300048913 Bacteria 11329
244 Ga0496110_0053158 3300048913 Bacteria 3560
245 Ga0496110_0093539 3300048913 Bacteria 2691
246 Ga0496110_0164922 3300048913 Bacteria 2009
247 Ga0496110_0437560 3300048913 Bacteria 1192
248 Ga0496111_0001214 3300048914 Bacteria 14399
249 Ga0496111_0047674 3300048914 Bacteria 3086
250 Ga0496111_0060490 3300048914 Bacteria 2745
251 Ga0496112_0035989 3300048915 Bacteria 4826
252 Ga0496112_0134704 3300048915 Bacteria 2441
253 Ga0496112_0273274 3300048915 Bacteria 1638
254 Ga0496113_0072492 3300048916 Bacteria 2621
255 Ga0496114_0017409 3300048917 Bacteria 5800
256 Ga0496114_0060690 3300048917 Bacteria 3161
257 Ga0496114_0283622 3300048917 Bacteria 1460
258 Ga0496114_0439535 3300048917 Bacteria 1155
259 Ga0496115_0020264 3300048918 Bacteria 5128
260 Ga0496115_0036588 3300048918 Bacteria 3888
261 Ga0501031_0320362 3300049568 Bacteria 1004
262 Ga0501036_0091018 3300049572 Bacteria 2577
263 Ga0501036_0162152 3300049572 Bacteria 1885
264 Ga0501037_0486906 3300049573 Bacteria 838
265 Ga0501038_0229561 3300049574 Bacteria 1478
266 Ga0501038_0249901 3300049574 Bacteria 1405
267 Ga0501039_0041820 3300049575 Bacteria 3541
268 Ga0501039_0326913 3300049575 Bacteria 1205
269 Ga0501040_0007840 3300049576 Bacteria 6920
270 Ga0501040_0054867 3300049576 Bacteria 2732
271 Ga0501040_0196663 3300049576 Bacteria 1431
272 Ga0501040_0237243 3300049576 Bacteria 1299
273 Ga0501041_0076260 3300049577 Bacteria 2062
274 Ga0501041_0157452 3300049577 Bacteria 1419
275 Ga0501042_0118349 3300049578 Bacteria 1907
276 Ga0501042_0119452 3300049578 Bacteria 1897
277 Ga0501043_0335552 3300049579 Bacteria 1151
278 Ga0501046_0130880 3300049580 Bacteria 1903
279 Ga0501048_0088076 3300049582 Bacteria 2190
280 Ga0501067_0005277 3300049583 Bacteria 7178
281 Ga0501067_0042463 3300049583 Bacteria 2525
282 Ga0501068_0050457 3300049584 Bacteria 2515
283 Ga0501069_0039259 3300049585 Bacteria 2615
284 Ga0501070_0293474 3300049586 Bacteria 1325
285 Ga0501071_0043509 3300049587 Bacteria 3220
286 Ga0501072_0115503 3300049588 Bacteria 2137
287 Ga0501074_0110120 3300049590 Bacteria 1970
288 Ga0501074_0728500 3300049590 Bacteria 699
289 Ga0501075_0084407 3300049591 Bacteria 2405
290 Ga0501076_0027257 3300049592 Bacteria 4431
291 Ga0501076_0171222 3300049592 Bacteria 1770
292 Ga0501076_0231840 3300049592 Bacteria 1509
293 Ga0501076_0262414 3300049592 Bacteria 1414
294 Ga0501076_0609099 3300049592 Bacteria 901
295 Ga0501077_0052577 3300049593 Bacteria 2586
296 Ga0501077_0052884 3300049593 Bacteria 2578
297 Ga0501077_0053303 3300049593 Bacteria 2568
298 Ga0501079_0016642 3300049741 Bacteria 5616
299 Ga0501079_0166057 3300049741 Bacteria 1722
300 Ga0501079_0293522 3300049741 Bacteria 1271
301 Ga0501079_0720049 3300049741 Bacteria 785
302 Ga0501080_0019637 3300049742 Bacteria 6260
303 Ga0501080_0591852 3300049742 Bacteria 985
304 Ga0501081_0075567 3300049743 Bacteria 2352
305 Ga0501081_0141468 3300049743 Bacteria 1724
306 Ga0501081_0157526 3300049743 Bacteria 1634
307 Ga0501081_0500308 3300049743 Bacteria 906
308 Ga0501045_0017516 3300049824 Bacteria 5087
309 Ga0501045_0075968 3300049824 Bacteria 2474
310 Ga0501045_0575084 3300049824 Bacteria 835
311 nmdc:mga03n38_397308_c1 3300050490 Bacteria 758
312 nmdc:mga05p37_39275_c2 3300050507 Bacteria 3074
313 nmdc:mga08y16_44828_c1 3300050511 Bacteria 4636
314 nmdc:mga08y16_99744_c1 3300050511 Bacteria 3024
315 nmdc:mga0n895_846794_c1 3300050512 Bacteria 902
316 Ga0495601_0285290 3300053077 Bacteria 1076
317 Ga0501084_0146847 3300054114 Bacteria 1986
318 Ga0501084_0746416 3300054114 Bacteria 825
319 Ga0501082_0020075 3300060353 Bacteria 5759
320 Ga0501082_0444227 3300060353 Unclassified 1133
321 Ga0501048_0281152
322 Ga0070676_10142971
323 Ga0070683_100011821
324 Ga0070683_100089736
325 Ga0070683_100151588
326 Ga0068869_100582677
327 Ga0070680_100020067
328 Ga0070680_100303297
329 Ga0070680_100676725
330 Ga0070682_100005842
331 Ga0070682_100195950
332 Ga0070682_100833587
333 Ga0070660_100109141
334 Ga0070661_100027163
335 Ga0070669_100055078
336 Ga0070675_100052944
337 Ga0070675_100627080
338 Ga0070714_100007848
339 Ga0070714_100022837
340 Ga0070714_100437678
341 Ga0070713_100251660
342 Ga0070713_100637998
343 Ga0070710_10028766
344 Ga0070710_10088487
345 Ga0070711_100672884
346 Ga0070705_100562727
347 Ga0070694_100050472
348 Ga0070678_100142670
349 Ga0070678_100265856
350 Ga0070662_100013263
351 Ga0070681_10052312
352 Ga0070681_10062064
353 Ga0070681_10749028
354 Ga0070681_10766410
355 Ga0070681_10990009
356 Ga0068867_100058020
357 Ga0070679_100015071
358 Ga0070679_100788334
359 Ga0070684_100076709
360 Ga0070684_100098436
361 Ga0070686_100458090
362 Ga0070693_100028359
363 Ga0070693_100090172
364 Ga0070704_100203254
365 Ga0070664_100008179
366 Ga0070664_100204849
367 Ga0070664_100985463
368 Ga0068857_100009512
369 Ga0068857_100340048
370 Ga0068857_100520403
371 Ga0068854_100653661
372 Ga0068856_100023964
373 Ga0070702_100087514
374 Ga0068852_100363619
375 Ga0068852_100496955
376 Ga0068859_100234609
377 Ga0068861_100155081
378 Ga0068858_100128218
379 Ga0068862_100505453
380 Ga0070717_10031334
381 Ga0070717_10076547
382 Ga0070717_10435271
383 Ga0070712_100145356
384 Ga0068871_100296672
385 Ga0075431_100421654
386 Ga0075434_100467639
387 Ga0075429_100297865
388 Ga0068865_100172347
389 Ga0097620_100234611
390 Ga0111539_10000449
391 Ga0105245_10013563
392 Ga0105245_10015293
393 Ga0105245_10440801
394 Ga0114129_10158007
395 Ga0105243_10042065
396 Ga0105241_10020476
397 Ga0105241_10740935
398 Ga0105242_10008934
399 Ga0105242_10549684
400 Ga0105248_11512634
401 Ga0105237_10204194
402 Ga0105237_10865308
403 Ga0105238_10560748
404 Ga0105238_11043795
405 Ga0105239_10104614
406 Ga0105239_10197418
407 Ga0157373_10119845
408 Ga0157371_10107608
409 Ga0157370_11078869
410 Ga0157369_10076067
411 Ga0157372_10027057
412 Ga0157372_10539220
413 Ga0157372_11817895
414 Ga0157375_10654766
415 Ga0182008_10016340
416 Ga0182008_10026428
417 Ga0157377_10112144
418 Ga0157377_10132530
419 Ga0157379_10932757
420 Ga0157376_10452072
421 Ga0182007_10048962
422 Ga0206350_11313306
423 Ga0224712_10055140
424 Ga0207692_10016891
425 Ga0207692_10228709
426 Ga0207688_10027741
427 Ga0207699_10144112
428 Ga0207654_10178189
429 Ga0207707_10330934
430 Ga0207707_10342413
431 Ga0207707_10434593
432 Ga0207693_10171259
433 Ga0207663_10013347
434 Ga0207663_10064251
435 Ga0207660_10063189
436 Ga0207660_10317104
437 Ga0207660_10716650
438 Ga0207657_10137924
439 Ga0207649_10297401
440 Ga0207652_10162002
441 Ga0207652_10223525
442 Ga0207652_10757433
443 Ga0207659_10113026
444 Ga0207687_10335334
445 Ga0207687_10528426
446 Ga0207700_10201506
447 Ga0207664_10000742
448 Ga0207664_10030945
449 Ga0207664_10153497
450 Ga0207706_10037028
451 Ga0207686_10412794
452 Ga0207709_10880842
453 Ga0207665_10446440
454 Ga0207661_10775879
455 Ga0207679_10157862
456 Ga0207668_10049994
457 Ga0207640_10197235
458 Ga0207703_10123919
459 Ga0207678_10289597
460 Ga0207708_10017557
461 Ga0207702_10049838
462 Ga0207702_10053471
463 Ga0207641_10210147
464 Ga0207674_10086568
465 Ga0207675_100145310
466 Ga0207683_10162156
467 Ga0207683_10233439
468 Ga0207428_10004703
469 Ga0207428_10043725
470 Ga0265318_10069837
471 Ga0307416_100454833
472 Ga0373941_0100110
473 Ga0373945_0061148
474 Ga0373943_0334379
475 Ga0373946_0250005
476 Ga0373955_0059088
477 Ga0373924_0078924
478 Ga0373935_0085628
479 Ga0373947_0002898
480 Ga0373947_0076908
481 Ga0373947_0133826
482 Ga0373925_0000592
483 Ga0395899_0006857
484 Ga0395899_0007569
485 Ga0395899_0039764
486 Ga0395900_0006383
487 Ga0395900_0009163
488 Ga0395900_0018573
489 Ga0395898_0015317
490 Ga0395898_0079029
491 Ga0395898_0356865
492 Ga0395905_0003925
493 Ga0395905_0069933
494 Ga0395905_0111383
495 Ga0395905_0503648
496 Ga0395901_0027118
497 Ga0395901_0070788
498 Ga0436363_0984092
499 Ga0450906_054241
500 Ga0450918_018446
501 Ga0466963_0000683
502 Ga0466957_0117584
503 Ga0451576_0009850
504 Ga0466967_0013497
505 Ga0495592_0073279
506 Ga0495603_0000523
507 Ga0495641_0005787
508 Ga0495641_0212074
509 Ga0495653_0651923
510 Ga0495582_0266153
511 Ga0495664_0053223
512 Ga0495594_0000753
513 Ga0495594_0070382
514 Ga0495628_0213393
515 Ga0495630_0196800
516 Ga0495666_0151298
517 Ga0495666_0369597
518 Ga0495652_0208300
519 Ga0495652_0220930
520 Ga0495665_0288843
521 Ga0495587_0115616
522 Ga0495645_0431644
523 Ga0495588_0015583
524 Ga0495599_0318695
525 Ga0495599_0457494
526 Ga0495647_0003403
527 Ga0495647_0030883
528 Ga0495647_0035738
529 Ga0495581_0000604
530 Ga0495676_0005187
531 Ga0495676_0040507
532 Ga0495676_0244242
533 Ga0496100_0005632
534 Ga0496100_0012167
535 Ga0496100_0045174
536 Ga0496101_0097360
537 Ga0496101_0127116
538 Ga0496101_0478420
539 Ga0496102_0041563
540 Ga0496102_0183493
541 Ga0496102_0525870
542 Ga0496103_0154084
543 Ga0496103_0287965
544 Ga0496104_0030059
545 Ga0496104_0228606
546 Ga0496104_0265174
547 Ga0496105_0025579
548 Ga0496105_0033426
549 Ga0496106_0148085
550 Ga0496107_0095795
551 Ga0496107_0195017
552 Ga0496107_0244471
553 Ga0496107_0519329
554 Ga0496108_0011668
555 Ga0496108_0037284
556 Ga0496108_0094792
557 Ga0496108_0295248
558 Ga0496108_0497574
559 Ga0496109_0001074
560 Ga0496109_0110991
561 Ga0496109_0292392
562 Ga0496110_0000072
563 Ga0496110_0004031
564 Ga0496110_0053158
565 Ga0496110_0093539
566 Ga0496110_0164922
567 Ga0496110_0437560
568 Ga0496111_0001214
569 Ga0496111_0047674
570 Ga0496111_0060490
571 Ga0496112_0035989
572 Ga0496112_0134704
573 Ga0496112_0273274
574 Ga0496113_0072492
575 Ga0496114_0017409
576 Ga0496114_0060690
577 Ga0496114_0283622
578 Ga0496114_0439535
579 Ga0496115_0020264
580 Ga0496115_0036588
581 Ga0501031_0320362
582 Ga0501036_0091018
583 Ga0501036_0162152
584 Ga0501037_0486906
585 Ga0501038_0229561
586 Ga0501038_0249901
587 Ga0501039_0041820
588 Ga0501039_0326913
589 Ga0501040_0007840
590 Ga0501040_0054867
591 Ga0501040_0196663
592 Ga0501040_0237243
593 Ga0501041_0076260
594 Ga0501041_0157452
595 Ga0501042_0118349
596 Ga0501042_0119452
597 Ga0501043_0335552
598 Ga0501046_0130880
599 Ga0501048_0088076
600 Ga0501067_0005277
601 Ga0501067_0042463
602 Ga0501068_0050457
603 Ga0501069_0039259
604 Ga0501070_0293474
605 Ga0501071_0043509
606 Ga0501072_0115503
607 Ga0501074_0110120
608 Ga0501074_0728500
609 Ga0501075_0084407
610 Ga0501076_0027257
611 Ga0501076_0171222
612 Ga0501076_0231840
613 Ga0501076_0262414
614 Ga0501076_0609099
615 Ga0501077_0052577
616 Ga0501077_0052884
617 Ga0501077_0053303
618 Ga0501079_0016642
619 Ga0501079_0166057
620 Ga0501079_0293522
621 Ga0501079_0720049
622 Ga0501080_0019637
623 Ga0501080_0591852
624 Ga0501081_0075567
625 Ga0501081_0141468
626 Ga0501081_0157526
627 Ga0501081_0500308
628 Ga0501045_0017516
629 Ga0501045_0075968
630 Ga0501045_0575084
631 nmdc:mga03n38_397308_c1
632 nmdc:mga05p37_39275_c2
633 nmdc:mga08y16_44828_c1
634 nmdc:mga08y16_99744_c1
635 nmdc:mga0n895_846794_c1
636 Ga0495601_0285290
637 Ga0501084_0146847
638 Ga0501084_0746416
639 Ga0501082_0020075
640 Ga0501082_0444227

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nf9-assembly2.cif.gz_B structure of the knl1/nsl1 complex 0.7005 115 151
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.6916 51 197
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.6831 51 192
3qra-assembly1.cif.gz_A the crystal structure of ail, the attachment invasion locus protein of yersinia pestis 0.6825 131 161
3qrc-assembly1.cif.gz_A the crystal structure of ail, the attachment invasion locus protein of yersinia pestis, in complex with the heparin analogue sucrose octasulfate 0.6825 131 161
ID Description Score Start End Superfamily
af_Q55E62_106_392_3.70.10.10 Alpha Beta;Box;Proliferating Cell Nuclear Antigen; 0.8301 131 162 3.70.10.10
af_I1L7C7_308_422_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.7074 54 160 3.30.310.80
af_Q9GYL7_59_288_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.7007 125 160 3.80.10.10
af_Q4D9Y1_1_92_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.6998 130 161 3.30.450.30
af_O45741_121_385_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.6856 123 162 3.80.10.10
ID Description Score Start End GO Terms
AF-A0A538LJA5-F1-model_v4 SRPBCC family protein 0.9897 20 200
AF-A0A538LJA5-F1-model_v4 SRPBCC family protein 0.9684 20 200
AF-A0A538MSJ5-F1-model_v4 SRPBCC family protein 0.9669 22 209
AF-A0A538JXF6-F1-model_v4 SRPBCC family protein 0.9619 7 205
AF-A0A6G3VJ27-F1-model_v4 deleted 0.9543 53 207

Map