F405683

General Info

Members Datasets Scaffolds Average Seq Length
320 167 640 267

Family's Representative Sequence

Representative Sequence 3300046539|Ga0495621_0018160|Ga0495621_0018160_767_1636
Length 289
Sequence MTAFFPSACRALDQELRMTSTRKLLTVAILCVLGSGLLAAQASPPAQAIPAKNPLEGDPAAIQTGMGLFRGRCADCHGMDARGVRGPDITQVWASGRTDDGLWKTIKNGVPNTEMPANPRALEHEIWQILAYLRTLAAPAPTDPPRGNAQNGEKLFRANCAGCHRVNVTGGRLGPDLSRVGVARSRDVMVRRIRGSIEDLGAGYEPVTITPESGPAIRGVKKNEDLFSVQVMDTRERIQGYEKDKVKAVVNDTKSAMPAFGVDRLSESDLDDLVRYLQSLRGFDPAVRQ

Samples

Sample ID Description Type Environment
1 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
113 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
119 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
123 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
124 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.56
Rhizosphere 98.44
Stem 0
Stem Tuber 0
Unclassified 23.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495621_0018160 3300046539 Unclassified 2281
2 JGI24751J29686_10004248 3300002459 Unclassified 2907
3 JGI25406J46586_10004292 3300003203 Bacteria 6656
4 Ga0065715_10020194 3300005293 Unclassified 1998
5 Ga0065715_10179374 3300005293 Bacteria 1477
6 Ga0065707_10189734 3300005295 Bacteria 1368
7 Ga0065707_10246082 3300005295 Bacteria 1140
8 Ga0068869_100106040 3300005334 Bacteria 2132
9 Ga0068869_100187793 3300005334 Bacteria 1623
10 Ga0070666_10094072 3300005335 Bacteria 2061
11 Ga0070682_100408709 3300005337 Bacteria 1028
12 Ga0070689_100044920 3300005340 Unclassified 3400
13 Ga0070691_10044529 3300005341 Unclassified 2105
14 Ga0070687_100011022 3300005343 Bacteria 3938
15 Ga0070687_100059875 3300005343 Bacteria 2007
16 Ga0070661_100106542 3300005344 Bacteria 2090
17 Ga0070668_100011905 3300005347 Bacteria 6475
18 Ga0070668_100534405 3300005347 Unclassified 1019
19 Ga0070669_100003406 3300005353 Bacteria 11445
20 Ga0070675_100013113 3300005354 Bacteria 6512
21 Ga0070675_100172591 3300005354 Bacteria 1865
22 Ga0070675_100248815 3300005354 Bacteria 1555
23 Ga0070671_100017672 3300005355 Bacteria 5780
24 Ga0070688_100086267 3300005365 Bacteria 2042
25 Ga0070659_100022118 3300005366 Unclassified 4852
26 Ga0070659_100302317 3300005366 Bacteria 1335
27 Ga0070667_100179177 3300005367 Bacteria 1874
28 Ga0070711_100119356 3300005439 Bacteria 1948
29 Ga0070705_100004053 3300005440 Bacteria 7155
30 Ga0070705_100075851 3300005440 Bacteria 2048
31 Ga0070705_100428478 3300005440 Bacteria 987
32 Ga0070700_100175739 3300005441 Bacteria 1486
33 Ga0070700_100440505 3300005441 Bacteria 989
34 Ga0070694_100000629 3300005444 Bacteria 19395
35 Ga0070694_100009071 3300005444 Bacteria 6098
36 Ga0070694_100045277 3300005444 Bacteria 2949
37 Ga0070694_100184891 3300005444 Bacteria 1544
38 Ga0070708_100069018 3300005445 Unclassified 3178
39 Ga0070708_100287776 3300005445 Unclassified 1547
40 Ga0070708_100337957 3300005445 Bacteria 1419
41 Ga0070708_100588490 3300005445 Bacteria 1049
42 Ga0070678_100646069 3300005456 Bacteria 948
43 Ga0070662_100067817 3300005457 Bacteria 2621
44 Ga0070681_10002151 3300005458 Bacteria 17918
45 Ga0070681_10176734 3300005458 Bacteria 2057
46 Ga0068867_100001524 3300005459 Bacteria 16059
47 Ga0070685_10104317 3300005466 Bacteria 1736
48 Ga0070706_100089882 3300005467 Bacteria 2848
49 Ga0070706_100099753 3300005467 Bacteria 2698
50 Ga0070706_100190008 3300005467 Unclassified 1919
51 Ga0070707_100004319 3300005468 Bacteria 13315
52 Ga0070707_100174307 3300005468 Unclassified 2096
53 Ga0070707_100224264 3300005468 Bacteria 1830
54 Ga0070707_100335937 3300005468 Unclassified 1468
55 Ga0070707_100557554 3300005468 Bacteria 1108
56 Ga0070698_100006218 3300005471 Bacteria 12996
57 Ga0070698_100007952 3300005471 Bacteria 11472
58 Ga0070698_100031341 3300005471 Bacteria 5513
59 Ga0070698_100180635 3300005471 Bacteria 2049
60 Ga0070698_100181365 3300005471 Bacteria 2044
61 Ga0070698_100317999 3300005471 Unclassified 1487
62 Ga0070699_100001931 3300005518 Bacteria 18702
63 Ga0070699_100033413 3300005518 Bacteria 4444
64 Ga0070699_100090199 3300005518 Bacteria 2679
65 Ga0070699_100090536 3300005518 Bacteria 2674
66 Ga0070679_100060879 3300005530 Bacteria 3763
67 Ga0070679_100501219 3300005530 Bacteria 1158
68 Ga0070697_100166382 3300005536 Bacteria 1865
69 Ga0070672_100079018 3300005543 Bacteria 2633
70 Ga0070672_100104228 3300005543 Bacteria 2304
71 Ga0070695_100000112 3300005545 Bacteria 36134
72 Ga0070695_100292059 3300005545 Unclassified 1202
73 Ga0070696_100002188 3300005546 Bacteria 12877
74 Ga0070665_100262753 3300005548 Unclassified 1727
75 Ga0070704_100012749 3300005549 Bacteria 5199
76 Ga0070704_100158181 3300005549 Bacteria 1789
77 Ga0070704_100210657 3300005549 Unclassified 1574
78 Ga0070664_100130614 3300005564 Unclassified 2206
79 Ga0068857_100008228 3300005577 Bacteria 9016
80 Ga0070702_100062665 3300005615 Bacteria 2169
81 Ga0068859_100022461 3300005617 Bacteria 6326
82 Ga0068859_100035274 3300005617 Bacteria 5019
83 Ga0068859_100039063 3300005617 Bacteria 4760
84 Ga0068859_100603002 3300005617 Bacteria 1191
85 Ga0068859_100686895 3300005617 Unclassified 1115
86 Ga0068864_100029950 3300005618 Bacteria 4613
87 Ga0068864_100042576 3300005618 Bacteria 3886
88 Ga0068861_100073776 3300005719 Bacteria 2651
89 Ga0068861_100251987 3300005719 Bacteria 1507
90 Ga0068870_10335115 3300005840 Bacteria 966
91 Ga0068863_100285799 3300005841 Bacteria 1599
92 Ga0068858_100004314 3300005842 Bacteria 13970
93 Ga0068858_100028516 3300005842 Bacteria 5185
94 Ga0068860_100009836 3300005843 Bacteria 9488
95 Ga0081539_10000090 3300005985 Bacteria 212006
96 Ga0081539_10001115 3300005985 Bacteria 48750
97 Ga0081539_10126887 3300005985 Bacteria 1259
98 Ga0097621_100064686 3300006237 Bacteria 3008
99 Ga0068871_100051841 3300006358 Unclassified 3322
100 Ga0075428_100318313 3300006844 Bacteria 1672
101 Ga0075428_100433126 3300006844 Bacteria 1409
102 Ga0075430_100002230 3300006846 Bacteria 16058
103 Ga0075431_100022999 3300006847 Bacteria 6370
104 Ga0075431_100460360 3300006847 Unclassified 1266
105 Ga0075433_10071703 3300006852 Unclassified 3045
106 Ga0075433_10103039 3300006852 Bacteria 2527
107 Ga0075433_10128781 3300006852 Bacteria 2248
108 Ga0075433_10271748 3300006852 Unclassified 1502
109 Ga0075433_10384014 3300006852 Unclassified 1240
110 Ga0075433_10527253 3300006852 Bacteria 1039
111 Ga0075434_100004491 3300006871 Bacteria 12587
112 Ga0075434_100007675 3300006871 Bacteria 9983
113 Ga0075434_100088953 3300006871 Bacteria 3090
114 Ga0075434_100113889 3300006871 Bacteria 2717
115 Ga0075434_100209574 3300006871 Bacteria 1969
116 Ga0075434_100296425 3300006871 Unclassified 1637
117 Ga0075429_100147877 3300006880 Bacteria 2057
118 Ga0075429_100220132 3300006880 Bacteria 1663
119 Ga0075429_100398590 3300006880 Bacteria 1205
120 Ga0075436_100123135 3300006914 Bacteria 1816
121 Ga0097620_100022461 3300006931 Bacteria 6326
122 Ga0097620_100035276 3300006931 Bacteria 5019
123 Ga0097620_100039063 3300006931 Bacteria 4760
124 Ga0097620_100603121 3300006931 Bacteria 1191
125 Ga0097620_100686982 3300006931 Unclassified 1115
126 Ga0075435_100124860 3300007076 Bacteria 2150
127 Ga0111539_10006795 3300009094 Bacteria 14720
128 Ga0111539_10024849 3300009094 Bacteria 7346
129 Ga0111539_10085845 3300009094 Bacteria 3699
130 Ga0111539_10185836 3300009094 Bacteria 2427
131 Ga0111539_10262041 3300009094 Bacteria 2012
132 Ga0111539_10562554 3300009094 Bacteria 1328
133 Ga0105247_10006313 3300009101 Bacteria 7347
134 Ga0114129_10002873 3300009147 Bacteria 24107
135 Ga0114129_10007966 3300009147 Bacteria 15084
136 Ga0114129_10017762 3300009147 Bacteria 10129
137 Ga0114129_10033176 3300009147 Bacteria 7296
138 Ga0114129_10090105 3300009147 Bacteria 4252
139 Ga0114129_10119472 3300009147 Unclassified 3630
140 Ga0114129_10208022 3300009147 Bacteria 2647
141 Ga0114129_10260809 3300009147 Bacteria 2323
142 Ga0114129_10282084 3300009147 Bacteria 2219
143 Ga0114129_10343238 3300009147 Bacteria 1980
144 Ga0114129_10376471 3300009147 Unclassified 1876
145 Ga0114129_10423423 3300009147 Bacteria 1751
146 Ga0105243_10691030 3300009148 Bacteria 993
147 Ga0105248_10048213 3300009177 Bacteria 4778
148 Ga0105248_10180287 3300009177 Bacteria 2380
149 Ga0105249_10032298 3300009553 Bacteria 4735
150 Ga0105249_10775660 3300009553 Bacteria 1022
151 Ga0105246_10081276 3300011119 Bacteria 2309
152 Ga0157378_10264151 3300013297 Unclassified 1653
153 Ga0163162_10188902 3300013306 Bacteria 2187
154 Ga0157372_10233828 3300013307 Bacteria 2131
155 Ga0157375_10002807 3300013308 Bacteria 15077
156 Ga0157380_10013955 3300014326 Bacteria 5866
157 Ga0157380_10096409 3300014326 Bacteria 2452
158 Ga0157380_10248186 3300014326 Bacteria 1609
159 Ga0157377_10013794 3300014745 Bacteria 4096
160 Ga0157377_10017255 3300014745 Unclassified 3730
161 Ga0157376_10068439 3300014969 Bacteria 3007
162 Ga0157376_10136420 3300014969 Bacteria 2196
163 Ga0207653_10050623 3300025885 Bacteria 1381
164 Ga0207684_10158265 3300025910 Unclassified 1950
165 Ga0207707_10048957 3300025912 Unclassified 3682
166 Ga0207663_10091071 3300025916 Unclassified 2024
167 Ga0207662_10005392 3300025918 Bacteria 6812
168 Ga0207662_10018217 3300025918 Bacteria 3980
169 Ga0207649_10223531 3300025920 Unclassified 1342
170 Ga0207652_10319198 3300025921 Unclassified 1402
171 Ga0207646_10008304 3300025922 Bacteria 10420
172 Ga0207646_10061855 3300025922 Bacteria 3342
173 Ga0207646_10095098 3300025922 Bacteria 2669
174 Ga0207681_10002961 3300025923 Bacteria 10698
175 Ga0207681_10595499 3300025923 Bacteria 913
176 Ga0207659_10038029 3300025926 Unclassified 3344
177 Ga0207706_10052012 3300025933 Bacteria 3617
178 Ga0207706_10397884 3300025933 Unclassified 1194
179 Ga0207670_10081531 3300025936 Bacteria 2265
180 Ga0207704_10262819 3300025938 Bacteria 1302
181 Ga0207691_10023292 3300025940 Bacteria 5829
182 Ga0207691_10250180 3300025940 Bacteria 1530
183 Ga0207711_10031779 3300025941 Bacteria 4459
184 Ga0207711_10052978 3300025941 Bacteria 3479
185 Ga0207711_10081306 3300025941 Bacteria 2831
186 Ga0207689_10068450 3300025942 Bacteria 2918
187 Ga0207689_10141377 3300025942 Bacteria 1982
188 Ga0207679_10216405 3300025945 Unclassified 1610
189 Ga0207712_10192074 3300025961 Unclassified 1612
190 Ga0207658_10100188 3300025986 Bacteria 2268
191 Ga0207703_10068282 3300026035 Bacteria 2929
192 Ga0207708_10006020 3300026075 Bacteria 8990
193 Ga0207708_10038248 3300026075 Unclassified 3655
194 Ga0207641_10044411 3300026088 Bacteria 3737
195 Ga0207648_10003683 3300026089 Bacteria 16035
196 Ga0207675_100079755 3300026118 Bacteria 3068
197 Ga0207675_100289504 3300026118 Unclassified 1593
198 Ga0207683_10145477 3300026121 Bacteria 2137
199 Ga0207683_10363910 3300026121 Bacteria 1328
200 Ga0207428_10000890 3300027907 Bacteria 33538
201 Ga0207428_10035516 3300027907 Bacteria 4074
202 Ga0207428_10139510 3300027907 Bacteria 1851
203 Ga0207428_10317231 3300027907 Unclassified 1151
204 Ga0268266_10190114 3300028379 Bacteria 1874
205 Ga0268265_10004223 3300028380 Bacteria 10034
206 Ga0268265_10132529 3300028380 Unclassified 2074
207 Ga0268265_10467943 3300028380 Bacteria 1181
208 Ga0268264_10003233 3300028381 Bacteria 14106
209 Ga0373943_0247279 3300035170 Bacteria 1001
210 Ga0373931_0083564 3300035691 Bacteria 1767
211 Ga0373935_0249749 3300035692 Unclassified 1241
212 Ga0373947_0178575 3300035725 Unclassified 1381
213 Ga0373937_0212826 3300036401 Unclassified 1819
214 Ga0373925_0191893 3300037068 Unclassified 1621
215 Ga0439444_0016003 3300042437 Unclassified 1272
216 Ga0453683_0190965 3300044673 Bacteria 1300
217 Ga0451576_0042570 3300045051 Bacteria 4794
218 Ga0451576_0838908 3300045051 Unclassified 965
219 Ga0466967_0289258 3300045976 Bacteria 1574
220 Ga0495592_0171039 3300046454 Bacteria 1488
221 Ga0495584_0185527 3300046491 Bacteria 1057
222 Ga0495663_0124844 3300046525 Unclassified 864
223 Ga0495642_0004165 3300046528 Bacteria 5643
224 Ga0495652_0356660 3300046529 Unclassified 1046
225 Ga0495587_0023982 3300046536 Bacteria 3744
226 Ga0495621_0049250 3300046539 Bacteria 1503
227 Ga0495633_0058741 3300046558 Bacteria 1805
228 Ga0495656_0129991 3300046615 Bacteria 1198
229 Ga0495659_0002279 3300046664 Bacteria 6223
230 Ga0495659_0002611 3300046664 Bacteria 5810
231 Ga0495659_0006091 3300046664 Unclassified 3812
232 Ga0495659_0031720 3300046664 Bacteria 1845
233 Ga0495659_0100803 3300046664 Unclassified 1118
234 Ga0495659_0108463 3300046664 Unclassified 1082
235 Ga0495646_0196924 3300046680 Unclassified 1099
236 Ga0495669_0006951 3300046684 Bacteria 4741
237 Ga0495669_0060202 3300046684 Bacteria 1716
238 Ga0495670_0193125 3300046691 Unclassified 1077
239 Ga0495670_0245031 3300046691 Unclassified 955
240 Ga0495636_0024033 3300047318 Bacteria 2469
241 Ga0495636_0063480 3300047318 Bacteria 1565
242 Ga0495684_0232726 3300047471 Unclassified 1347
243 Ga0496108_0100340 3300048911 Bacteria 2469
244 Ga0496109_0300703 3300048912 Bacteria 1513
245 Ga0496111_0080601 3300048914 Bacteria 2375
246 Ga0496112_0244461 3300048915 Bacteria 1747
247 Ga0496113_0279910 3300048916 Unclassified 1334
248 Ga0501031_0210420 3300049568 Unclassified 1267
249 Ga0501033_0045153 3300049570 Unclassified 3280
250 Ga0501036_0204742 3300049572 Bacteria 1659
251 Ga0501038_0153122 3300049574 Bacteria 1879
252 Ga0501040_0010560 3300049576 Bacteria 6039
253 Ga0501040_0028711 3300049576 Bacteria 3751
254 Ga0501041_0004446 3300049577 Bacteria 8115
255 Ga0501042_0131866 3300049578 Unclassified 1801
256 Ga0501046_0201394 3300049580 Unclassified 1481
257 Ga0501071_0011522 3300049587 Bacteria 5963
258 Ga0501071_0186256 3300049587 Bacteria 1556
259 Ga0501072_0012296 3300049588 Bacteria 6542
260 Ga0501072_0035883 3300049588 Bacteria 3886
261 Ga0501074_0114888 3300049590 Bacteria 1926
262 Ga0501074_0320993 3300049590 Bacteria 1100
263 Ga0501075_0005690 3300049591 Bacteria 8531
264 Ga0501075_0079522 3300049591 Unclassified 2481
265 Ga0501075_0140530 3300049591 Bacteria 1840
266 Ga0501075_0325894 3300049591 Unclassified 1170
267 Ga0501076_0021799 3300049592 Bacteria 4918
268 Ga0501076_0045850 3300049592 Bacteria 3452
269 Ga0501076_0078450 3300049592 Bacteria 2650
270 Ga0501077_0329367 3300049593 Bacteria 974
271 Ga0501079_0021144 3300049741 Bacteria 4975
272 Ga0501079_0092136 3300049741 Bacteria 2348
273 Ga0501080_0348361 3300049742 Bacteria 1338
274 Ga0501081_0046758 3300049743 Bacteria 2976
275 Ga0501081_0118403 3300049743 Bacteria 1884
276 Ga0501083_0357005 3300049744 Unclassified 950
277 nmdc:mga05p37_119363_c1 3300050507 Unclassified 3240
278 nmdc:mga05p37_129510_c1 3300050507 Bacteria 3096
279 nmdc:mga05p37_148302_c1 3300050507 Bacteria 2871
280 nmdc:mga05p37_15595_c1 3300050507 Bacteria 9132
281 nmdc:mga05p37_158600_c1 3300050507 Bacteria 2764
282 nmdc:mga05p37_29057_c1 3300050507 Bacteria 6747
283 nmdc:mga05p37_302145_c1 3300050507 Unclassified 1901
284 nmdc:mga05p37_34108_c1 3300050507 Bacteria 6234
285 nmdc:mga05p37_346219_c1 3300050507 Unclassified 1751
286 nmdc:mga05p37_377819_c1 3300050507 Bacteria 1661
287 nmdc:mga05p37_9516_c1 3300050507 Bacteria 11506
288 nmdc:mga09592_105779_c1 3300050508 Bacteria 2413
289 nmdc:mga09592_567201_c1 3300050508 Unclassified 974
290 nmdc:mga09592_80642_c1 3300050508 Bacteria 2771
291 nmdc:mga0qj67_12453_c1 3300050509 Bacteria 6407
292 nmdc:mga06r32_287048_c1 3300050510 Bacteria 1632
293 nmdc:mga06r32_45002_c1 3300050510 Bacteria 4206
294 nmdc:mga08y16_174834_c1 3300050511 Bacteria 2230
295 nmdc:mga08y16_2170_c1 3300050511 Bacteria 20129
296 nmdc:mga08y16_330835_c1 3300050511 Bacteria 1567
297 nmdc:mga08y16_58165_c1 3300050511 Bacteria 4039
298 nmdc:mga0n895_168176_c1 3300050512 Bacteria 2224
299 nmdc:mga0n895_200773_c1 3300050512 Bacteria 2025
300 nmdc:mga0n895_59997_c1 3300050512 Bacteria 3753
301 nmdc:mga0rr50_163707_c1 3300050513 Bacteria 1807
302 nmdc:mga08x19_110755_c1 3300050514 Bacteria 1831
303 nmdc:mga0a205_231018_c1 3300050515 Bacteria 1733
304 nmdc:mga0a205_289227_c1 3300050515 Unclassified 1513
305 nmdc:mga0a205_387444_c1 3300050515 Bacteria 1262
306 nmdc:mga0a205_424792_c1 3300050515 Unclassified 1191
307 nmdc:mga0a205_56636_c2 3300050515 Bacteria 2108
308 nmdc:mga0a205_59789_c1 3300050515 Bacteria 3681
309 nmdc:mga0a205_91433_c1 3300050515 Unclassified 2940
310 Ga0495601_0155488 3300053077 Unclassified 1493
311 Ga0495612_0016893 3300053078 Unclassified 2924
312 Ga0495619_0024320 3300053085 Bacteria 3884
313 Ga0501084_0009551 3300054114 Bacteria 8029
314 Ga0501084_0028923 3300054114 Bacteria 4633
315 Ga0501084_0115230 3300054114 Bacteria 2259
316 Ga0501082_0013035 3300060353 Bacteria 7145
317 Ga0501082_0133565 3300060353 Bacteria 2153
318 Ga0530510_0007251 3300061734 Bacteria 7714
319 Ga0530510_0016901 3300061734 Bacteria 5168
320 Ga0530510_0026845 3300061734 Bacteria 4125
321 Ga0495621_0018160
322 JGI24751J29686_10004248
323 JGI25406J46586_10004292
324 Ga0065715_10020194
325 Ga0065715_10179374
326 Ga0065707_10189734
327 Ga0065707_10246082
328 Ga0068869_100106040
329 Ga0068869_100187793
330 Ga0070666_10094072
331 Ga0070682_100408709
332 Ga0070689_100044920
333 Ga0070691_10044529
334 Ga0070687_100011022
335 Ga0070687_100059875
336 Ga0070661_100106542
337 Ga0070668_100011905
338 Ga0070668_100534405
339 Ga0070669_100003406
340 Ga0070675_100013113
341 Ga0070675_100172591
342 Ga0070675_100248815
343 Ga0070671_100017672
344 Ga0070688_100086267
345 Ga0070659_100022118
346 Ga0070659_100302317
347 Ga0070667_100179177
348 Ga0070711_100119356
349 Ga0070705_100004053
350 Ga0070705_100075851
351 Ga0070705_100428478
352 Ga0070700_100175739
353 Ga0070700_100440505
354 Ga0070694_100000629
355 Ga0070694_100009071
356 Ga0070694_100045277
357 Ga0070694_100184891
358 Ga0070708_100069018
359 Ga0070708_100287776
360 Ga0070708_100337957
361 Ga0070708_100588490
362 Ga0070678_100646069
363 Ga0070662_100067817
364 Ga0070681_10002151
365 Ga0070681_10176734
366 Ga0068867_100001524
367 Ga0070685_10104317
368 Ga0070706_100089882
369 Ga0070706_100099753
370 Ga0070706_100190008
371 Ga0070707_100004319
372 Ga0070707_100174307
373 Ga0070707_100224264
374 Ga0070707_100335937
375 Ga0070707_100557554
376 Ga0070698_100006218
377 Ga0070698_100007952
378 Ga0070698_100031341
379 Ga0070698_100180635
380 Ga0070698_100181365
381 Ga0070698_100317999
382 Ga0070699_100001931
383 Ga0070699_100033413
384 Ga0070699_100090199
385 Ga0070699_100090536
386 Ga0070679_100060879
387 Ga0070679_100501219
388 Ga0070697_100166382
389 Ga0070672_100079018
390 Ga0070672_100104228
391 Ga0070695_100000112
392 Ga0070695_100292059
393 Ga0070696_100002188
394 Ga0070665_100262753
395 Ga0070704_100012749
396 Ga0070704_100158181
397 Ga0070704_100210657
398 Ga0070664_100130614
399 Ga0068857_100008228
400 Ga0070702_100062665
401 Ga0068859_100022461
402 Ga0068859_100035274
403 Ga0068859_100039063
404 Ga0068859_100603002
405 Ga0068859_100686895
406 Ga0068864_100029950
407 Ga0068864_100042576
408 Ga0068861_100073776
409 Ga0068861_100251987
410 Ga0068870_10335115
411 Ga0068863_100285799
412 Ga0068858_100004314
413 Ga0068858_100028516
414 Ga0068860_100009836
415 Ga0081539_10000090
416 Ga0081539_10001115
417 Ga0081539_10126887
418 Ga0097621_100064686
419 Ga0068871_100051841
420 Ga0075428_100318313
421 Ga0075428_100433126
422 Ga0075430_100002230
423 Ga0075431_100022999
424 Ga0075431_100460360
425 Ga0075433_10071703
426 Ga0075433_10103039
427 Ga0075433_10128781
428 Ga0075433_10271748
429 Ga0075433_10384014
430 Ga0075433_10527253
431 Ga0075434_100004491
432 Ga0075434_100007675
433 Ga0075434_100088953
434 Ga0075434_100113889
435 Ga0075434_100209574
436 Ga0075434_100296425
437 Ga0075429_100147877
438 Ga0075429_100220132
439 Ga0075429_100398590
440 Ga0075436_100123135
441 Ga0097620_100022461
442 Ga0097620_100035276
443 Ga0097620_100039063
444 Ga0097620_100603121
445 Ga0097620_100686982
446 Ga0075435_100124860
447 Ga0111539_10006795
448 Ga0111539_10024849
449 Ga0111539_10085845
450 Ga0111539_10185836
451 Ga0111539_10262041
452 Ga0111539_10562554
453 Ga0105247_10006313
454 Ga0114129_10002873
455 Ga0114129_10007966
456 Ga0114129_10017762
457 Ga0114129_10033176
458 Ga0114129_10090105
459 Ga0114129_10119472
460 Ga0114129_10208022
461 Ga0114129_10260809
462 Ga0114129_10282084
463 Ga0114129_10343238
464 Ga0114129_10376471
465 Ga0114129_10423423
466 Ga0105243_10691030
467 Ga0105248_10048213
468 Ga0105248_10180287
469 Ga0105249_10032298
470 Ga0105249_10775660
471 Ga0105246_10081276
472 Ga0157378_10264151
473 Ga0163162_10188902
474 Ga0157372_10233828
475 Ga0157375_10002807
476 Ga0157380_10013955
477 Ga0157380_10096409
478 Ga0157380_10248186
479 Ga0157377_10013794
480 Ga0157377_10017255
481 Ga0157376_10068439
482 Ga0157376_10136420
483 Ga0207653_10050623
484 Ga0207684_10158265
485 Ga0207707_10048957
486 Ga0207663_10091071
487 Ga0207662_10005392
488 Ga0207662_10018217
489 Ga0207649_10223531
490 Ga0207652_10319198
491 Ga0207646_10008304
492 Ga0207646_10061855
493 Ga0207646_10095098
494 Ga0207681_10002961
495 Ga0207681_10595499
496 Ga0207659_10038029
497 Ga0207706_10052012
498 Ga0207706_10397884
499 Ga0207670_10081531
500 Ga0207704_10262819
501 Ga0207691_10023292
502 Ga0207691_10250180
503 Ga0207711_10031779
504 Ga0207711_10052978
505 Ga0207711_10081306
506 Ga0207689_10068450
507 Ga0207689_10141377
508 Ga0207679_10216405
509 Ga0207712_10192074
510 Ga0207658_10100188
511 Ga0207703_10068282
512 Ga0207708_10006020
513 Ga0207708_10038248
514 Ga0207641_10044411
515 Ga0207648_10003683
516 Ga0207675_100079755
517 Ga0207675_100289504
518 Ga0207683_10145477
519 Ga0207683_10363910
520 Ga0207428_10000890
521 Ga0207428_10035516
522 Ga0207428_10139510
523 Ga0207428_10317231
524 Ga0268266_10190114
525 Ga0268265_10004223
526 Ga0268265_10132529
527 Ga0268265_10467943
528 Ga0268264_10003233
529 Ga0373943_0247279
530 Ga0373931_0083564
531 Ga0373935_0249749
532 Ga0373947_0178575
533 Ga0373937_0212826
534 Ga0373925_0191893
535 Ga0439444_0016003
536 Ga0453683_0190965
537 Ga0451576_0042570
538 Ga0451576_0838908
539 Ga0466967_0289258
540 Ga0495592_0171039
541 Ga0495584_0185527
542 Ga0495663_0124844
543 Ga0495642_0004165
544 Ga0495652_0356660
545 Ga0495587_0023982
546 Ga0495621_0049250
547 Ga0495633_0058741
548 Ga0495656_0129991
549 Ga0495659_0002279
550 Ga0495659_0002611
551 Ga0495659_0006091
552 Ga0495659_0031720
553 Ga0495659_0100803
554 Ga0495659_0108463
555 Ga0495646_0196924
556 Ga0495669_0006951
557 Ga0495669_0060202
558 Ga0495670_0193125
559 Ga0495670_0245031
560 Ga0495636_0024033
561 Ga0495636_0063480
562 Ga0495684_0232726
563 Ga0496108_0100340
564 Ga0496109_0300703
565 Ga0496111_0080601
566 Ga0496112_0244461
567 Ga0496113_0279910
568 Ga0501031_0210420
569 Ga0501033_0045153
570 Ga0501036_0204742
571 Ga0501038_0153122
572 Ga0501040_0010560
573 Ga0501040_0028711
574 Ga0501041_0004446
575 Ga0501042_0131866
576 Ga0501046_0201394
577 Ga0501071_0011522
578 Ga0501071_0186256
579 Ga0501072_0012296
580 Ga0501072_0035883
581 Ga0501074_0114888
582 Ga0501074_0320993
583 Ga0501075_0005690
584 Ga0501075_0079522
585 Ga0501075_0140530
586 Ga0501075_0325894
587 Ga0501076_0021799
588 Ga0501076_0045850
589 Ga0501076_0078450
590 Ga0501077_0329367
591 Ga0501079_0021144
592 Ga0501079_0092136
593 Ga0501080_0348361
594 Ga0501081_0046758
595 Ga0501081_0118403
596 Ga0501083_0357005
597 nmdc:mga05p37_119363_c1
598 nmdc:mga05p37_129510_c1
599 nmdc:mga05p37_148302_c1
600 nmdc:mga05p37_15595_c1
601 nmdc:mga05p37_158600_c1
602 nmdc:mga05p37_29057_c1
603 nmdc:mga05p37_302145_c1
604 nmdc:mga05p37_34108_c1
605 nmdc:mga05p37_346219_c1
606 nmdc:mga05p37_377819_c1
607 nmdc:mga05p37_9516_c1
608 nmdc:mga09592_105779_c1
609 nmdc:mga09592_567201_c1
610 nmdc:mga09592_80642_c1
611 nmdc:mga0qj67_12453_c1
612 nmdc:mga06r32_287048_c1
613 nmdc:mga06r32_45002_c1
614 nmdc:mga08y16_174834_c1
615 nmdc:mga08y16_2170_c1
616 nmdc:mga08y16_330835_c1
617 nmdc:mga08y16_58165_c1
618 nmdc:mga0n895_168176_c1
619 nmdc:mga0n895_200773_c1
620 nmdc:mga0n895_59997_c1
621 nmdc:mga0rr50_163707_c1
622 nmdc:mga08x19_110755_c1
623 nmdc:mga0a205_231018_c1
624 nmdc:mga0a205_289227_c1
625 nmdc:mga0a205_387444_c1
626 nmdc:mga0a205_424792_c1
627 nmdc:mga0a205_56636_c2
628 nmdc:mga0a205_59789_c1
629 nmdc:mga0a205_91433_c1
630 Ga0495601_0155488
631 Ga0495612_0016893
632 Ga0495619_0024320
633 Ga0501084_0009551
634 Ga0501084_0028923
635 Ga0501084_0115230
636 Ga0501082_0013035
637 Ga0501082_0133565
638 Ga0530510_0007251
639 Ga0530510_0016901
640 Ga0530510_0026845

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

149

281

0.9

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

210

277

0.88

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

60

133

0.85

PF00034

Cytochrom_C

Cytochrome c

62

137

0.78

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

147

206

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c90-assembly1.cif.gz_C crystal structure of cytochrome cl from the marine methylotrophic bacterium methylophaga aminisulfidivorans mpt (ma-cytcl) 0.9117 29 112
6tfl-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8626 183 227
2c8s-assembly1.cif.gz_A cytochrome cl from methylobacterium extorquens 0.8606 32 117
1c75-assembly1.cif.gz_A "0.97 a ""ab initio"" crystal structure of cytochrome c-553 from bacillus pasteurii" 0.8578 44 110
1k3g-assembly1.cif.gz_A nmr solution structure of oxidized cytochrome c-553 from bacillus pasteurii 0.8552 42 112
ID Description Score Start End Superfamily
af_Q7JPE3_651_806_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.927 196 219 3.40.1110.10
2c8sA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8606 32 117 1.10.760.10
1k3gA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8552 42 112 1.10.760.10
af_P9WGY9_643_706_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8539 196 219 2.40.50.100
af_A4HRD7_2_71_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.8509 182 229 2.30.30.100
ID Description Score Start End GO Terms
AF-A0A2V8HH65-F1-model_v4 Cytochrome c domain-containing protein 0.8987 24 260 GO:0009055
GO:0020037
GO:0046872
AF-A0A7Y5MPL0-F1-model_v4 C-type cytochrome 0.8911 123 255 GO:0009055
GO:0020037
GO:0046872
AF-A0A2V8KT35-F1-model_v4 Cytochrome c domain-containing protein 0.8825 21 134 GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A0A517TZA8-F1-model_v4 Cytochrome c 0.882 123 255 GO:0009055
GO:0020037
GO:0046872
AF-A0A7V3RSZ9-F1-model_v4 C-type cytochrome 0.8795 123 255 GO:0009055
GO:0020037
GO:0046872

Map