F405671

General Info

Members Datasets Scaffolds Average Seq Length
320 175 306 437

Family's Representative Sequence

Representative Sequence 3300046491|Ga0495584_0008462|Ga0495584_0008462_1482_3011
Length 498
Sequence LGGWSAHAFKPGVPVRVSFFARIYRTIACWHAKIMRLIEAQQFEGRILMPQARISSSVLAALLPAPAKGPDVARHQPDIDKIVAEVSPKRIEGYIRKLVSFETRHTMSDTNSDTVGIGAARRWIKSELERCGAGTRLQVAFDSHVAPVSARISRPTEIVNVVATLPGTQEASKDRMYVVSGHYDSRNTDVMDASGKAPGANDDASGTAAVMELACVMARHNFDATIVFMAVAAEEQGLIGATHWAEQAKRNNLNVAGMFTNDIIGSSRADDGRVDNSQVRLFAEALPATREVNDANRMLLQTGGENDSISRQLARHVKEQGERYVKGFKVNVIQRRDRYLRGGDHMPFLERGYAALRFTEPNENFDHQHQNLRTEDGKVYGDLIEFDDFNYIAKVARVNAAALXXXXLAPAAPREVGIRIDKLENDTTLVWAPNGEPDLAGYRIVWRETTAPQWQGSKFVGNVTETTVKLSKDNYFFGVQAIDKDGNASVATYPSPKR

Samples

Sample ID Description Type Environment
1 2643221645 Massilia sp. Root351 Isolate Unclassified
2 2643221664 Massilia sp. Root418 Isolate Unclassified
3 2738541280 Massilia sp. GV090 Isolate Unclassified
4 2738541297 Duganella sp. GV083 Isolate Unclassified
5 2738541300 Massilia sp. GV016 Isolate Unclassified
6 2738541357 Duganella sp. GV053 Isolate Unclassified
7 2738543003 Duganella sp. GV066 Isolate Unclassified
8 2738543018 Massilia sp. GV045 Isolate Unclassified
9 2738543026 Duganella sp. GV089 Isolate Unclassified
10 2738543029 Duganella sp. GV039 Isolate Unclassified
11 2738543030 Massilia sp. GV097 Isolate Unclassified
12 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
13 2842711865 Duganella sp. R-73148 Isolate Unclassified
14 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
15 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
16 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
17 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
18 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
38 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
39 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
40 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
41 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
42 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
43 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
61 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
62 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
63 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
64 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
65 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
66 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
67 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
68 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
71 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
72 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
73 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
74 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
75 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
76 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
77 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
78 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
79 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
80 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
81 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
82 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
83 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
84 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
85 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
86 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
89 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
90 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
91 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
92 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
93 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
94 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
95 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
96 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
97 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
98 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
99 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
100 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
101 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
102 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
103 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
104 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
109 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
110 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
111 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
117 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
131 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
132 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
133 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
134 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
139 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
152 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
166 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
167 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
170 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
171 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
172 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
173 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
174 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.62
Metatranscriptomes 0
Isolates 4.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.12
Nodule 0
Rhizoplane 0.94
Rhizosphere 77.19
Stem 0
Stem Tuber 0
Unclassified 8.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000495 3300002738 Bacteria 20221
2 JGI25152J39213_1000405 3300002773 Bacteria 26194
3 JGI25150J39212_1000834 3300002774 Bacteria 10337
4 JGI25150J39212_1001962 3300002774 Bacteria 5396
5 JGI25159J45721_1002683 3300002987 Bacteria 6625
6 Ga0055526_1000010 3300003771 Bacteria 241512
7 Ga0055526_1000104 3300003771 Bacteria 73451
8 Ga0055526_1005588 3300003771 Bacteria 7167
9 Ga0055537_1000200 3300003773 Bacteria 44838
10 Ga0055524_1003726 3300003775 Bacteria 7284
11 Ga0055534_1000083 3300003784 Bacteria 74541
12 Ga0055528_1000347 3300003790 Bacteria 38155
13 Ga0055543_1003168 3300004625 Bacteria 5022
14 Ga0065165_1000120 3300005262 Bacteria 134211
15 Ga0070683_100002063 3300005329 Bacteria 15856
16 Ga0070711_100000021 3300005439 Bacteria 122874
17 Ga0070695_100136860 3300005545 Bacteria 1694
18 Ga0070717_10000014 3300006028 Bacteria 218451
19 Ga0075431_100001696 3300006847 Bacteria 20705
20 Ga0075431_100257218 3300006847 Bacteria 1773
21 Ga0075436_100000083 3300006914 Bacteria 54890
22 Ga0105240_10065152 3300009093 Bacteria 4524
23 Ga0105243_10025569 3300009148 Bacteria 4513
24 Ga0105243_10148985 3300009148 Bacteria 2005
25 Ga0157371_10000014 3300013102 Bacteria 347490
26 Ga0182008_10000231 3300014497 Bacteria 43471
27 Ga0182008_10008123 3300014497 Bacteria 5746
28 Ga0157379_10085044 3300014968 Bacteria 2835
29 Ga0182006_1000004 3300015261 Bacteria 622190
30 Ga0213872_10000035 3300021361 Bacteria 133053
31 Ga0213872_10001028 3300021361 Bacteria 19460
32 Ga0213872_10031533 3300021361 Bacteria 2429
33 Ga0209437_102687 3300025233 Bacteria 3372
34 Ga0207425_1000017 3300025245 Bacteria 423851
35 Ga0207425_1000988 3300025245 Bacteria 13350
36 Ga0209646_1000036 3300025246 Bacteria 358864
37 Ga0209129_1000039 3300025258 Bacteria 322444
38 Ga0209129_1000088 3300025258 Bacteria 179071
39 Ga0209565_1000068 3300025263 Bacteria 171201
40 Ga0209565_1003966 3300025263 Bacteria 4624
41 Ga0209673_1000119 3300025273 Bacteria 171203
42 Ga0209130_1000057 3300025284 Bacteria 210593
43 Ga0209675_1000068 3300025291 Bacteria 171202
44 Ga0209025_1008504 3300025294 Bacteria 7377
45 Ga0209564_1000060 3300025295 Bacteria 325890
46 Ga0209564_1000141 3300025295 Bacteria 179852
47 Ga0209564_1000149 3300025295 Bacteria 170958
48 Ga0209758_1000137 3300025297 Bacteria 176734
49 Ga0209758_1003937 3300025297 Bacteria 12905
50 Ga0209256_1000173 3300025299 Bacteria 129001
51 Ga0209256_1000207 3300025299 Bacteria 111217
52 Ga0207663_10000004 3300025916 Bacteria 294638
53 Ga0207709_10024975 3300025935 Bacteria 3418
54 Ga0207661_10009452 3300025944 Bacteria 6994
55 Ga0207641_10018738 3300026088 Bacteria 5676
56 Ga0207674_10210594 3300026116 Bacteria 1893
57 Ga0265316_10128383 3300031344 Bacteria 1911
58 Ga0307408_100000929 3300031548 Bacteria 22856
59 Ga0307508_10021904 3300031616 Bacteria 5814
60 Ga0265314_10008487 3300031711 Bacteria 8791
61 Ga0307507_10044145 3300033179 Bacteria 4412
62 Ga0373961_0000082 3300035241 Bacteria 51180
63 Ga0436361_0087889 3300039447 Bacteria 55397
64 Ga0436361_0339081 3300039447 Bacteria 17622
65 Ga0436361_0574593 3300039447 Bacteria 1925
66 Ga0436361_0775460 3300039447 Bacteria 6031
67 Ga0436361_1080527 3300039447 Bacteria 5244
68 Ga0450904_002082 3300042139 Bacteria 2502
69 Ga0466972_0003976 3300044658 Bacteria 7368
70 Ga0466965_0001433 3300044683 Bacteria 9627
71 Ga0466964_0009998 3300044706 Bacteria 3575
72 Ga0466964_0066535 3300044706 Bacteria 1512
73 Ga0453684_0001075 3300044712 Bacteria 86968
74 Ga0466970_0021745 3300044765 Bacteria 3344
75 Ga0451576_0000025 3300045051 Bacteria 427980
76 Ga0495617_000007 3300046452 Bacteria 369986
77 Ga0495617_000169 3300046452 Bacteria 41491
78 Ga0495590_0000035 3300046457 Bacteria 129481
79 Ga0495590_0001605 3300046457 Bacteria 9680
80 Ga0495590_0014581 3300046457 Bacteria 2866
81 Ga0495638_0000023 3300046460 Bacteria 363063
82 Ga0495638_0005758 3300046460 Bacteria 9125
83 Ga0495638_0082064 3300046460 Bacteria 1956
84 Ga0495653_0000297 3300046463 Bacteria 40421
85 Ga0495653_0045927 3300046463 Bacteria 3383
86 Ga0495650_0000230 3300046471 Bacteria 114025
87 Ga0495650_0000274 3300046471 Bacteria 98605
88 Ga0495650_0000288 3300046471 Bacteria 93448
89 Ga0495582_0010504 3300046473 Bacteria 5092
90 Ga0495605_0000071 3300046474 Bacteria 135203
91 Ga0495605_0014579 3300046474 Bacteria 4299
92 Ga0495605_0056252 3300046474 Bacteria 1898
93 Ga0495584_0000007 3300046491 Bacteria 294820
94 Ga0495584_0001275 3300046491 Bacteria 15333
95 Ga0495584_0001980 3300046491 Bacteria 11794
96 Ga0495584_0002688 3300046491 Bacteria 9996
97 Ga0495584_0004602 3300046491 Bacteria 7393
98 Ga0495584_0008462 3300046491 Bacteria 5330
99 Ga0495584_0045390 3300046491 Bacteria 2216
100 Ga0495585_0000090 3300046492 Bacteria 95790
101 Ga0495585_0000147 3300046492 Bacteria 76686
102 Ga0495585_0000518 3300046492 Bacteria 36483
103 Ga0495585_0000561 3300046492 Bacteria 35148
104 Ga0495585_0006252 3300046492 Bacteria 7417
105 Ga0495585_0007296 3300046492 Bacteria 6784
106 Ga0495585_0017363 3300046492 Bacteria 4157
107 Ga0495585_0029963 3300046492 Bacteria 3095
108 Ga0495585_0062761 3300046492 Bacteria 2040
109 Ga0495585_0085321 3300046492 Bacteria 1706
110 Ga0495594_0002614 3300046499 Bacteria 9354
111 Ga0495594_0042282 3300046499 Bacteria 2495
112 Ga0495596_0002383 3300046500 Bacteria 10162
113 Ga0495607_0001625 3300046501 Bacteria 19476
114 Ga0495583_0000016 3300046506 Bacteria 312691
115 Ga0495583_0000075 3300046506 Bacteria 177074
116 Ga0495583_0000093 3300046506 Bacteria 158708
117 Ga0495583_0000205 3300046506 Bacteria 99711
118 Ga0495583_0009144 3300046506 Bacteria 5953
119 Ga0495606_0000133 3300046507 Bacteria 126345
120 Ga0495606_0000331 3300046507 Bacteria 81871
121 Ga0495606_0001324 3300046507 Bacteria 33820
122 Ga0495606_0001578 3300046507 Bacteria 29867
123 Ga0495606_0002149 3300046507 Bacteria 23757
124 Ga0495606_0003940 3300046507 Bacteria 15272
125 Ga0495606_0019199 3300046507 Bacteria 5095
126 Ga0495606_0027114 3300046507 Bacteria 4068
127 Ga0495606_0027116 3300046507 Bacteria 4068
128 Ga0495610_0000004 3300046512 Bacteria 1006135
129 Ga0495616_0000048 3300046513 Bacteria 108577
130 Ga0495616_0005551 3300046513 Bacteria 7742
131 Ga0495616_0011520 3300046513 Bacteria 5060
132 Ga0495616_0022927 3300046513 Bacteria 3365
133 Ga0495620_0013990 3300046515 Bacteria 4092
134 Ga0495630_0030210 3300046517 Bacteria 4030
135 Ga0495631_0006670 3300046518 Bacteria 5935
136 Ga0495631_0017844 3300046518 Bacteria 3350
137 Ga0495631_0017967 3300046518 Bacteria 3337
138 Ga0495631_0035926 3300046518 Bacteria 2214
139 Ga0495643_0000115 3300046522 Bacteria 130423
140 Ga0495643_0001307 3300046522 Bacteria 23666
141 Ga0495643_0001678 3300046522 Bacteria 19341
142 Ga0495644_0030948 3300046523 Bacteria 2020
143 Ga0495644_0035366 3300046523 Bacteria 1886
144 Ga0495648_0000025 3300046524 Bacteria 233415
145 Ga0495648_0000091 3300046524 Bacteria 113822
146 Ga0495648_0004796 3300046524 Bacteria 11429
147 Ga0495648_0014000 3300046524 Bacteria 5900
148 Ga0495648_0017134 3300046524 Bacteria 5191
149 Ga0495648_0020334 3300046524 Bacteria 4632
150 Ga0495648_0020345 3300046524 Bacteria 4630
151 Ga0495663_0003019 3300046525 Bacteria 4942
152 Ga0495666_0000465 3300046526 Bacteria 18043
153 Ga0495642_0003672 3300046528 Bacteria 6020
154 Ga0495642_0004385 3300046528 Bacteria 5478
155 Ga0495642_0016853 3300046528 Bacteria 2850
156 Ga0495642_0025030 3300046528 Bacteria 2364
157 Ga0495642_0036708 3300046528 Bacteria 1981
158 Ga0495652_0025910 3300046529 Bacteria 5181
159 Ga0495654_0003346 3300046530 Bacteria 9878
160 Ga0495654_0004175 3300046530 Bacteria 8655
161 Ga0495654_0035954 3300046530 Bacteria 2491
162 Ga0495665_0021110 3300046531 Bacteria 3498
163 Ga0495586_0002254 3300046535 Bacteria 10496
164 Ga0495586_0094343 3300046535 Bacteria 1655
165 Ga0495587_0058125 3300046536 Bacteria 2272
166 Ga0495609_0001147 3300046538 Bacteria 18253
167 Ga0495609_0004867 3300046538 Bacteria 7227
168 Ga0495609_0039682 3300046538 Bacteria 2119
169 Ga0495609_0039728 3300046538 Bacteria 2117
170 Ga0495597_0000355 3300046542 Bacteria 40841
171 Ga0495597_0000361 3300046542 Bacteria 40182
172 Ga0495597_0001465 3300046542 Bacteria 16925
173 Ga0495597_0018222 3300046542 Bacteria 3297
174 Ga0495622_0000015 3300046557 Bacteria 179054
175 Ga0495622_0000063 3300046557 Bacteria 95713
176 Ga0495622_0024144 3300046557 Bacteria 2838
177 Ga0495622_0050655 3300046557 Bacteria 1926
178 Ga0495633_0000050 3300046558 Bacteria 155466
179 Ga0495633_0001378 3300046558 Bacteria 18980
180 Ga0495633_0001935 3300046558 Bacteria 15068
181 Ga0495633_0003688 3300046558 Bacteria 10108
182 Ga0495633_0004046 3300046558 Bacteria 9479
183 Ga0495633_0004677 3300046558 Bacteria 8613
184 Ga0495633_0007938 3300046558 Bacteria 6049
185 Ga0495633_0008658 3300046558 Bacteria 5712
186 Ga0495633_0009298 3300046558 Bacteria 5441
187 Ga0495633_0051653 3300046558 Bacteria 1936
188 Ga0495656_0004222 3300046615 Bacteria 4903
189 Ga0495656_0022744 3300046615 Bacteria 2459
190 Ga0495656_0049401 3300046615 Bacteria 1791
191 Ga0495668_0000064 3300046616 Bacteria 180583
192 Ga0495668_0002309 3300046616 Bacteria 15967
193 Ga0495668_0002600 3300046616 Bacteria 14629
194 Ga0495668_0005267 3300046616 Bacteria 8848
195 Ga0495668_0020430 3300046616 Bacteria 3809
196 Ga0495668_0047160 3300046616 Bacteria 2392
197 Ga0495668_0063296 3300046616 Bacteria 2037
198 Ga0495668_0063672 3300046616 Bacteria 2031
199 Ga0495611_0003039 3300046648 Bacteria 7471
200 Ga0495611_0045694 3300046648 Bacteria 1962
201 Ga0495625_0000123 3300046660 Bacteria 120958
202 Ga0495625_0001138 3300046660 Bacteria 34313
203 Ga0495625_0008450 3300046660 Bacteria 8787
204 Ga0495625_0010474 3300046660 Bacteria 7668
205 Ga0495625_0026240 3300046660 Bacteria 4404
206 Ga0495635_0002174 3300046663 Bacteria 13328
207 Ga0495659_0000006 3300046664 Bacteria 105925
208 Ga0495661_0006471 3300046665 Bacteria 8236
209 Ga0495661_0014625 3300046665 Bacteria 5256
210 Ga0495661_0028650 3300046665 Bacteria 3562
211 Ga0495661_0029525 3300046665 Bacteria 3498
212 Ga0495661_0051710 3300046665 Bacteria 2479
213 Ga0495588_0018456 3300046674 Bacteria 3402
214 Ga0495588_0020408 3300046674 Bacteria 3256
215 Ga0495623_0021624 3300046679 Bacteria 4154
216 Ga0495623_0048460 3300046679 Bacteria 2694
217 Ga0495669_0000710 3300046684 Bacteria 14492
218 Ga0495669_0001295 3300046684 Bacteria 10366
219 Ga0495624_0005523 3300046690 Bacteria 9102
220 Ga0495670_0002303 3300046691 Bacteria 9437
221 Ga0495670_0032712 3300046691 Bacteria 2587
222 Ga0495671_0000177 3300046692 Bacteria 56452
223 Ga0495671_0000815 3300046692 Bacteria 22292
224 Ga0495671_0015582 3300046692 Bacteria 4069
225 Ga0495671_0047618 3300046692 Bacteria 2141
226 Ga0495589_0018006 3300046794 Bacteria 3625
227 Ga0495600_0017831 3300046809 Bacteria 4519
228 Ga0495660_0000225 3300046810 Bacteria 56074
229 Ga0495660_0003119 3300046810 Bacteria 10329
230 Ga0495581_0009206 3300047315 Bacteria 5712
231 Ga0495581_0034575 3300047315 Bacteria 2924
232 Ga0495604_0029427 3300047317 Bacteria 4369
233 Ga0495604_0035040 3300047317 Bacteria 3965
234 Ga0495604_0036902 3300047317 Bacteria 3851
235 Ga0495636_0000372 3300047318 Bacteria 16900
236 Ga0495674_0002462 3300047319 Bacteria 18093
237 Ga0495672_0000111 3300047320 Bacteria 130829
238 Ga0495672_0000203 3300047320 Bacteria 84822
239 Ga0495676_0074304 3300047321 Bacteria 2604
240 Ga0495680_0002023 3300047322 Bacteria 21263
241 Ga0495680_0119962 3300047322 Bacteria 1942
242 Ga0495683_0000443 3300047323 Bacteria 32710
243 Ga0495683_0000555 3300047323 Bacteria 28217
244 Ga0495687_001786 3300047443 Bacteria 19007
245 Ga0495675_0003501 3300047444 Bacteria 9461
246 Ga0495675_0025189 3300047444 Bacteria 3793
247 Ga0495677_0009280 3300047445 Bacteria 3634
248 Ga0495677_0028755 3300047445 Bacteria 2020
249 Ga0495679_005536 3300047446 Bacteria 5583
250 Ga0495685_000032 3300047447 Bacteria 58381
251 Ga0495673_0000017 3300047469 Bacteria 574970
252 Ga0495673_0000027 3300047469 Bacteria 475440
253 Ga0495681_0015075 3300047470 Bacteria 4388
254 Ga0495686_0000169 3300047472 Bacteria 123511
255 Ga0495686_0000771 3300047472 Bacteria 42111
256 Ga0495686_0007222 3300047472 Bacteria 8364
257 Ga0495686_0016639 3300047472 Bacteria 4980
258 Ga0495593_0002458 3300047673 Bacteria 11146
259 Ga0495602_0013366 3300048088 Bacteria 8394
260 Ga0495602_0035851 3300048088 Bacteria 4622
261 Ga0495614_0000545 3300048089 Bacteria 15602
262 Ga0495626_0000027 3300048091 Bacteria 206022
263 Ga0495626_0004210 3300048091 Bacteria 8910
264 Ga0496102_0036051 3300048905 Bacteria 4454
265 Ga0496103_0027644 3300048906 Bacteria 3438
266 Ga0496115_0078335 3300048918 Bacteria 2689
267 Ga0496116_0093421 3300048919 Bacteria 1821
268 Ga0496117_0000011 3300048920 Bacteria 610930
269 Ga0496118_0000010 3300048921 Bacteria 610930
270 Ga0496120_0044604 3300048923 Bacteria 2575
271 Ga0496122_0000691 3300048925 Bacteria 67209
272 Ga0496122_0098359 3300048925 Bacteria 1965
273 Ga0496123_0002380 3300048926 Bacteria 23576
274 Ga0496123_0011143 3300048926 Bacteria 7835
275 Ga0496124_0006779 3300048927 Bacteria 12373
276 Ga0496126_0012025 3300048929 Bacteria 8894
277 Ga0495678_000518 3300049459 Bacteria 37613
278 Ga0495678_001329 3300049459 Bacteria 19817
279 Ga0495678_003559 3300049459 Bacteria 9546
280 Ga0495682_0000887 3300049460 Bacteria 18536
281 Ga0495682_0002041 3300049460 Bacteria 9902
282 Ga0495682_0002383 3300049460 Bacteria 8915
283 Ga0501040_0050942 3300049576 Bacteria 2833
284 Ga0501041_0093185 3300049577 Bacteria 1860
285 Ga0501042_0058006 3300049578 Bacteria 2763
286 Ga0501046_0054446 3300049580 Bacteria 3147
287 Ga0501048_0104690 3300049582 Bacteria 1997
288 Ga0501072_0091051 3300049588 Bacteria 2421
289 Ga0501075_0112077 3300049591 Bacteria 2074
290 Ga0501076_0011354 3300049592 Bacteria 6632
291 Ga0501079_0134025 3300049741 Bacteria 1928
292 Ga0501279_001783 3300049775 Bacteria 2838
293 Ga0501045_0113514 3300049824 Bacteria 2009
294 nmdc:mga08x19_30_c1 3300050514 Bacteria 212384
295 Ga0500566_0008490 3300053094 Bacteria 6073
296 Ga0500618_001084 3300053125 Bacteria 13371
297 Ga0500618_013671 3300053125 Bacteria 2091
298 Ga0500564_069435 3300053138 Bacteria 1591
299 Ga0500568_0014829 3300053139 Bacteria 3505
300 Ga0500585_014510 3300053144 Bacteria 2434
301 Ga0500586_006577 3300053145 Bacteria 3033
302 Ga0500590_034224 3300053148 Bacteria 2631
303 Ga0500603_000757 3300053150 Bacteria 7800
304 Ga0500622_0080867 3300053156 Bacteria 1627
305 Ga0500637_0042049 3300053178 Bacteria 2583
306 Ga0501082_0036412 3300060353 Bacteria 4240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046529 Ga0495652_0025910 Ga0495652_0025910_3600_4964 376
2 3300046463 Ga0495653_0045927 Ga0495653_0045927_1328_2722 384
3 3300046535 Ga0495586_0002254 Ga0495586_0002254_8695_10089 384
4 3300046663 Ga0495635_0002174 Ga0495635_0002174_9841_11235 384
5 3300047322 Ga0495680_0002023 Ga0495680_0002023_13937_15331 384
6 3300047444 Ga0495675_0025189 Ga0495675_0025189_2292_3686 384
7 3300048089 Ga0495614_0000545 Ga0495614_0000545_550_1944 384
8 3300046526 Ga0495666_0000465 Ga0495666_0000465_8338_9732 385
9 3300048088 Ga0495602_0035851 Ga0495602_0035851_1660_3027 387
10 3300046473 Ga0495582_0010504 Ga0495582_0010504_1301_2668 388
11 3300046517 Ga0495630_0030210 Ga0495630_0030210_2417_3784 388
12 3300046616 Ga0495668_0063672 Ga0495668_0063672_144_1511 388
13 3300046674 Ga0495588_0020408 Ga0495588_0020408_727_2094 388
14 3300046679 Ga0495623_0021624 Ga0495623_0021624_189_1556 388
15 3300047317 Ga0495604_0029427 Ga0495604_0029427_1889_3256 388
16 3300047444 Ga0495675_0003501 Ga0495675_0003501_7934_9301 388
17 3300046531 Ga0495665_0021110 Ga0495665_0021110_247_1614 391
18 3300026088 Ga0207641_10018738 Ga0207641_100187383 395
19 3300048091 Ga0495626_0000027 Ga0495626_0000027_24916_26280 395
20 3300049775 Ga0501279_001783 Ga0501279_001783_519_1862 397
21 3300046530 Ga0495654_0003346 Ga0495654_0003346_1321_2697 398
22 3300046664 Ga0495659_0000006 Ga0495659_0000006_98307_99683 398
23 3300046692 Ga0495671_0000815 Ga0495671_0000815_6591_7967 398
24 3300047320 Ga0495672_0000203 Ga0495672_0000203_77604_78980 398
25 3300003775 Ga0055524_1003726 Ga0055524_10037264 399
26 3300025299 Ga0209256_1000207 Ga0209256_10002077 399
27 3300015261 Ga0182006_1000004 Ga0182006_1000004396 400
28 3300031616 Ga0307508_10021904 Ga0307508_100219045 400
29 3300033179 Ga0307507_10044145 Ga0307507_100441454 400
30 3300048920 Ga0496117_0000011 Ga0496117_0000011_431514_432869 400
31 3300048921 Ga0496118_0000010 Ga0496118_0000010_178062_179417 400
32 3300048925 Ga0496122_0000691 Ga0496122_0000691_9394_10749 400
33 3300048926 Ga0496123_0002380 Ga0496123_0002380_12645_14000 400
34 3300009148 Ga0105243_10148985 Ga0105243_101489852 401
35 3300046542 Ga0495597_0001465 Ga0495597_0001465_1655_3037 401
36 3300014497 Ga0182008_10000231 Ga0182008_100002313 402
37 3300046524 Ga0495648_0017134 Ga0495648_0017134_2810_4186 402
38 3300002773 JGI25152J39213_1000405 JGI25152J39213_10004058 405
39 3300002774 JGI25150J39212_1000834 JGI25150J39212_10008346 405
40 3300025245 Ga0207425_1000017 Ga0207425_1000017258 405
41 3300025258 Ga0209129_1000039 Ga0209129_1000039141 405
42 3300025258 Ga0209129_1000088 Ga0209129_1000088144 405
43 3300025263 Ga0209565_1003966 Ga0209565_10039664 405
44 3300025297 Ga0209758_1000137 Ga0209758_1000137155 405
45 3300048091 Ga0495626_0004210 Ga0495626_0004210_1836_3212 407
46 3300009093 Ga0105240_10065152 Ga0105240_100651525 408
47 3300046684 Ga0495669_0001295 Ga0495669_0001295_6714_8075 408
48 3300046460 Ga0495638_0082064 Ga0495638_0082064_118_1479 409
49 3300046491 Ga0495584_0045390 Ga0495584_0045390_737_2098 409
50 3300046538 Ga0495609_0001147 Ga0495609_0001147_13710_15071 409
51 3300046660 Ga0495625_0026240 Ga0495625_0026240_2734_4095 409
52 3300047446 Ga0495679_005536 Ga0495679_005536_3845_5206 409
53 3300003771 Ga0055526_1005588 Ga0055526_10055884 410
54 3300003773 Ga0055537_1000200 Ga0055537_10002009 410
55 3300003784 Ga0055534_1000083 Ga0055534_100008313 410
56 3300003790 Ga0055528_1000347 Ga0055528_100034713 410
57 3300025263 Ga0209565_1000068 Ga0209565_1000068148 410
58 3300025273 Ga0209673_1000119 Ga0209673_1000119148 410
59 3300025291 Ga0209675_1000068 Ga0209675_1000068148 410
60 3300025295 Ga0209564_1000149 Ga0209564_100014913 410
61 3300025299 Ga0209256_1000173 Ga0209256_1000173110 410
62 3300044658 Ga0466972_0003976 Ga0466972_0003976_4698_6086 410
63 3300044683 Ga0466965_0001433 Ga0466965_0001433_4981_6369 410
64 3300044706 Ga0466964_0009998 Ga0466964_0009998_1091_2479 410
65 3300042139 Ga0450904_002082 Ga0450904_002082_293_1675 412
66 3300026116 Ga0207674_10210594 Ga0207674_102105941 413
67 3300031344 Ga0265316_10128383 Ga0265316_101283832 413
68 3300046492 Ga0495585_0007296 Ga0495585_0007296_359_1720 413
69 3300046616 Ga0495668_0020430 Ga0495668_0020430_1681_3060 413
70 3300044706 Ga0466964_0066535 Ga0466964_0066535_122_1444 414
71 3300046491 Ga0495584_0001275 Ga0495584_0001275_8714_10093 415
72 3300046492 Ga0495585_0000518 Ga0495585_0000518_14464_15843 415
73 3300046558 Ga0495633_0007938 Ga0495633_0007938_873_2252 415
74 3300046691 Ga0495670_0032712 Ga0495670_0032712_1116_2525 415
75 3300047323 Ga0495683_0000443 Ga0495683_0000443_9219_10598 415
76 3300053125 Ga0500618_001084 Ga0500618_001084_6777_8162 415
77 3300053139 Ga0500568_0014829 Ga0500568_0014829_123_1490 415
78 3300046457 Ga0495590_0001605 Ga0495590_0001605_3928_5286 416
79 3300046536 Ga0495587_0058125 Ga0495587_0058125_767_2134 416
80 3300002987 JGI25159J45721_1002683 JGI25159J45721_10026837 417
81 3300004625 Ga0055543_1003168 Ga0055543_10031683 417
82 3300005262 Ga0065165_1000120 Ga0065165_100012011 417
83 3300009148 Ga0105243_10025569 Ga0105243_100255691 417
84 3300014968 Ga0157379_10085044 Ga0157379_100850442 417
85 3300025284 Ga0209130_1000057 Ga0209130_1000057188 417
86 3300031711 Ga0265314_10008487 Ga0265314_100084879 417
87 3300046499 Ga0495594_0002614 Ga0495594_0002614_514_1920 417
88 3300053094 Ga0500566_0008490 Ga0500566_0008490_2061_3443 417
89 3300053138 Ga0500564_069435 Ga0500564_069435_62_1444 417
90 3300053144 Ga0500585_014510 Ga0500585_014510_212_1594 417
91 3300053148 Ga0500590_034224 Ga0500590_034224_325_1707 417
92 3300053150 Ga0500603_000757 Ga0500603_000757_1342_2724 417
93 3300046615 Ga0495656_0049401 Ga0495656_0049401_187_1596 418
94 3300049460 Ga0495682_0002383 Ga0495682_0002383_3246_4655 418
95 3300047472 Ga0495686_0000771 Ga0495686_0000771_7112_8470 419
96 3300006847 Ga0075431_100001696 Ga0075431_10000169617 420
97 3300044765 Ga0466970_0021745 Ga0466970_0021745_862_2223 420
98 3300046501 Ga0495607_0001625 Ga0495607_0001625_12491_13903 420
99 3300046507 Ga0495606_0001324 Ga0495606_0001324_19587_20999 420
100 3300035241 Ga0373961_0000082 Ga0373961_0000082_34229_35809 421
101 3300046557 Ga0495622_0000015 Ga0495622_0000015_9656_11065 421
102 3300048905 Ga0496102_0036051 Ga0496102_0036051_513_1892 421
103 3300002774 JGI25150J39212_1001962 JGI25150J39212_10019623 422
104 3300025245 Ga0207425_1000988 Ga0207425_10009888 422
105 3300025294 Ga0209025_1008504 Ga0209025_10085045 422
106 3300025297 Ga0209758_1003937 Ga0209758_10039373 422
107 3300046452 Ga0495617_000169 Ga0495617_000169_5708_7087 422
108 3300046491 Ga0495584_0001980 Ga0495584_0001980_8230_9624 422
109 3300046491 Ga0495584_0004602 Ga0495584_0004602_3607_5037 422
110 3300046492 Ga0495585_0000090 Ga0495585_0000090_5278_6657 422
111 3300046492 Ga0495585_0029963 Ga0495585_0029963_1029_2459 422
112 3300046492 Ga0495585_0085321 Ga0495585_0085321_136_1530 422
113 3300046507 Ga0495606_0002149 Ga0495606_0002149_13849_15222 422
114 3300046513 Ga0495616_0005551 Ga0495616_0005551_5425_6804 422
115 3300046513 Ga0495616_0022927 Ga0495616_0022927_1514_2893 422
116 3300046518 Ga0495631_0017967 Ga0495631_0017967_36_1430 422
117 3300046518 Ga0495631_0035926 Ga0495631_0035926_479_1858 422
118 3300046524 Ga0495648_0000091 Ga0495648_0000091_5719_7098 422
119 3300046525 Ga0495663_0003019 Ga0495663_0003019_2496_3875 422
120 3300046528 Ga0495642_0003672 Ga0495642_0003672_2986_4365 422
121 3300046530 Ga0495654_0035954 Ga0495654_0035954_546_1886 422
122 3300046542 Ga0495597_0018222 Ga0495597_0018222_1742_3121 422
123 3300046558 Ga0495633_0001378 Ga0495633_0001378_12597_13937 422
124 3300046558 Ga0495633_0004046 Ga0495633_0004046_3464_4843 422
125 3300046558 Ga0495633_0009298 Ga0495633_0009298_3010_4389 422
126 3300046615 Ga0495656_0004222 Ga0495656_0004222_2469_3848 422
127 3300046616 Ga0495668_0063296 Ga0495668_0063296_19_1449 422
128 3300046648 Ga0495611_0003039 Ga0495611_0003039_607_1986 422
129 3300046794 Ga0495589_0018006 Ga0495589_0018006_1452_2831 422
130 3300047445 Ga0495677_0009280 Ga0495677_0009280_1220_2599 422
131 3300047470 Ga0495681_0015075 Ga0495681_0015075_1989_3368 422
132 3300049460 Ga0495682_0002041 Ga0495682_0002041_102_1442 422
133 3300006914 Ga0075436_100000083 Ga0075436_10000008321 423
134 3300046558 Ga0495633_0008658 Ga0495633_0008658_4006_5376 423
135 3300047319 Ga0495674_0002462 Ga0495674_0002462_8084_9463 423
136 3300049459 Ga0495678_003559 Ga0495678_003559_7252_8634 423
137 3300050514 nmdc:mga08x19_30_c1 nmdc:mga08x19_30_c1_30962_32386 423
138 3300005545 Ga0070695_100136860 Ga0070695_1001368601 424
139 3300046474 Ga0495605_0056252 Ga0495605_0056252_413_1792 424
140 3300046507 Ga0495606_0003940 Ga0495606_0003940_2834_4213 424
141 3300046518 Ga0495631_0017844 Ga0495631_0017844_1065_2444 424
142 3300046558 Ga0495633_0051653 Ga0495633_0051653_205_1584 424
143 3300046616 Ga0495668_0047160 Ga0495668_0047160_727_2106 424
144 3300046665 Ga0495661_0029525 Ga0495661_0029525_1520_2899 424
145 3300046665 Ga0495661_0051710 Ga0495661_0051710_444_1823 424
146 3300049576 Ga0501040_0050942 Ga0501040_0050942_398_1819 424
147 3300049577 Ga0501041_0093185 Ga0501041_0093185_266_1687 424
148 3300049578 Ga0501042_0058006 Ga0501042_0058006_635_2056 424
149 3300049580 Ga0501046_0054446 Ga0501046_0054446_1102_2523 424
150 3300049582 Ga0501048_0104690 Ga0501048_0104690_425_1846 424
151 3300049591 Ga0501075_0112077 Ga0501075_0112077_307_1728 424
152 3300049592 Ga0501076_0011354 Ga0501076_0011354_659_2080 424
153 3300049741 Ga0501079_0134025 Ga0501079_0134025_160_1581 424
154 3300049824 Ga0501045_0113514 Ga0501045_0113514_335_1756 424
155 3300013102 Ga0157371_10000014 Ga0157371_10000014122 426
156 3300046491 Ga0495584_0000007 Ga0495584_0000007_26113_27492 426
157 3300046492 Ga0495585_0062761 Ga0495585_0062761_431_1810 426
158 3300046506 Ga0495583_0000075 Ga0495583_0000075_22824_24203 426
159 3300046507 Ga0495606_0027116 Ga0495606_0027116_1801_3180 426
160 3300046515 Ga0495620_0013990 Ga0495620_0013990_94_1473 426
161 3300046528 Ga0495642_0004385 Ga0495642_0004385_791_2170 426
162 3300046648 Ga0495611_0045694 Ga0495611_0045694_346_1725 426
163 3300046691 Ga0495670_0002303 Ga0495670_0002303_5948_7327 426
164 3300014497 Ga0182008_10008123 Ga0182008_100081233 427
165 3300031548 Ga0307408_100000929 Ga0307408_10000092916 427
166 3300046457 Ga0495590_0014581 Ga0495590_0014581_828_2234 428
167 3300046460 Ga0495638_0005758 Ga0495638_0005758_3946_5352 428
168 3300046474 Ga0495605_0014579 Ga0495605_0014579_369_1775 428
169 3300046506 Ga0495583_0000016 Ga0495583_0000016_230906_232312 428
170 3300046523 Ga0495644_0030948 Ga0495644_0030948_520_1926 428
171 3300046524 Ga0495648_0014000 Ga0495648_0014000_369_1775 428
172 3300046538 Ga0495609_0004867 Ga0495609_0004867_2296_3702 428
173 3300046660 Ga0495625_0008450 Ga0495625_0008450_1488_2894 428
174 3300047443 Ga0495687_001786 Ga0495687_001786_12376_13782 428
175 3300047445 Ga0495677_0028755 Ga0495677_0028755_520_1926 428
176 3300047447 Ga0495685_000032 Ga0495685_000032_30124_31530 428
177 3300049460 Ga0495682_0000887 Ga0495682_0000887_12870_14276 428
178 3300006028 Ga0070717_10000014 Ga0070717_1000001446 429
179 3300046524 Ga0495648_0004796 Ga0495648_0004796_4707_6077 429
180 3300046492 Ga0495585_0000147 Ga0495585_0000147_4527_5906 430
181 3300046507 Ga0495606_0027114 Ga0495606_0027114_592_1986 430
182 3300046810 Ga0495660_0000225 Ga0495660_0000225_106_1500 430
183 3300047472 Ga0495686_0016639 Ga0495686_0016639_375_1769 430
184 3300021361 Ga0213872_10000035 Ga0213872_100000359 431
185 3300039447 Ga0436361_0087889 Ga0436361_0087889_9374_10738 431
186 3300046491 Ga0495584_0002688 Ga0495584_0002688_5349_6755 431
187 3300046507 Ga0495606_0019199 Ga0495606_0019199_393_1760 431
188 3300046558 Ga0495633_0004677 Ga0495633_0004677_658_2019 431
189 3300046692 Ga0495671_0015582 Ga0495671_0015582_1386_2753 431
190 3300047318 Ga0495636_0000372 Ga0495636_0000372_4382_5749 431
191 3300047323 Ga0495683_0000555 Ga0495683_0000555_11454_12821 431
192 3300044712 Ga0453684_0001075 Ga0453684_0001075_42811_44187 432
193 3300045051 Ga0451576_0000025 Ga0451576_0000025_42541_43917 432
194 3300060353 Ga0501082_0036412 Ga0501082_0036412_425_1846 432
195 3300046528 Ga0495642_0036708 Ga0495642_0036708_84_1472 433
196 3300046674 Ga0495588_0018456 Ga0495588_0018456_1284_2660 433
197 3300049588 Ga0501072_0091051 Ga0501072_0091051_811_2232 433
198 3300021361 Ga0213872_10001028 Ga0213872_100010289 434
199 3300021361 Ga0213872_10031533 Ga0213872_100315332 434
200 3300039447 Ga0436361_0339081 Ga0436361_0339081_8748_10121 434
201 3300039447 Ga0436361_1080527 Ga0436361_1080527_3566_4939 434
202 3300046507 Ga0495606_0000331 Ga0495606_0000331_11917_13299 435
203 3300046522 Ga0495643_0000115 Ga0495643_0000115_122957_124321 435
204 3300046558 Ga0495633_0001935 Ga0495633_0001935_3311_4693 435
205 3300046665 Ga0495661_0006471 Ga0495661_0006471_3294_4676 435
206 3300047320 Ga0495672_0000111 Ga0495672_0000111_7517_8881 435
207 3300049459 Ga0495678_000518 Ga0495678_000518_29039_30403 435
208 3300006847 Ga0075431_100257218 Ga0075431_1002572181 436
209 3300025935 Ga0207709_10024975 Ga0207709_100249754 436
210 3300046535 Ga0495586_0094343 Ga0495586_0094343_227_1606 437
211 3300046690 Ga0495624_0005523 Ga0495624_0005523_6982_8367 437
212 3300047315 Ga0495581_0034575 Ga0495581_0034575_231_1610 437
213 3300047317 Ga0495604_0036902 Ga0495604_0036902_53_1438 437
214 3300047321 Ga0495676_0074304 Ga0495676_0074304_810_2195 437
215 3300047322 Ga0495680_0119962 Ga0495680_0119962_512_1891 437
216 3300046507 Ga0495606_0000133 Ga0495606_0000133_119123_120484 438
217 3300046616 Ga0495668_0000064 Ga0495668_0000064_12834_14195 438
218 3300047472 Ga0495686_0007222 Ga0495686_0007222_4198_5559 438
219 3300005439 Ga0070711_100000021 Ga0070711_10000002161 439
220 3300025916 Ga0207663_10000004 Ga0207663_10000004276 439
221 3300046528 Ga0495642_0025030 Ga0495642_0025030_630_1976 439
222 3300048927 Ga0496124_0006779 Ga0496124_0006779_7102_8526 439
223 iso_pu_bacteria 2643221664 2644359870 439
224 3300005329 Ga0070683_100002063 Ga0070683_1000020637 440
225 3300025944 Ga0207661_10009452 Ga0207661_100094524 440
226 3300039447 Ga0436361_0574593 Ga0436361_0574593_23_1375 440
227 3300046506 Ga0495583_0000205 Ga0495583_0000205_45567_46937 440
228 3300046471 Ga0495650_0000288 Ga0495650_0000288_53422_54822 441
229 3300046491 Ga0495584_0008462 Ga0495584_0008462_1482_3011 441
230 3300046492 Ga0495585_0000561 Ga0495585_0000561_28137_29666 441
231 3300046507 Ga0495606_0001578 Ga0495606_0001578_21051_22451 441
232 3300053178 Ga0500637_0042049 Ga0500637_0042049_40_1389 441
233 iso_pu_bacteria 2643221645 2644255349 441
234 iso_pu_bacteria 2786546940 2788435441 442
235 iso_pu_bacteria 2857547612 2857549670 442
236 3300053156 Ga0500622_0080867 Ga0500622_0080867_88_1533 443
237 3300046457 Ga0495590_0000035 Ga0495590_0000035_44781_46154 444
238 3300046460 Ga0495638_0000023 Ga0495638_0000023_17493_18866 444
239 3300046506 Ga0495583_0000093 Ga0495583_0000093_17159_18532 444
240 3300046538 Ga0495609_0039728 Ga0495609_0039728_170_1543 444
241 3300046557 Ga0495622_0000063 Ga0495622_0000063_13929_15302 444
242 3300048923 Ga0496120_0044604 Ga0496120_0044604_400_1773 444
243 3300048926 Ga0496123_0011143 Ga0496123_0011143_3489_4862 444
244 iso_pu_bacteria 2738541280 2738742512 444
245 iso_pu_bacteria 2738541297 2738825502 444
246 iso_pu_bacteria 2738541300 2738846534 444
247 iso_pu_bacteria 2738541357 2739149299 444
248 iso_pu_bacteria 2738543003 2739191218 444
249 iso_pu_bacteria 2738543018 2739277178 444
250 iso_pu_bacteria 2738543026 2739317695 444
251 iso_pu_bacteria 2738543029 2739335936 444
252 iso_pu_bacteria 2738543030 2739346262 444
253 3300046452 Ga0495617_000007 Ga0495617_000007_360299_361675 445
254 3300046471 Ga0495650_0000274 Ga0495650_0000274_4154_5512 445
255 3300046492 Ga0495585_0006252 Ga0495585_0006252_5463_6839 445
256 3300046512 Ga0495610_0000004 Ga0495610_0000004_783855_785231 445
257 3300046524 Ga0495648_0020334 Ga0495648_0020334_2134_3510 445
258 3300046524 Ga0495648_0020345 Ga0495648_0020345_1539_2915 445
259 3300046530 Ga0495654_0004175 Ga0495654_0004175_1056_2432 445
260 3300046616 Ga0495668_0002600 Ga0495668_0002600_8283_9659 445
261 3300046660 Ga0495625_0001138 Ga0495625_0001138_28925_30283 445
262 3300046665 Ga0495661_0014625 Ga0495661_0014625_2081_3457 445
263 3300046692 Ga0495671_0000177 Ga0495671_0000177_52852_54228 445
264 3300046692 Ga0495671_0047618 Ga0495671_0047618_704_2080 445
265 3300046810 Ga0495660_0003119 Ga0495660_0003119_7441_8817 445
266 3300047469 Ga0495673_0000017 Ga0495673_0000017_469252_470628 445
267 3300047469 Ga0495673_0000027 Ga0495673_0000027_287939_289318 445
268 3300048925 Ga0496122_0098359 Ga0496122_0098359_136_1512 445
269 3300048929 Ga0496126_0012025 Ga0496126_0012025_5848_7227 445
270 3300053145 Ga0500586_006577 Ga0500586_006577_1423_2799 445
271 3300003771 Ga0055526_1000104 Ga0055526_100010462 446
272 3300025295 Ga0209564_1000141 Ga0209564_10001418 446
273 3300046463 Ga0495653_0000297 Ga0495653_0000297_11894_13276 446
274 3300046471 Ga0495650_0000230 Ga0495650_0000230_5386_6738 446
275 3300046518 Ga0495631_0006670 Ga0495631_0006670_926_2299 446
276 3300046523 Ga0495644_0035366 Ga0495644_0035366_454_1827 446
277 3300046557 Ga0495622_0050655 Ga0495622_0050655_269_1642 446
278 3300046616 Ga0495668_0005267 Ga0495668_0005267_3306_4658 446
279 3300048919 Ga0496116_0093421 Ga0496116_0093421_255_1607 446
280 3300053125 Ga0500618_013671 Ga0500618_013671_234_1613 446
281 3300048906 Ga0496103_0027644 Ga0496103_0027644_1904_3289 447
282 iso_pu_bacteria 2842711865 2842715082 447
283 3300046492 Ga0495585_0017363 Ga0495585_0017363_2136_3512 448
284 3300046499 Ga0495594_0042282 Ga0495594_0042282_175_1560 448
285 3300046500 Ga0495596_0002383 Ga0495596_0002383_5432_6808 448
286 3300046506 Ga0495583_0009144 Ga0495583_0009144_4101_5468 448
287 3300046513 Ga0495616_0000048 Ga0495616_0000048_4315_5682 448
288 3300046513 Ga0495616_0011520 Ga0495616_0011520_2475_3851 448
289 3300046522 Ga0495643_0001678 Ga0495643_0001678_13693_15060 448
290 3300046538 Ga0495609_0039682 Ga0495609_0039682_504_1880 448
291 3300046557 Ga0495622_0024144 Ga0495622_0024144_147_1547 448
292 3300046558 Ga0495633_0003688 Ga0495633_0003688_8000_9376 448
293 3300046615 Ga0495656_0022744 Ga0495656_0022744_742_2118 448
294 3300046665 Ga0495661_0028650 Ga0495661_0028650_1728_3104 448
295 3300046679 Ga0495623_0048460 Ga0495623_0048460_120_1520 448
296 3300046684 Ga0495669_0000710 Ga0495669_0000710_7365_8741 448
297 3300046809 Ga0495600_0017831 Ga0495600_0017831_135_1535 448
298 3300047315 Ga0495581_0009206 Ga0495581_0009206_1151_2551 448
299 3300047317 Ga0495604_0035040 Ga0495604_0035040_720_2120 448
300 3300047673 Ga0495593_0002458 Ga0495593_0002458_5666_7066 448
301 3300048088 Ga0495602_0013366 Ga0495602_0013366_5672_7072 448
302 3300048918 Ga0496115_0078335 Ga0496115_0078335_814_2193 448
303 3300046474 Ga0495605_0000071 Ga0495605_0000071_5556_6917 449
304 3300046522 Ga0495643_0001307 Ga0495643_0001307_8436_9830 449
305 3300046524 Ga0495648_0000025 Ga0495648_0000025_214514_215908 449
306 3300046528 Ga0495642_0016853 Ga0495642_0016853_1295_2689 449
307 3300046542 Ga0495597_0000361 Ga0495597_0000361_24856_26250 449
308 3300046558 Ga0495633_0000050 Ga0495633_0000050_23996_25390 449
309 3300046616 Ga0495668_0002309 Ga0495668_0002309_491_1885 449
310 3300046660 Ga0495625_0000123 Ga0495625_0000123_82155_83549 449
311 3300047472 Ga0495686_0000169 Ga0495686_0000169_5763_7142 449
312 3300049459 Ga0495678_001329 Ga0495678_001329_17789_19183 449
313 3300002738 JGI25154J39366_1000495 JGI25154J39366_100049514 451
314 3300003771 Ga0055526_1000010 Ga0055526_1000010191 451
315 3300025233 Ga0209437_102687 Ga0209437_1026874 451
316 3300025246 Ga0209646_1000036 Ga0209646_1000036177 451
317 3300025295 Ga0209564_1000060 Ga0209564_100006098 451
318 3300039447 Ga0436361_0775460 Ga0436361_0775460_4016_5389 451
319 3300046542 Ga0495597_0000355 Ga0495597_0000355_34838_36202 451
320 3300046660 Ga0495625_0010474 Ga0495625_0010474_3953_5317 451

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04389

Peptidase_M28

Peptidase family M28

160

385

0.8

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

165

386

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bxr-assembly1.cif.gz_A titin fniii-domain i109-i111 (i/a4-a/a6) from the mir region 0.8205 363 447
5n48-assembly1.cif.gz_B structure of anticalin n9b in complex with extra-domain b of human oncofetal fibronectin 0.8137 365 448
5e53-assembly1.cif.gz_A crystal structure of chicken cntn1 fn1-fn3 domains 0.8126 362 445
2dju-assembly1.cif.gz_A solution structures of the fn3 domain of human receptor-type tyrosine-protein phosphatase f 0.8108 362 445
8bvo-assembly1.cif.gz_A titin i110-i111 fniii tandem from the mir region (i/a5-i/a6) 0.8077 363 447
ID Description Score Start End Superfamily
5ib9A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8322 30 356 3.40.630.10
af_A0A2R8RVM5_101_187_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.82 363 442 2.60.40.10
2djuA00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8108 362 445 2.60.40.10
af_Q12860_814_899_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8084 369 445 2.60.40.10
4u3hA00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8062 363 445 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A3D3PIF8-F1-model_v4 Aminopeptidase 0.9869 76 451 GO:0004177
GO:0006508
GO:0008235
AF-A0A538PWR8-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.981 8 451 GO:0006508
GO:0008235
AF-A0A3D3PIF8-F1-model_v4 Aminopeptidase 0.9792 76 451 GO:0004177
GO:0006508
GO:0008235
AF-A0A3A4B3W8-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9791 34 451 GO:0000272
GO:0006508
GO:0008235
GO:0016798
AF-A0A3D5SJR8-F1-model_v4 Aminopeptidase 0.9789 25 451 GO:0004177
GO:0006508
GO:0008235

Feature Viewer

pLDDT pTM Quality
88.91 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map