F405580

General Info

Members Datasets Scaffolds Average Seq Length
320 195 320 267

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_10062777|Ga0268266_100627773
Length 326
Sequence VVPPLPKRSLRWGLGVSVIERGQCRRSTGVLLTKRKYLVENPSPIKDLFDVCADSLRPGMNLSGRKALLTGATGGLGRAIARSLAERGAQVALSARNREALEAFAAELPGSGHSVLPADLAEPDAAERLAXEATGTEILIANAGLPGAGRLDEFSAEEVKRALRVNLEAPMLLARALYPAMLEAGSGHLVFVASLSGKAASPRSSIYNATKFGLRGFSLGLRADLGPQGIGVSIVSPGFIREAGMFADAGAKPPPGMGTSTPEQVGAATVKAIEKNKVEVTIAPLTQRAGAHLALVSPSLSVKVQSGSAGQKAAKDIASGHSSDKR

Samples

Sample ID Description Type Environment
1 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
86 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
87 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
88 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
89 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
90 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
95 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
101 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
115 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
194 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.31
Nodule 0
Rhizoplane 16.88
Rhizosphere 70.62
Stem 0
Stem Tuber 0
Unclassified 7.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10000844 3300002239 Bacteria 3990
2 JGI24742J22300_10002022 3300002244 Bacteria 3239
3 Ga0070683_100108507 3300005329 Bacteria 2618
4 Ga0070670_100052245 3300005331 Bacteria 3510
5 Ga0070677_10001097 3300005333 Bacteria 8701
6 Ga0070680_100181076 3300005336 Bacteria 1775
7 Ga0070660_100082346 3300005339 Bacteria 2527
8 Ga0070691_10000011 3300005341 Bacteria 57498
9 Ga0070668_100636290 3300005347 Bacteria 936
10 Ga0070674_100000011 3300005356 Bacteria 134886
11 Ga0070673_100003239 3300005364 Bacteria 10098
12 Ga0070688_100008869 3300005365 Bacteria 5474
13 Ga0070667_100004881 3300005367 Bacteria 11227
14 Ga0070701_10126235 3300005438 Bacteria 1448
15 Ga0070663_100002455 3300005455 Bacteria 10446
16 Ga0070685_10000062 3300005466 Bacteria 62782
17 Ga0070679_100000658 3300005530 Bacteria 29449
18 Ga0070679_100015466 3300005530 Bacteria 7332
19 Ga0070684_100021270 3300005535 Bacteria 5395
20 Ga0070684_100326060 3300005535 Bacteria 1411
21 Ga0068853_100009307 3300005539 Bacteria 7922
22 Ga0070664_100179572 3300005564 Bacteria 1881
23 Ga0068854_100050956 3300005578 Bacteria 2964
24 Ga0068856_100000758 3300005614 Bacteria 35052
25 Ga0068856_100057046 3300005614 Bacteria 3855
26 Ga0068863_100000042 3300005841 Bacteria 154459
27 Ga0068860_100004950 3300005843 Bacteria 13576
28 Ga0068860_100044348 3300005843 Bacteria 4238
29 Ga0068862_100008903 3300005844 Bacteria 8309
30 Ga0081455_10007155 3300005937 Bacteria 11808
31 Ga0081455_10007267 3300005937 Bacteria 11692
32 Ga0081455_10022634 3300005937 Bacteria 5868
33 Ga0081455_10130947 3300005937 Bacteria 1961
34 Ga0081538_10024188 3300005981 Bacteria 4333
35 Ga0081538_10034575 3300005981 Bacteria 3338
36 Ga0081540_1000153 3300005983 Bacteria 70813
37 Ga0081540_1068387 3300005983 Bacteria 1655
38 Ga0075365_10000598 3300006038 Bacteria 14138
39 Ga0075365_10140355 3300006038 Bacteria 1677
40 Ga0075363_100042336 3300006048 Bacteria 2406
41 Ga0075364_10013463 3300006051 Bacteria 5030
42 Ga0075364_10061175 3300006051 Bacteria 2469
43 Ga0075364_10118599 3300006051 Bacteria 1770
44 Ga0075364_10270158 3300006051 Bacteria 1156
45 Ga0070715_10000105 3300006163 Bacteria 20466
46 Ga0097621_100549444 3300006237 Bacteria 1051
47 Ga0068871_100328578 3300006358 Bacteria 1348
48 Ga0075428_100125682 3300006844 Bacteria 2791
49 Ga0075428_100383132 3300006844 Bacteria 1507
50 Ga0075431_100001556 3300006847 Bacteria 21288
51 Ga0075433_10000476 3300006852 Bacteria 26119
52 Ga0075433_10006214 3300006852 Bacteria 9423
53 Ga0075434_100029287 3300006871 Bacteria 5415
54 Ga0111539_10147128 3300009094 Bacteria 2758
55 Ga0105245_10001390 3300009098 Bacteria 21921
56 Ga0105245_10001630 3300009098 Bacteria 20423
57 Ga0105245_10036340 3300009098 Bacteria 4375
58 Ga0105245_10259409 3300009098 Bacteria 1691
59 Ga0105247_10049422 3300009101 Bacteria 2586
60 Ga0114129_10046625 3300009147 Bacteria 6090
61 Ga0114129_10079312 3300009147 Bacteria 4566
62 Ga0105238_10000051 3300009551 Bacteria 141705
63 Ga0105249_10000085 3300009553 Bacteria 133497
64 Ga0105249_10112762 3300009553 Bacteria 2572
65 Ga0105239_10041042 3300010375 Bacteria 5071
66 Ga0157371_10001825 3300013102 Bacteria 21451
67 Ga0157375_10000184 3300013308 Bacteria 58368
68 Ga0157375_10011557 3300013308 Bacteria 7799
69 Ga0157375_10427972 3300013308 Bacteria 1490
70 Ga0163163_10125800 3300014325 Bacteria 2601
71 Ga0157379_10002454 3300014968 Bacteria 15540
72 Ga0157379_10169797 3300014968 Bacteria 1969
73 Ga0213876_10035638 3300021384 Bacteria 2624
74 Ga0213876_10036526 3300021384 Bacteria 2591
75 Ga0213875_10012303 3300021388 Bacteria 4231
76 Ga0207682_10000470 3300025893 Bacteria 18663
77 Ga0207642_10000001 3300025899 Bacteria 714030
78 Ga0207642_10000003 3300025899 Bacteria 650651
79 Ga0207685_10000001 3300025905 Bacteria 604473
80 Ga0207707_10037980 3300025912 Bacteria 4207
81 Ga0207671_10191545 3300025914 Bacteria 1595
82 Ga0207663_10098883 3300025916 Bacteria 1954
83 Ga0207657_10234581 3300025919 Bacteria 1466
84 Ga0207649_10000021 3300025920 Bacteria 209660
85 Ga0207652_10000150 3300025921 Bacteria 75189
86 Ga0207652_10002609 3300025921 Bacteria 15140
87 Ga0207681_10316777 3300025923 Bacteria 1239
88 Ga0207694_10000035 3300025924 Bacteria 195870
89 Ga0207650_10029145 3300025925 Bacteria 3965
90 Ga0207687_10000058 3300025927 Bacteria 85860
91 Ga0207687_10001129 3300025927 Bacteria 18177
92 Ga0207644_10282061 3300025931 Bacteria 1334
93 Ga0207669_10000027 3300025937 Bacteria 91216
94 Ga0207704_10000029 3300025938 Bacteria 120526
95 Ga0207661_10004638 3300025944 Bacteria 9629
96 Ga0207661_10025894 3300025944 Bacteria 4464
97 Ga0207661_10102024 3300025944 Bacteria 2412
98 Ga0207679_10023984 3300025945 Bacteria 4179
99 Ga0207667_10282555 3300025949 Unclassified 1696
100 Ga0207712_10000033 3300025961 Bacteria 209336
101 Ga0207712_10450626 3300025961 Bacteria 1091
102 Ga0207668_10121999 3300025972 Bacteria 1975
103 Ga0207640_10036004 3300025981 Bacteria 3103
104 Ga0207658_10002913 3300025986 Bacteria 12248
105 Ga0207639_10002347 3300026041 Bacteria 12724
106 Ga0207639_10021128 3300026041 Bacteria 4670
107 Ga0207678_10003823 3300026067 Bacteria 13545
108 Ga0207702_10000333 3300026078 Bacteria 54074
109 Ga0207702_10006289 3300026078 Bacteria 10257
110 Ga0207702_10007867 3300026078 Bacteria 9038
111 Ga0207641_10000066 3300026088 Bacteria 155638
112 Ga0207674_10569020 3300026116 Bacteria 1095
113 Ga0207675_100081922 3300026118 Bacteria 3026
114 Ga0207683_10165264 3300026121 Bacteria 2002
115 Ga0268266_10062777 3300028379 Bacteria 3207
116 Ga0268266_10152886 3300028379 Bacteria 2082
117 Ga0268265_10027838 3300028380 Bacteria 4039
118 Ga0268264_10010145 3300028381 Bacteria 7795
119 Ga0268264_10069157 3300028381 Bacteria 2986
120 Ga0268264_10124594 3300028381 Bacteria 2275
121 Ga0265326_10000088 3300028558 Bacteria 48958
122 Ga0265322_10000006 3300028654 Bacteria 231685
123 Ga0265324_10000713 3300029957 Bacteria 22085
124 Ga0265328_10007555 3300031239 Bacteria 4527
125 Ga0265320_10000001 3300031240 Bacteria 847191
126 Ga0265329_10007022 3300031242 Bacteria 4397
127 Ga0265331_10003616 3300031250 Bacteria 9887
128 Ga0265327_10000003 3300031251 Bacteria 852750
129 Ga0265327_10059489 3300031251 Bacteria 1956
130 Ga0265314_10000103 3300031711 Bacteria 127956
131 Ga0316576_10013603 3300031727 Bacteria 5415
132 Ga0316578_10131326 3300031728 Bacteria 1507
133 Ga0373955_0112673 3300035172 Bacteria 1574
134 Ga0316574_0386373 3300035398 Bacteria 883
135 Ga0373933_0046279 3300035724 Bacteria 2583
136 Ga0373937_0171786 3300036401 Bacteria 2034
137 Ga0316582_0316133 3300036647 Bacteria 1073
138 Ga0316584_0006276 3300036712 Bacteria 8051
139 Ga0316584_0069844 3300036712 Bacteria 2634
140 Ga0395900_0056800 3300037418 Bacteria 4029
141 Ga0395900_0273087 3300037418 Bacteria 1685
142 Ga0395898_0033225 3300037466 Bacteria 5150
143 Ga0395898_0069455 3300037466 Bacteria 3408
144 Ga0395898_0076597 3300037466 Bacteria 3230
145 Ga0395898_0182471 3300037466 Bacteria 2006
146 Ga0395898_0434383 3300037466 Bacteria 1251
147 Ga0395905_0279653 3300037471 Bacteria 1555
148 Ga0395905_0324512 3300037471 Bacteria 1430
149 Ga0395905_0420439 3300037471 Bacteria 1233
150 Ga0436364_0151788 3300037853 Bacteria 9637
151 Ga0395901_0051029 3300038443 Bacteria 4299
152 Ga0395901_0053223 3300038443 Bacteria 4206
153 Ga0395901_0058568 3300038443 Bacteria 4006
154 Ga0395901_0222250 3300038443 Bacteria 1974
155 Ga0436365_0446656 3300039437 Bacteria 4552
156 Ga0436365_1211880 3300039437 Bacteria 11484
157 Ga0436363_0149963 3300039450 Bacteria 1212
158 Ga0436363_0993426 3300039450 Bacteria 8152
159 Ga0436363_1051090 3300039450 Bacteria 3788
160 Ga0436362_0307053 3300039453 Bacteria 4257
161 Ga0451853_2759690 3300041512 Bacteria 3310
162 Ga0451853_3486967 3300041512 Unclassified 1140
163 Ga0439460_0090754 3300042461 Bacteria 971
164 Ga0466966_0286313 3300044684 Bacteria 991
165 Ga0466963_0160443 3300044694 Bacteria 1565
166 Ga0466963_0163908 3300044694 Bacteria 1548
167 Ga0466968_0033674 3300044735 Unclassified 2135
168 Ga0466960_0000048 3300044901 Bacteria 40114
169 Ga0466958_0055593 3300045836 Bacteria 2402
170 Ga0466958_0224561 3300045836 Bacteria 1198
171 Ga0466967_0000072 3300045976 Bacteria 37332
172 Ga0495603_0000045 3300046455 Bacteria 53543
173 Ga0495629_0212019 3300046459 Bacteria 1337
174 Ga0495629_0442275 3300046459 Bacteria 881
175 Ga0495641_0000001 3300046461 Bacteria 485224
176 Ga0495641_0025666 3300046461 Bacteria 2890
177 Ga0495650_0000054 3300046471 Bacteria 313631
178 Ga0495606_0000131 3300046507 Bacteria 127298
179 Ga0495620_0000325 3300046515 Bacteria 33527
180 Ga0495628_0053260 3300046516 Bacteria 3194
181 Ga0495637_0034216 3300046520 Bacteria 2227
182 Ga0495587_0013676 3300046536 Bacteria 5097
183 Ga0495598_0003783 3300046537 Bacteria 3236
184 Ga0495634_0001214 3300046642 Bacteria 23764
185 Ga0495625_0000213 3300046660 Bacteria 91768
186 Ga0495588_0000202 3300046674 Bacteria 59591
187 Ga0495588_0064576 3300046674 Bacteria 1899
188 Ga0495657_0020853 3300046675 Bacteria 4709
189 Ga0495657_0080771 3300046675 Bacteria 2104
190 Ga0495599_0003216 3300046678 Bacteria 9515
191 Ga0495647_0000003 3300046681 Bacteria 145235
192 Ga0495658_0034967 3300046683 Bacteria 2760
193 Ga0495669_0000065 3300046684 Bacteria 69983
194 Ga0495624_0000305 3300046690 Bacteria 38658
195 Ga0495624_0023057 3300046690 Bacteria 4107
196 Ga0495649_0009523 3300046694 Bacteria 5763
197 Ga0495604_0000131 3300047317 Bacteria 63337
198 Ga0495674_0226037 3300047319 Bacteria 1546
199 Ga0495672_0068941 3300047320 Bacteria 2009
200 Ga0495676_0025770 3300047321 Bacteria 5072
201 Ga0495680_0002055 3300047322 Bacteria 21001
202 Ga0495680_0003667 3300047322 Bacteria 14993
203 Ga0495680_0076937 3300047322 Bacteria 2529
204 Ga0495675_0004905 3300047444 Bacteria 8147
205 Ga0495684_0367686 3300047471 Bacteria 1017
206 Ga0495602_0131319 3300048088 Bacteria 1997
207 Ga0495602_0165896 3300048088 Bacteria 1719
208 Ga0496100_0000003 3300048903 Bacteria 360802
209 Ga0496100_0000027 3300048903 Bacteria 115829
210 Ga0496100_0385442 3300048903 Bacteria 1065
211 Ga0496101_0000003 3300048904 Bacteria 406565
212 Ga0496101_0000012 3300048904 Bacteria 268127
213 Ga0496102_0122837 3300048905 Bacteria 2426
214 Ga0496102_0620608 3300048905 Bacteria 1004
215 Ga0496103_0274692 3300048906 Bacteria 1084
216 Ga0496104_0000007 3300048907 Bacteria 524804
217 Ga0496104_0051891 3300048907 Bacteria 3872
218 Ga0496104_0151206 3300048907 Bacteria 2228
219 Ga0496104_0280410 3300048907 Bacteria 1580
220 Ga0496105_0000002 3300048908 Bacteria 753215
221 Ga0496105_0015175 3300048908 Bacteria 6133
222 Ga0496105_0093865 3300048908 Bacteria 2478
223 Ga0496106_0000015 3300048909 Bacteria 187570
224 Ga0496106_0000020 3300048909 Bacteria 169168
225 Ga0496106_0000147 3300048909 Bacteria 51986
226 Ga0496107_0000008 3300048910 Bacteria 251874
227 Ga0496107_0000014 3300048910 Bacteria 176738
228 Ga0496107_0022506 3300048910 Bacteria 4454
229 Ga0496107_0050493 3300048910 Bacteria 2998
230 Ga0496107_0088750 3300048910 Bacteria 2257
231 Ga0496108_0000025 3300048911 Bacteria 177919
232 Ga0496108_0179230 3300048911 Bacteria 1834
233 Ga0496108_0289804 3300048911 Bacteria 1425
234 Ga0496109_0000025 3300048912 Bacteria 171741
235 Ga0496109_0000103 3300048912 Bacteria 88192
236 Ga0496109_0000155 3300048912 Bacteria 66634
237 Ga0496109_0098068 3300048912 Bacteria 2717
238 Ga0496109_0210755 3300048912 Bacteria 1827
239 Ga0496109_0240071 3300048912 Bacteria 1705
240 Ga0496109_0249823 3300048912 Bacteria 1670
241 Ga0496109_0281854 3300048912 Bacteria 1566
242 Ga0496109_0851342 3300048912 Bacteria 850
243 Ga0496110_0000003 3300048913 Bacteria 144124
244 Ga0496110_0002724 3300048913 Bacteria 13344
245 Ga0496110_0111709 3300048913 Bacteria 2457
246 Ga0496110_0159192 3300048913 Bacteria 2046
247 Ga0496110_0403228 3300048913 Bacteria 1246
248 Ga0496110_0555799 3300048913 Bacteria 1043
249 Ga0496111_0000007 3300048914 Bacteria 103885
250 Ga0496111_0061258 3300048914 Bacteria 2728
251 Ga0496112_0000003 3300048915 Bacteria 660147
252 Ga0496112_0018625 3300048915 Bacteria 6542
253 Ga0496112_0047641 3300048915 Bacteria 4205
254 Ga0496112_0097216 3300048915 Bacteria 2915
255 Ga0496112_0107900 3300048915 Bacteria 2754
256 Ga0496113_0038045 3300048916 Bacteria 3535
257 Ga0496113_0044856 3300048916 Bacteria 3276
258 Ga0496114_0000010 3300048917 Bacteria 363396
259 Ga0496115_0000004 3300048918 Bacteria 319734
260 Ga0496115_0000082 3300048918 Bacteria 87212
261 Ga0496115_0003398 3300048918 Bacteria 11429
262 Ga0496116_0000383 3300048919 Bacteria 65450
263 Ga0496117_0008110 3300048920 Bacteria 10045
264 Ga0496118_0005965 3300048921 Bacteria 13596
265 Ga0496119_0000740 3300048922 Bacteria 43968
266 Ga0496119_0007034 3300048922 Bacteria 10239
267 Ga0496119_0022679 3300048922 Bacteria 4484
268 Ga0496120_0002553 3300048923 Bacteria 18162
269 Ga0496121_0006796 3300048924 Bacteria 14015
270 Ga0496121_0010640 3300048924 Bacteria 10329
271 Ga0496121_0162036 3300048924 Bacteria 1634
272 Ga0496125_0018716 3300048928 Bacteria 6567
273 Ga0496126_0046828 3300048929 Bacteria 3962
274 Ga0501034_0353055 3300049571 Bacteria 1398
275 Ga0501034_0712389 3300049571 Bacteria 901
276 Ga0501043_0309278 3300049579 Bacteria 1206
277 Ga0501047_0015201 3300049581 Bacteria 7329
278 Ga0501047_0493567 3300049581 Bacteria 1051
279 Ga0501048_0032956 3300049582 Bacteria 3744
280 Ga0501070_0084582 3300049586 Bacteria 2626
281 Ga0501071_0039001 3300049587 Bacteria 3397
282 Ga0501072_0092516 3300049588 Bacteria 2402
283 Ga0501074_0027620 3300049590 Bacteria 4115
284 Ga0501079_0017928 3300049741 Bacteria 5406
285 Ga0501080_0130204 3300049742 Bacteria 2329
286 Ga0501080_0250595 3300049742 Unclassified 1615
287 Ga0501080_0440445 3300049742 Bacteria 1169
288 Ga0501083_0004541 3300049744 Bacteria 9805
289 Ga0501083_0068662 3300049744 Bacteria 2358
290 Ga0501044_0119827 3300049823 Bacteria 2633
291 Ga0501045_0062248 3300049824 Bacteria 2738
292 Ga0501045_0083496 3300049824 Bacteria 2357
293 Ga0501045_0302399 3300049824 Bacteria 1190
294 nmdc:mga00v17_210218_c1 3300050491 Bacteria 1259
295 nmdc:mga00v17_338314_c1 3300050491 Bacteria 978
296 nmdc:mga00v17_88070_c1 3300050491 Bacteria 1946
297 nmdc:mga00v17_92861_c1 3300050491 Bacteria 1897
298 nmdc:mga0yw44_103835_c1 3300050492 Bacteria 1813
299 nmdc:mga0yw44_1782_c1 3300050492 Bacteria 8786
300 nmdc:mga0yw44_37309_c1 3300050492 Bacteria 2869
301 nmdc:mga0yw44_9247_c1 3300050492 Bacteria 4964
302 nmdc:mga05p37_392209_c1 3300050507 Bacteria 1623
303 nmdc:mga06r32_4272_c1 3300050510 Bacteria 12794
304 nmdc:mga08y16_17753_c1 3300050511 Bacteria 7493
305 nmdc:mga0n895_28014_c1 3300050512 Bacteria 5356
306 nmdc:mga0a205_4293_c1 3300050515 Bacteria 12790
307 Ga0495601_0000061 3300053077 Bacteria 60136
308 Ga0495601_0032374 3300053077 Bacteria 3255
309 Ga0495601_0135348 3300053077 Bacteria 1606
310 Ga0495612_0000142 3300053078 Bacteria 30222
311 Ga0495612_0005176 3300053078 Bacteria 5388
312 Ga0495619_0000103 3300053085 Bacteria 64239
313 Ga0495619_0003692 3300053085 Bacteria 9868
314 Ga0495619_0007420 3300053085 Bacteria 6949
315 Ga0495619_0390837 3300053085 Bacteria 961
316 Ga0500614_000043 3300053123 Bacteria 27265
317 Ga0500616_0010396 3300053153 Bacteria 5571
318 Ga0530510_0091722 3300061734 Bacteria 2217
319 Ga0530510_0221221 3300061734 Bacteria 1407
320 Ga0530510_0233685 3300061734 Bacteria 1368

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_392209_c1 nmdc:mga05p37_392209_c1_132_932 228
2 3300009147 Ga0114129_10046625 Ga0114129_100466259 229
3 3300048916 Ga0496113_0038045 Ga0496113_0038045_2682_3473 229
4 3300048912 Ga0496109_0851342 Ga0496109_0851342_13_804 230
5 3300048915 Ga0496112_0047641 Ga0496112_0047641_959_1750 230
6 3300046683 Ga0495658_0034967 Ga0495658_0034967_801_1763 231
7 3300048088 Ga0495602_0131319 Ga0495602_0131319_290_1180 232
8 3300049571 Ga0501034_0353055 Ga0501034_0353055_95_886 232
9 3300046507 Ga0495606_0000131 Ga0495606_0000131_61615_62499 233
10 3300046471 Ga0495650_0000054 Ga0495650_0000054_42410_43201 237
11 3300048913 Ga0496110_0159192 Ga0496110_0159192_941_1825 238
12 3300048914 Ga0496111_0061258 Ga0496111_0061258_1431_2315 238
13 3300031251 Ga0265327_10059489 Ga0265327_100594892 249
14 3300047320 Ga0495672_0068941 Ga0495672_0068941_1089_1958 249
15 3300037471 Ga0395905_0420439 Ga0395905_0420439_343_1134 251
16 3300025938 Ga0207704_10000029 Ga0207704_10000029100 252
17 3300021384 Ga0213876_10035638 Ga0213876_100356381 253
18 3300039437 Ga0436365_1211880 Ga0436365_1211880_4331_5122 253
19 3300044901 Ga0466960_0000048 Ga0466960_0000048_35832_36623 253
20 3300025920 Ga0207649_10000021 Ga0207649_1000002145 254
21 3300037471 Ga0395905_0324512 Ga0395905_0324512_576_1367 255
22 3300053153 Ga0500616_0010396 Ga0500616_0010396_1308_2099 255
23 3300005367 Ga0070667_100004881 Ga0070667_1000048812 256
24 3300005843 Ga0068860_100044348 Ga0068860_1000443483 256
25 3300025986 Ga0207658_10002913 Ga0207658_100029134 256
26 3300028381 Ga0268264_10124594 Ga0268264_101245942 256
27 3300006844 Ga0075428_100125682 Ga0075428_1001256822 257
28 3300006847 Ga0075431_100001556 Ga0075431_1000015562 257
29 3300006871 Ga0075434_100029287 Ga0075434_1000292875 257
30 3300009094 Ga0111539_10147128 Ga0111539_101471281 257
31 3300050510 nmdc:mga06r32_4272_c1 nmdc:mga06r32_4272_c1_1536_2399 257
32 3300050511 nmdc:mga08y16_17753_c1 nmdc:mga08y16_17753_c1_6600_7463 257
33 3300050512 nmdc:mga0n895_28014_c1 nmdc:mga0n895_28014_c1_3735_4598 257
34 3300005937 Ga0081455_10007267 Ga0081455_100072674 259
35 3300005339 Ga0070660_100082346 Ga0070660_1000823462 263
36 3300005347 Ga0070668_100636290 Ga0070668_1006362901 263
37 3300005535 Ga0070684_100326060 Ga0070684_1003260602 263
38 3300013308 Ga0157375_10427972 Ga0157375_104279722 263
39 3300014325 Ga0163163_10125800 Ga0163163_101258002 263
40 3300014968 Ga0157379_10002454 Ga0157379_100024545 263
41 3300021384 Ga0213876_10036526 Ga0213876_100365262 263
42 3300021388 Ga0213875_10012303 Ga0213875_100123032 263
43 3300025919 Ga0207657_10234581 Ga0207657_102345812 263
44 3300025944 Ga0207661_10102024 Ga0207661_101020242 263
45 3300025972 Ga0207668_10121999 Ga0207668_101219992 263
46 3300026116 Ga0207674_10569020 Ga0207674_105690202 263
47 3300026118 Ga0207675_100081922 Ga0207675_1000819222 263
48 3300037466 Ga0395898_0182471 Ga0395898_0182471_676_1467 263
49 3300037853 Ga0436364_0151788 Ga0436364_0151788_5678_6469 263
50 3300038443 Ga0395901_0051029 Ga0395901_0051029_191_988 263
51 3300038443 Ga0395901_0222250 Ga0395901_0222250_464_1255 263
52 3300039437 Ga0436365_0446656 Ga0436365_0446656_3239_4030 263
53 3300039450 Ga0436363_0149963 Ga0436363_0149963_336_1127 263
54 3300039450 Ga0436363_0993426 Ga0436363_0993426_5120_5911 263
55 3300039450 Ga0436363_1051090 Ga0436363_1051090_169_960 263
56 3300039453 Ga0436362_0307053 Ga0436362_0307053_2433_3224 263
57 3300044684 Ga0466966_0286313 Ga0466966_0286313_90_890 263
58 3300044694 Ga0466963_0160443 Ga0466963_0160443_94_885 263
59 3300044694 Ga0466963_0163908 Ga0466963_0163908_150_950 263
60 3300044735 Ga0466968_0033674 Ga0466968_0033674_60_857 263
61 3300045836 Ga0466958_0055593 Ga0466958_0055593_247_1047 263
62 3300046674 Ga0495588_0064576 Ga0495588_0064576_173_964 263
63 3300048907 Ga0496104_0151206 Ga0496104_0151206_256_1053 263
64 3300048907 Ga0496104_0280410 Ga0496104_0280410_258_1055 263
65 3300048908 Ga0496105_0093865 Ga0496105_0093865_1216_2013 263
66 3300048911 Ga0496108_0289804 Ga0496108_0289804_60_857 263
67 3300048912 Ga0496109_0240071 Ga0496109_0240071_890_1687 263
68 3300048912 Ga0496109_0281854 Ga0496109_0281854_86_883 263
69 3300048913 Ga0496110_0555799 Ga0496110_0555799_65_862 263
70 3300048915 Ga0496112_0018625 Ga0496112_0018625_3448_4245 263
71 3300048915 Ga0496112_0097216 Ga0496112_0097216_1176_1973 263
72 3300048916 Ga0496113_0044856 Ga0496113_0044856_498_1295 263
73 3300048924 Ga0496121_0006796 Ga0496121_0006796_6939_7733 263
74 3300005844 Ga0068862_100008903 Ga0068862_1000089038 264
75 3300025923 Ga0207681_10316777 Ga0207681_103167772 264
76 3300028380 Ga0268265_10027838 Ga0268265_100278382 264
77 3300005438 Ga0070701_10126235 Ga0070701_101262351 265
78 3300006038 Ga0075365_10000598 Ga0075365_100005982 265
79 3300006051 Ga0075364_10118599 Ga0075364_101185991 265
80 3300006844 Ga0075428_100383132 Ga0075428_1003831322 265
81 3300009098 Ga0105245_10001390 Ga0105245_100013902 265
82 3300009147 Ga0114129_10079312 Ga0114129_100793122 265
83 3300009553 Ga0105249_10112762 Ga0105249_101127622 265
84 3300035398 Ga0316574_0386373 Ga0316574_0386373_54_866 265
85 3300036647 Ga0316582_0316133 Ga0316582_0316133_80_892 265
86 3300036712 Ga0316584_0069844 Ga0316584_0069844_1733_2545 265
87 3300037418 Ga0395900_0056800 Ga0395900_0056800_3150_3947 265
88 3300037466 Ga0395898_0033225 Ga0395898_0033225_2332_3129 265
89 3300037466 Ga0395898_0069455 Ga0395898_0069455_250_1047 265
90 3300038443 Ga0395901_0053223 Ga0395901_0053223_3065_3862 265
91 3300038443 Ga0395901_0058568 Ga0395901_0058568_3063_3860 265
92 3300047319 Ga0495674_0226037 Ga0495674_0226037_702_1502 265
93 3300048911 Ga0496108_0179230 Ga0496108_0179230_470_1267 265
94 3300048913 Ga0496110_0403228 Ga0496110_0403228_285_1082 265
95 3300048915 Ga0496112_0107900 Ga0496112_0107900_1742_2539 265
96 3300049588 Ga0501072_0092516 Ga0501072_0092516_919_1716 265
97 3300049742 Ga0501080_0250595 Ga0501080_0250595_63_860 265
98 3300049824 Ga0501045_0062248 Ga0501045_0062248_339_1136 265
99 3300049824 Ga0501045_0083496 Ga0501045_0083496_707_1504 265
100 3300049824 Ga0501045_0302399 Ga0501045_0302399_135_1019 265
101 3300050492 nmdc:mga0yw44_1782_c1 nmdc:mga0yw44_1782_c1_7967_8764 265
102 3300050492 nmdc:mga0yw44_9247_c1 nmdc:mga0yw44_9247_c1_3813_4610 265
103 3300053077 Ga0495601_0032374 Ga0495601_0032374_133_933 265
104 3300053078 Ga0495612_0000142 Ga0495612_0000142_22395_23195 265
105 3300053085 Ga0495619_0007420 Ga0495619_0007420_176_976 265
106 3300053085 Ga0495619_0390837 Ga0495619_0390837_112_912 265
107 3300061734 Ga0530510_0091722 Ga0530510_0091722_1149_1946 265
108 3300061734 Ga0530510_0221221 Ga0530510_0221221_557_1354 265
109 3300061734 Ga0530510_0233685 Ga0530510_0233685_180_1025 265
110 3300002239 JGI24034J26672_10000844 JGI24034J26672_100008444 266
111 3300002244 JGI24742J22300_10002022 JGI24742J22300_100020224 266
112 3300005329 Ga0070683_100108507 Ga0070683_1001085072 266
113 3300005331 Ga0070670_100052245 Ga0070670_1000522452 266
114 3300005333 Ga0070677_10001097 Ga0070677_100010979 266
115 3300005336 Ga0070680_100181076 Ga0070680_1001810761 266
116 3300005341 Ga0070691_10000011 Ga0070691_1000001135 266
117 3300005356 Ga0070674_100000011 Ga0070674_10000001152 266
118 3300005364 Ga0070673_100003239 Ga0070673_1000032399 266
119 3300005365 Ga0070688_100008869 Ga0070688_1000088692 266
120 3300005455 Ga0070663_100002455 Ga0070663_10000245510 266
121 3300005466 Ga0070685_10000062 Ga0070685_1000006254 266
122 3300005530 Ga0070679_100000658 Ga0070679_10000065826 266
123 3300005530 Ga0070679_100015466 Ga0070679_1000154665 266
124 3300005535 Ga0070684_100021270 Ga0070684_1000212703 266
125 3300005539 Ga0068853_100009307 Ga0068853_1000093076 266
126 3300005564 Ga0070664_100179572 Ga0070664_1001795722 266
127 3300005578 Ga0068854_100050956 Ga0068854_1000509563 266
128 3300005614 Ga0068856_100000758 Ga0068856_10000075821 266
129 3300005614 Ga0068856_100057046 Ga0068856_1000570463 266
130 3300005841 Ga0068863_100000042 Ga0068863_100000042102 266
131 3300005843 Ga0068860_100004950 Ga0068860_1000049502 266
132 3300005937 Ga0081455_10007155 Ga0081455_100071554 266
133 3300005937 Ga0081455_10022634 Ga0081455_100226347 266
134 3300005937 Ga0081455_10130947 Ga0081455_101309472 266
135 3300005981 Ga0081538_10024188 Ga0081538_100241882 266
136 3300005981 Ga0081538_10034575 Ga0081538_100345752 266
137 3300005983 Ga0081540_1000153 Ga0081540_100015359 266
138 3300005983 Ga0081540_1068387 Ga0081540_10683872 266
139 3300006038 Ga0075365_10140355 Ga0075365_101403552 266
140 3300006048 Ga0075363_100042336 Ga0075363_1000423362 266
141 3300006051 Ga0075364_10013463 Ga0075364_100134636 266
142 3300006051 Ga0075364_10061175 Ga0075364_100611752 266
143 3300006051 Ga0075364_10270158 Ga0075364_102701581 266
144 3300006163 Ga0070715_10000105 Ga0070715_1000010514 266
145 3300006237 Ga0097621_100549444 Ga0097621_1005494442 266
146 3300006358 Ga0068871_100328578 Ga0068871_1003285782 266
147 3300006852 Ga0075433_10000476 Ga0075433_100004765 266
148 3300006852 Ga0075433_10006214 Ga0075433_100062148 266
149 3300009098 Ga0105245_10001630 Ga0105245_100016309 266
150 3300009098 Ga0105245_10036340 Ga0105245_100363404 266
151 3300009098 Ga0105245_10259409 Ga0105245_102594092 266
152 3300009101 Ga0105247_10049422 Ga0105247_100494222 266
153 3300009551 Ga0105238_10000051 Ga0105238_1000005132 266
154 3300009553 Ga0105249_10000085 Ga0105249_1000008582 266
155 3300010375 Ga0105239_10041042 Ga0105239_100410422 266
156 3300013102 Ga0157371_10001825 Ga0157371_1000182510 266
157 3300013308 Ga0157375_10000184 Ga0157375_1000018418 266
158 3300013308 Ga0157375_10011557 Ga0157375_100115579 266
159 3300014968 Ga0157379_10169797 Ga0157379_101697972 266
160 3300025893 Ga0207682_10000470 Ga0207682_100004707 266
161 3300025899 Ga0207642_10000001 Ga0207642_10000001604 266
162 3300025899 Ga0207642_10000003 Ga0207642_10000003604 266
163 3300025905 Ga0207685_10000001 Ga0207685_10000001262 266
164 3300025912 Ga0207707_10037980 Ga0207707_100379802 266
165 3300025914 Ga0207671_10191545 Ga0207671_101915451 266
166 3300025916 Ga0207663_10098883 Ga0207663_100988832 266
167 3300025921 Ga0207652_10000150 Ga0207652_100001502 266
168 3300025921 Ga0207652_10002609 Ga0207652_1000260911 266
169 3300025924 Ga0207694_10000035 Ga0207694_10000035105 266
170 3300025925 Ga0207650_10029145 Ga0207650_100291454 266
171 3300025927 Ga0207687_10000058 Ga0207687_100000588 266
172 3300025927 Ga0207687_10001129 Ga0207687_100011293 266
173 3300025931 Ga0207644_10282061 Ga0207644_102820612 266
174 3300025937 Ga0207669_10000027 Ga0207669_1000002752 266
175 3300025944 Ga0207661_10004638 Ga0207661_100046381 266
176 3300025944 Ga0207661_10025894 Ga0207661_100258942 266
177 3300025945 Ga0207679_10023984 Ga0207679_100239844 266
178 3300025949 Ga0207667_10282555 Ga0207667_102825552 266
179 3300025961 Ga0207712_10000033 Ga0207712_1000003390 266
180 3300025961 Ga0207712_10450626 Ga0207712_104506262 266
181 3300025981 Ga0207640_10036004 Ga0207640_100360043 266
182 3300026041 Ga0207639_10002347 Ga0207639_100023475 266
183 3300026041 Ga0207639_10021128 Ga0207639_100211284 266
184 3300026067 Ga0207678_10003823 Ga0207678_100038232 266
185 3300026078 Ga0207702_10000333 Ga0207702_1000033342 266
186 3300026078 Ga0207702_10006289 Ga0207702_1000628910 266
187 3300026078 Ga0207702_10007867 Ga0207702_100078674 266
188 3300026088 Ga0207641_10000066 Ga0207641_10000066121 266
189 3300026121 Ga0207683_10165264 Ga0207683_101652641 266
190 3300028379 Ga0268266_10062777 Ga0268266_100627773 266
191 3300028379 Ga0268266_10152886 Ga0268266_101528862 266
192 3300028381 Ga0268264_10010145 Ga0268264_100101457 266
193 3300028381 Ga0268264_10069157 Ga0268264_100691573 266
194 3300028558 Ga0265326_10000088 Ga0265326_100000883 266
195 3300028654 Ga0265322_10000006 Ga0265322_10000006110 266
196 3300029957 Ga0265324_10000713 Ga0265324_1000071317 266
197 3300031239 Ga0265328_10007555 Ga0265328_100075555 266
198 3300031240 Ga0265320_10000001 Ga0265320_10000001579 266
199 3300031242 Ga0265329_10007022 Ga0265329_100070224 266
200 3300031250 Ga0265331_10003616 Ga0265331_100036163 266
201 3300031251 Ga0265327_10000003 Ga0265327_10000003579 266
202 3300031711 Ga0265314_10000103 Ga0265314_10000103120 266
203 3300031727 Ga0316576_10013603 Ga0316576_100136033 266
204 3300031728 Ga0316578_10131326 Ga0316578_101313262 266
205 3300035172 Ga0373955_0112673 Ga0373955_0112673_251_1051 266
206 3300035724 Ga0373933_0046279 Ga0373933_0046279_765_1565 266
207 3300036401 Ga0373937_0171786 Ga0373937_0171786_811_1611 266
208 3300036712 Ga0316584_0006276 Ga0316584_0006276_7166_7966 266
209 3300037418 Ga0395900_0273087 Ga0395900_0273087_595_1401 266
210 3300037466 Ga0395898_0076597 Ga0395898_0076597_973_1788 266
211 3300037466 Ga0395898_0434383 Ga0395898_0434383_348_1154 266
212 3300037471 Ga0395905_0279653 Ga0395905_0279653_111_917 266
213 3300041512 Ga0451853_2759690 Ga0451853_2759690_1133_1933 266
214 3300041512 Ga0451853_3486967 Ga0451853_3486967_65_880 266
215 3300042461 Ga0439460_0090754 Ga0439460_0090754_94_900 266
216 3300045836 Ga0466958_0224561 Ga0466958_0224561_374_1174 266
217 3300045976 Ga0466967_0000072 Ga0466967_0000072_9780_10583 266
218 3300046455 Ga0495603_0000045 Ga0495603_0000045_49078_49881 266
219 3300046459 Ga0495629_0212019 Ga0495629_0212019_347_1147 266
220 3300046459 Ga0495629_0442275 Ga0495629_0442275_19_819 266
221 3300046461 Ga0495641_0000001 Ga0495641_0000001_247461_248261 266
222 3300046461 Ga0495641_0025666 Ga0495641_0025666_1533_2336 266
223 3300046515 Ga0495620_0000325 Ga0495620_0000325_27405_28205 266
224 3300046516 Ga0495628_0053260 Ga0495628_0053260_2134_2934 266
225 3300046520 Ga0495637_0034216 Ga0495637_0034216_278_1081 266
226 3300046536 Ga0495587_0013676 Ga0495587_0013676_1648_2451 266
227 3300046537 Ga0495598_0003783 Ga0495598_0003783_2052_2852 266
228 3300046642 Ga0495634_0001214 Ga0495634_0001214_10124_10927 266
229 3300046660 Ga0495625_0000213 Ga0495625_0000213_2961_3764 266
230 3300046674 Ga0495588_0000202 Ga0495588_0000202_57831_58721 266
231 3300046675 Ga0495657_0020853 Ga0495657_0020853_3037_3837 266
232 3300046675 Ga0495657_0080771 Ga0495657_0080771_718_1521 266
233 3300046678 Ga0495599_0003216 Ga0495599_0003216_1658_2458 266
234 3300046681 Ga0495647_0000003 Ga0495647_0000003_49778_50578 266
235 3300046684 Ga0495669_0000065 Ga0495669_0000065_6859_7659 266
236 3300046690 Ga0495624_0000305 Ga0495624_0000305_30346_31146 266
237 3300046690 Ga0495624_0023057 Ga0495624_0023057_2279_3079 266
238 3300046694 Ga0495649_0009523 Ga0495649_0009523_4875_5675 266
239 3300047317 Ga0495604_0000131 Ga0495604_0000131_37067_37870 266
240 3300047321 Ga0495676_0025770 Ga0495676_0025770_1311_2114 266
241 3300047322 Ga0495680_0002055 Ga0495680_0002055_16616_17416 266
242 3300047322 Ga0495680_0003667 Ga0495680_0003667_14130_14930 266
243 3300047322 Ga0495680_0076937 Ga0495680_0076937_51_851 266
244 3300047444 Ga0495675_0004905 Ga0495675_0004905_6858_7661 266
245 3300047471 Ga0495684_0367686 Ga0495684_0367686_178_978 266
246 3300048088 Ga0495602_0165896 Ga0495602_0165896_432_1235 266
247 3300048903 Ga0496100_0000003 Ga0496100_0000003_127242_128042 266
248 3300048903 Ga0496100_0000027 Ga0496100_0000027_1175_1978 266
249 3300048903 Ga0496100_0385442 Ga0496100_0385442_57_860 266
250 3300048904 Ga0496101_0000003 Ga0496101_0000003_127242_128042 266
251 3300048904 Ga0496101_0000012 Ga0496101_0000012_214376_215179 266
252 3300048905 Ga0496102_0122837 Ga0496102_0122837_1217_2029 266
253 3300048905 Ga0496102_0620608 Ga0496102_0620608_160_963 266
254 3300048906 Ga0496103_0274692 Ga0496103_0274692_173_976 266
255 3300048907 Ga0496104_0000007 Ga0496104_0000007_175664_176470 266
256 3300048907 Ga0496104_0051891 Ga0496104_0051891_1199_2002 266
257 3300048908 Ga0496105_0000002 Ga0496105_0000002_378603_379409 266
258 3300048908 Ga0496105_0015175 Ga0496105_0015175_2591_3394 266
259 3300048909 Ga0496106_0000015 Ga0496106_0000015_134535_135335 266
260 3300048909 Ga0496106_0000020 Ga0496106_0000020_113877_114680 266
261 3300048909 Ga0496106_0000147 Ga0496106_0000147_35717_36517 266
262 3300048910 Ga0496107_0000008 Ga0496107_0000008_18302_19102 266
263 3300048910 Ga0496107_0000014 Ga0496107_0000014_113866_114669 266
264 3300048910 Ga0496107_0022506 Ga0496107_0022506_296_1111 266
265 3300048910 Ga0496107_0050493 Ga0496107_0050493_1634_2434 266
266 3300048910 Ga0496107_0088750 Ga0496107_0088750_43_846 266
267 3300048911 Ga0496108_0000025 Ga0496108_0000025_68677_69480 266
268 3300048912 Ga0496109_0000025 Ga0496109_0000025_38422_39225 266
269 3300048912 Ga0496109_0000103 Ga0496109_0000103_34317_35270 266
270 3300048912 Ga0496109_0000155 Ga0496109_0000155_44245_45045 266
271 3300048912 Ga0496109_0098068 Ga0496109_0098068_1058_1861 266
272 3300048912 Ga0496109_0210755 Ga0496109_0210755_928_1731 266
273 3300048912 Ga0496109_0249823 Ga0496109_0249823_741_1556 266
274 3300048913 Ga0496110_0000003 Ga0496110_0000003_107827_108630 266
275 3300048913 Ga0496110_0002724 Ga0496110_0002724_9601_10401 266
276 3300048913 Ga0496110_0111709 Ga0496110_0111709_383_1198 266
277 3300048914 Ga0496111_0000007 Ga0496111_0000007_100142_100945 266
278 3300048915 Ga0496112_0000003 Ga0496112_0000003_550756_551559 266
279 3300048917 Ga0496114_0000010 Ga0496114_0000010_332270_333073 266
280 3300048918 Ga0496115_0000004 Ga0496115_0000004_213753_214559 266
281 3300048918 Ga0496115_0000082 Ga0496115_0000082_29998_30801 266
282 3300048918 Ga0496115_0003398 Ga0496115_0003398_6285_7088 266
283 3300048919 Ga0496116_0000383 Ga0496116_0000383_27077_27880 266
284 3300048920 Ga0496117_0008110 Ga0496117_0008110_7391_8194 266
285 3300048921 Ga0496118_0005965 Ga0496118_0005965_5266_6069 266
286 3300048922 Ga0496119_0000740 Ga0496119_0000740_36015_36818 266
287 3300048922 Ga0496119_0007034 Ga0496119_0007034_2838_3641 266
288 3300048922 Ga0496119_0022679 Ga0496119_0022679_2547_3353 266
289 3300048923 Ga0496120_0002553 Ga0496120_0002553_16047_16850 266
290 3300048924 Ga0496121_0010640 Ga0496121_0010640_3222_4025 266
291 3300048924 Ga0496121_0162036 Ga0496121_0162036_674_1477 266
292 3300048928 Ga0496125_0018716 Ga0496125_0018716_4246_5049 266
293 3300048929 Ga0496126_0046828 Ga0496126_0046828_3069_3872 266
294 3300049571 Ga0501034_0712389 Ga0501034_0712389_51_854 266
295 3300049579 Ga0501043_0309278 Ga0501043_0309278_28_831 266
296 3300049581 Ga0501047_0015201 Ga0501047_0015201_4080_4883 266
297 3300049581 Ga0501047_0493567 Ga0501047_0493567_213_1016 266
298 3300049582 Ga0501048_0032956 Ga0501048_0032956_1768_2571 266
299 3300049586 Ga0501070_0084582 Ga0501070_0084582_788_1591 266
300 3300049587 Ga0501071_0039001 Ga0501071_0039001_1395_2198 266
301 3300049590 Ga0501074_0027620 Ga0501074_0027620_526_1329 266
302 3300049741 Ga0501079_0017928 Ga0501079_0017928_1711_2514 266
303 3300049742 Ga0501080_0130204 Ga0501080_0130204_682_1485 266
304 3300049742 Ga0501080_0440445 Ga0501080_0440445_259_1062 266
305 3300049744 Ga0501083_0004541 Ga0501083_0004541_8890_9693 266
306 3300049744 Ga0501083_0068662 Ga0501083_0068662_1467_2270 266
307 3300049823 Ga0501044_0119827 Ga0501044_0119827_1496_2299 266
308 3300050491 nmdc:mga00v17_210218_c1 nmdc:mga00v17_210218_c1_143_943 266
309 3300050491 nmdc:mga00v17_338314_c1 nmdc:mga00v17_338314_c1_49_849 266
310 3300050491 nmdc:mga00v17_88070_c1 nmdc:mga00v17_88070_c1_494_1294 266
311 3300050491 nmdc:mga00v17_92861_c1 nmdc:mga00v17_92861_c1_685_1491 266
312 3300050492 nmdc:mga0yw44_103835_c1 nmdc:mga0yw44_103835_c1_953_1753 266
313 3300050492 nmdc:mga0yw44_37309_c1 nmdc:mga0yw44_37309_c1_98_898 266
314 3300050515 nmdc:mga0a205_4293_c1 nmdc:mga0a205_4293_c1_8543_9346 266
315 3300053077 Ga0495601_0000061 Ga0495601_0000061_8196_8999 266
316 3300053077 Ga0495601_0135348 Ga0495601_0135348_247_1050 266
317 3300053078 Ga0495612_0005176 Ga0495612_0005176_3695_4543 266
318 3300053085 Ga0495619_0000103 Ga0495619_0000103_14987_15856 266
319 3300053085 Ga0495619_0003692 Ga0495619_0003692_4824_5624 266
320 3300053123 Ga0500614_000043 Ga0500614_000043_17222_18022 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

65

253

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

71

281

0.89

PF08659

KR

KR domain

66

235

0.85

PF13460

NAD_binding_10

NAD(P)H-binding

71

276

0.81

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

67

212

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ph3-assembly1.cif.gz_A-2 crystal structure of 3-oxoacyl-[acyl carrier protein] reductase ttha0415 from thermus thermophilus 0.9065 6 224
4itu-assembly1.cif.gz_B crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s-hpcdh) bound to s-hpc and nadh 0.8987 1 224
6tq5-assembly1.cif.gz_D alcohol dehydrogenase from candida magnoliae dsmz 70638 (adha): complex with nadp+ 0.8987 6 224
7e24-assembly2.cif.gz_C crystal structure of sdr family nad(p)-dependent oxidoreductase from exiguobacterium 0.8981 6 220
7e3x-assembly1.cif.gz_B crystal structure of sdr family nad(p)-dependent oxidoreductase from exiguobacterium 0.8976 6 227
ID Description Score Start End Superfamily
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9238 4 179 3.40.50.720
af_Q2FVD5_4_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9098 3 222 3.40.50.720
af_Q3B7V0_30_291_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9062 1 245 3.40.50.720
af_Q99J47_40_321_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9049 4 245 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9009 3 179 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A536NNC9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9851 2 178 GO:0016020
GO:0016491
AF-A0A537YTP6-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9822 1 266 GO:0016020
GO:0016491
AF-A0A524JFH9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.979 1 266 GO:0016020
GO:0016491
AF-A0A537YTP6-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9785 1 266 GO:0016020
GO:0016491
AF-A0A1V3XCQ1-F1-model_v4 Short chain dehydrogenase family protein 0.9781 1 166 GO:0016020
GO:0016491

Feature Viewer

pLDDT pTM Quality
92.06 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map