F405536

General Info

Members Datasets Scaffolds Average Seq Length
320 184 640 279

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10571455|Ga0163163_105714552
Length 299
Sequence MHPYFGRFHRPARGVAVLGVLSCGRSRMTLDPGRDGGPRVRAMIVAMRFTPAPGAELLHRPLDQILDVNVRDGLVYYRALKGDRGRLDRYIASLNVTPAVYQGWPRPQQMAFWVNAYNAFVLQTVINHYPLRGTIREIPGAFDRTPFHAAGRTVTLDQIEKTILPEFKDPRLYLALGRGAIGGGRLRSEAYTGERLEKQLADLQEEFVSNRYMYRLDRSAGQMSITPIVSWREAEFVAAYADKADPVFAQRSPIERAIIAFVWPNLLPLEKDLVKKNEFRMVFHEMDWRLNDLTGGRVE

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
121 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
125 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
126 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
127 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
128 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
133 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
145 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
146 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
161 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
162 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
166 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.25
Nodule 0
Rhizoplane 4.38
Rhizosphere 89.38
Stem 0
Stem Tuber 0
Unclassified 16.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10571455 3300014325 Bacteria 1193
2 MBSR1b_contig_9174838 2162886012 Bacteria 1034
3 Ga0065712_10068004 3300005290 Bacteria 17424
4 Ga0065715_10026660 3300005293 Bacteria 1369
5 Ga0065715_10094681 3300005293 Bacteria 4270
6 Ga0065715_10315153 3300005293 Bacteria 1013
7 Ga0070683_100005172 3300005329 Bacteria 10856
8 Ga0070690_100147243 3300005330 Bacteria 1603
9 Ga0070670_100022530 3300005331 Bacteria 5420
10 Ga0070670_100022840 3300005331 Bacteria 5383
11 Ga0068869_100134426 3300005334 Unclassified 1904
12 Ga0070666_10017223 3300005335 Bacteria 4632
13 Ga0068868_100067439 3300005338 Bacteria 2848
14 Ga0068868_100092053 3300005338 Bacteria 2444
15 Ga0070689_100139896 3300005340 Bacteria 1946
16 Ga0070691_10045318 3300005341 Bacteria 2087
17 Ga0070687_100016227 3300005343 Bacteria 3390
18 Ga0070661_100020476 3300005344 Bacteria 4718
19 Ga0070661_100067878 3300005344 Bacteria 2621
20 Ga0070669_100000637 3300005353 Bacteria 25990
21 Ga0070669_100013906 3300005353 Bacteria 5723
22 Ga0070669_100108507 3300005353 Bacteria 2104
23 Ga0070675_100127694 3300005354 Bacteria 2165
24 Ga0070675_100168844 3300005354 Bacteria 1886
25 Ga0070671_100051836 3300005355 Bacteria 3412
26 Ga0070671_100135761 3300005355 Bacteria 2074
27 Ga0070671_100271045 3300005355 Bacteria 1443
28 Ga0070674_100010674 3300005356 Bacteria 5565
29 Ga0070673_100024178 3300005364 Bacteria 4450
30 Ga0070673_100360017 3300005364 Unclassified 1293
31 Ga0070688_100072833 3300005365 Unclassified 2202
32 Ga0070667_100131776 3300005367 Bacteria 2182
33 Ga0070703_10119293 3300005406 Bacteria 955
34 Ga0070700_100046081 3300005441 Bacteria 2692
35 Ga0070700_100386449 3300005441 Unclassified 1048
36 Ga0070694_100379059 3300005444 Bacteria 1103
37 Ga0070663_100024021 3300005455 Bacteria 4095
38 Ga0070663_100198434 3300005455 Bacteria 1565
39 Ga0070678_100714453 3300005456 Bacteria 904
40 Ga0070662_100034186 3300005457 Unclassified 3584
41 Ga0070681_10217603 3300005458 Bacteria 1826
42 Ga0068867_100014138 3300005459 Bacteria 5656
43 Ga0070685_10197402 3300005466 Bacteria 1306
44 Ga0070699_100468085 3300005518 Bacteria 1143
45 Ga0070699_100599802 3300005518 Unclassified 1004
46 Ga0070679_100203598 3300005530 Bacteria 1944
47 Ga0070684_100000998 3300005535 Bacteria 20154
48 Ga0070684_100025641 3300005535 Bacteria 4959
49 Ga0070684_100134278 3300005535 Bacteria 2234
50 Ga0070684_100412009 3300005535 Unclassified 1247
51 Ga0070672_100042897 3300005543 Bacteria 3484
52 Ga0070672_100100493 3300005543 Bacteria 2346
53 Ga0070672_100568437 3300005543 Bacteria 986
54 Ga0070686_100175468 3300005544 Unclassified 1519
55 Ga0070696_100447970 3300005546 Unclassified 1018
56 Ga0070693_100078943 3300005547 Bacteria 1957
57 Ga0070665_100333803 3300005548 Unclassified 1521
58 Ga0070665_100712420 3300005548 Unclassified 1017
59 Ga0070704_100142595 3300005549 Bacteria 1873
60 Ga0070664_100013741 3300005564 Bacteria 6598
61 Ga0070664_100205839 3300005564 Bacteria 1757
62 Ga0068854_100098668 3300005578 Bacteria 2186
63 Ga0070702_100211696 3300005615 Bacteria 1290
64 Ga0068852_100144187 3300005616 Bacteria 2207
65 Ga0068859_100055968 3300005617 Bacteria 3969
66 Ga0068864_100471749 3300005618 Bacteria 1203
67 Ga0068860_100255402 3300005843 Bacteria 1707
68 Ga0068862_100079368 3300005844 Bacteria 2845
69 Ga0068862_100082981 3300005844 Bacteria 2783
70 Ga0075365_10000825 3300006038 Bacteria 12798
71 Ga0075363_100271797 3300006048 Bacteria 979
72 Ga0075364_10004281 3300006051 Bacteria 8194
73 Ga0075364_10072989 3300006051 Bacteria 2262
74 Ga0075362_10002204 3300006177 Bacteria 6468
75 Ga0075367_10004229 3300006178 Bacteria 6971
76 Ga0075367_10018450 3300006178 Bacteria 3850
77 Ga0075367_10255265 3300006178 Bacteria 1100
78 Ga0075366_10007619 3300006195 Bacteria 5989
79 Ga0075366_10125114 3300006195 Bacteria 1550
80 Ga0097621_100494318 3300006237 Unclassified 1107
81 Ga0097621_100646489 3300006237 Bacteria 970
82 Ga0075370_10094941 3300006353 Bacteria 1722
83 Ga0075370_10198502 3300006353 Unclassified 1183
84 Ga0075428_100001079 3300006844 Bacteria 28987
85 Ga0075428_100009288 3300006844 Bacteria 10901
86 Ga0075430_100009046 3300006846 Bacteria 8418
87 Ga0075430_100030710 3300006846 Bacteria 4564
88 Ga0075430_100039483 3300006846 Bacteria 3996
89 Ga0075430_100181447 3300006846 Unclassified 1751
90 Ga0075430_100183389 3300006846 Bacteria 1741
91 Ga0075431_100013234 3300006847 Bacteria 8333
92 Ga0075431_100020050 3300006847 Bacteria 6828
93 Ga0075431_100060865 3300006847 Bacteria 3896
94 Ga0075431_100141527 3300006847 Bacteria 2480
95 Ga0075431_100174790 3300006847 Archaea 2206
96 Ga0075431_100194350 3300006847 Unclassified 2078
97 Ga0075433_10081284 3300006852 Bacteria 2857
98 Ga0075434_100001383 3300006871 Bacteria 20371
99 Ga0075434_100052943 3300006871 Unclassified 4034
100 Ga0068865_100148480 3300006881 Bacteria 1776
101 Ga0097620_100055967 3300006931 Bacteria 3969
102 Ga0075435_100001593 3300007076 Bacteria 14635
103 Ga0075435_100036019 3300007076 Bacteria 3930
104 Ga0075435_100076624 3300007076 Bacteria 2741
105 Ga0111539_10000876 3300009094 Bacteria 39324
106 Ga0111539_10005229 3300009094 Bacteria 16810
107 Ga0111539_10086574 3300009094 Bacteria 3682
108 Ga0111539_10121239 3300009094 Bacteria 3064
109 Ga0111539_10149698 3300009094 Bacteria 2732
110 Ga0111539_10221836 3300009094 Bacteria 2202
111 Ga0111539_10238244 3300009094 Bacteria 2118
112 Ga0111539_10352782 3300009094 Unclassified 1712
113 Ga0105245_10299558 3300009098 Bacteria 1577
114 Ga0114129_10000895 3300009147 Bacteria 38835
115 Ga0114129_10003277 3300009147 Bacteria 22723
116 Ga0114129_10006336 3300009147 Bacteria 16780
117 Ga0114129_10012128 3300009147 Bacteria 12269
118 Ga0114129_10028607 3300009147 Bacteria 7896
119 Ga0114129_10304260 3300009147 Unclassified 2124
120 Ga0105243_10442369 3300009148 Unclassified 1217
121 Ga0105241_10392342 3300009174 Bacteria 1216
122 Ga0105241_10410963 3300009174 Bacteria 1189
123 Ga0105242_10057493 3300009176 Bacteria 3186
124 Ga0105248_10106641 3300009177 Bacteria 3159
125 Ga0105238_10701129 3300009551 Bacteria 1024
126 Ga0105249_10002058 3300009553 Bacteria 17439
127 Ga0105249_10145726 3300009553 Bacteria 2275
128 Ga0105249_10247243 3300009553 Bacteria 1766
129 Ga0105249_10470068 3300009553 Unclassified 1299
130 Ga0105239_10147130 3300010375 Bacteria 2628
131 Ga0105246_10205266 3300011119 Unclassified 1535
132 Ga0105246_10461994 3300011119 Bacteria 1069
133 Ga0105246_10475749 3300011119 Unclassified 1056
134 Ga0163162_10745607 3300013306 Bacteria 1099
135 Ga0157375_10719341 3300013308 Unclassified 1151
136 Ga0163163_10026836 3300014325 Bacteria 5510
137 Ga0157380_10169886 3300014326 Unclassified 1904
138 Ga0157377_10065441 3300014745 Unclassified 2088
139 Ga0157379_10087795 3300014968 Bacteria 2788
140 Ga0157379_10920620 3300014968 Bacteria 830
141 Ga0207697_10001826 3300025315 Bacteria 11417
142 Ga0207697_10034699 3300025315 Bacteria 2065
143 Ga0207688_10046165 3300025901 Bacteria 2431
144 Ga0207645_10012900 3300025907 Bacteria 5656
145 Ga0207662_10013282 3300025918 Bacteria 4604
146 Ga0207681_10013892 3300025923 Unclassified 4990
147 Ga0207681_10233690 3300025923 Bacteria 1428
148 Ga0207650_10030631 3300025925 Bacteria 3877
149 Ga0207650_10058673 3300025925 Unclassified 2866
150 Ga0207650_10105705 3300025925 Bacteria 2173
151 Ga0207659_10131034 3300025926 Bacteria 1935
152 Ga0207644_10128532 3300025931 Bacteria 1937
153 Ga0207644_10275538 3300025931 Bacteria 1349
154 Ga0207690_10112090 3300025932 Unclassified 1967
155 Ga0207690_10146628 3300025932 Bacteria 1746
156 Ga0207706_10199838 3300025933 Unclassified 1753
157 Ga0207706_10289188 3300025933 Bacteria 1429
158 Ga0207706_10370035 3300025933 Bacteria 1245
159 Ga0207709_10110337 3300025935 Bacteria 1838
160 Ga0207709_10510816 3300025935 Bacteria 939
161 Ga0207669_10027932 3300025937 Bacteria 3097
162 Ga0207669_10115280 3300025937 Bacteria 1811
163 Ga0207691_10003569 3300025940 Bacteria 15136
164 Ga0207711_10119615 3300025941 Bacteria 2350
165 Ga0207711_10314890 3300025941 Unclassified 1445
166 Ga0207689_10091007 3300025942 Bacteria 2507
167 Ga0207661_10016303 3300025944 Bacteria 5482
168 Ga0207661_10095889 3300025944 Bacteria 2481
169 Ga0207679_10172252 3300025945 Bacteria 1783
170 Ga0207651_10078801 3300025960 Bacteria 2364
171 Ga0207712_10010845 3300025961 Bacteria 5799
172 Ga0207712_10441104 3300025961 Unclassified 1102
173 Ga0207658_10044310 3300025986 Bacteria 3239
174 Ga0207658_10077619 3300025986 Bacteria 2535
175 Ga0207677_10121862 3300026023 Bacteria 1963
176 Ga0207677_10147714 3300026023 Bacteria 1809
177 Ga0207678_10016960 3300026067 Bacteria 6396
178 Ga0207678_10024824 3300026067 Bacteria 5233
179 Ga0207708_10029594 3300026075 Bacteria 4151
180 Ga0207708_10124101 3300026075 Bacteria 2014
181 Ga0207648_10023089 3300026089 Bacteria 5579
182 Ga0207648_10406681 3300026089 Bacteria 1234
183 Ga0207676_10321315 3300026095 Bacteria 1421
184 Ga0207675_100015996 3300026118 Bacteria 7003
185 Ga0207683_10048391 3300026121 Bacteria 3723
186 Ga0207683_10294403 3300026121 Bacteria 1484
187 Ga0207683_10429759 3300026121 Bacteria 1217
188 Ga0207698_10294492 3300026142 Bacteria 1508
189 Ga0207698_10427481 3300026142 Bacteria 1273
190 Ga0207428_10004308 3300027907 Bacteria 13588
191 Ga0207428_10011114 3300027907 Bacteria 7994
192 Ga0207428_10214410 3300027907 Unclassified 1445
193 Ga0207428_10406468 3300027907 Bacteria 996
194 Ga0268266_10192674 3300028379 Bacteria 1862
195 Ga0268265_10029769 3300028380 Bacteria 3925
196 Ga0268265_10403056 3300028380 Bacteria 1265
197 Ga0307408_100019004 3300031548 Bacteria 4622
198 Ga0307408_100046598 3300031548 Bacteria 3101
199 Ga0307408_100075747 3300031548 Bacteria 2501
200 Ga0307405_10013628 3300031731 Bacteria 4342
201 Ga0307405_10168484 3300031731 Bacteria 1560
202 Ga0307410_10069544 3300031852 Unclassified 2436
203 Ga0307410_10109306 3300031852 Bacteria 1998
204 Ga0307407_10315771 3300031903 Bacteria 1095
205 Ga0307409_100036338 3300031995 Unclassified 3620
206 Ga0307409_100069487 3300031995 Bacteria 2791
207 Ga0307416_100008390 3300032002 Bacteria 6662
208 Ga0307416_100116341 3300032002 Bacteria 2370
209 Ga0307416_100199225 3300032002 Bacteria 1898
210 Ga0307416_100214901 3300032002 Bacteria 1838
211 Ga0307416_100245408 3300032002 Bacteria 1739
212 Ga0307416_100546393 3300032002 Bacteria 1231
213 Ga0307416_100680135 3300032002 Bacteria 1116
214 Ga0307414_10108573 3300032004 Bacteria 2106
215 Ga0307411_10566315 3300032005 Unclassified 972
216 Ga0307415_100722650 3300032126 Bacteria 901
217 Ga0373941_0093881 3300035115 Bacteria 1034
218 Ga0373960_0065035 3300035121 Bacteria 1115
219 Ga0373931_0052177 3300035691 Bacteria 2180
220 Ga0395905_0122150 3300037471 Bacteria 2449
221 Ga0439453_0005340 3300041408 Bacteria 1953
222 Ga0439450_001737 3300042008 Bacteria 3258
223 Ga0439435_0000836 3300042436 Bacteria 5261
224 Ga0439435_0014987 3300042436 Bacteria 1923
225 Ga0439435_0019143 3300042436 Bacteria 1751
226 Ga0439464_0003604 3300042439 Bacteria 3923
227 Ga0439460_0089141 3300042461 Bacteria 978
228 Ga0451577_0736070 3300042876 Unclassified 892
229 Ga0451576_0425181 3300045051 Bacteria 1394
230 Ga0495603_0076446 3300046455 Bacteria 1965
231 Ga0495622_0173214 3300046557 Unclassified 970
232 Ga0495656_0078367 3300046615 Unclassified 1485
233 Ga0496100_0139807 3300048903 Bacteria 1715
234 Ga0496102_0304690 3300048905 Bacteria 1501
235 Ga0496104_0014102 3300048907 Bacteria 7215
236 Ga0496106_0050617 3300048909 Bacteria 3131
237 Ga0496106_0416919 3300048909 Bacteria 1079
238 Ga0496108_0013482 3300048911 Bacteria 6670
239 Ga0496109_0114980 3300048912 Bacteria 2503
240 Ga0496109_0171455 3300048912 Bacteria 2036
241 Ga0496109_0189529 3300048912 Bacteria 1932
242 Ga0496110_0044243 3300048913 Bacteria 3888
243 Ga0496111_0006943 3300048914 Bacteria 7390
244 Ga0496111_0227881 3300048914 Unclassified 1384
245 Ga0496112_0002090 3300048915 Bacteria 15841
246 Ga0496114_0168328 3300048917 Bacteria 1909
247 Ga0501291_005570 3300049514 Bacteria 1652
248 Ga0501298_009518 3300049521 Unclassified 1656
249 Ga0501299_004072 3300049522 Unclassified 2161
250 Ga0501034_0006685 3300049571 Bacteria 12368
251 Ga0501038_0077178 3300049574 Bacteria 2813
252 Ga0501039_0034579 3300049575 Bacteria 3900
253 Ga0501040_0045059 3300049576 Bacteria 3007
254 Ga0501040_0088084 3300049576 Bacteria 2156
255 Ga0501041_0108690 3300049577 Bacteria 1720
256 Ga0501046_0043579 3300049580 Bacteria 3572
257 Ga0501046_0451826 3300049580 Unclassified 924
258 Ga0501047_0043273 3300049581 Bacteria 4350
259 Ga0501047_0526694 3300049581 Unclassified 1007
260 Ga0501048_0039211 3300049582 Bacteria 3399
261 Ga0501067_0060747 3300049583 Bacteria 2092
262 Ga0501071_0072599 3300049587 Bacteria 2510
263 Ga0501072_0029694 3300049588 Bacteria 4272
264 Ga0501072_0126480 3300049588 Bacteria 2037
265 Ga0501075_0034159 3300049591 Bacteria 3785
266 Ga0501075_0083731 3300049591 Bacteria 2416
267 Ga0501076_0096472 3300049592 Bacteria 2381
268 Ga0501076_0122889 3300049592 Bacteria 2102
269 Ga0501076_0149489 3300049592 Bacteria 1900
270 Ga0501202_027688 3300049652 Bacteria 1166
271 Ga0501217_029374 3300049661 Unclassified 1344
272 Ga0501233_055264 3300049668 Unclassified 972
273 Ga0501079_0091292 3300049741 Bacteria 2360
274 Ga0501079_0442710 3300049741 Bacteria 1020
275 Ga0501081_0024394 3300049743 Bacteria 4061
276 Ga0501279_018741 3300049775 Unclassified 976
277 Ga0501283_011308 3300049779 Bacteria 1326
278 Ga0501045_0069844 3300049824 Bacteria 2583
279 Ga0501212_018282 3300049851 Bacteria 1066
280 nmdc:mga00v17_183882_c1 3300050491 Bacteria 1349
281 nmdc:mga00v17_69685_c2 3300050491 Bacteria 1779
282 nmdc:mga0yw44_140769_c1 3300050492 Bacteria 1568
283 nmdc:mga0yw44_2136_c1 3300050492 Bacteria 8293
284 nmdc:mga0yw44_259530_c1 3300050492 Bacteria 1158
285 nmdc:mga0k408_155625_c1 3300050493 Bacteria 1361
286 nmdc:mga06z11_45450_c1 3300050494 Bacteria 2220
287 nmdc:mga07m45_28559_c1 3300050496 Bacteria 3079
288 nmdc:mga05p37_12045_c1 3300050507 Bacteria 10320
289 nmdc:mga05p37_1665_c1 3300050507 Bacteria 25824
290 nmdc:mga05p37_282545_c1 3300050507 Unclassified 1979
291 nmdc:mga05p37_43516_c1 3300050507 Bacteria 5525
292 nmdc:mga05p37_456689_c1 3300050507 Bacteria 1477
293 nmdc:mga05p37_68838_c1 3300050507 Bacteria 4353
294 nmdc:mga09592_3444_c1 3300050508 Bacteria 12779
295 nmdc:mga09592_67218_c1 3300050508 Bacteria 3039
296 nmdc:mga0qj67_151252_c1 3300050509 Bacteria 1883
297 nmdc:mga0qj67_17470_c1 3300050509 Bacteria 5454
298 nmdc:mga0qj67_9631_c1 3300050509 Bacteria 7199
299 nmdc:mga06r32_13043_c1 3300050510 Bacteria 7519
300 nmdc:mga06r32_55321_c1 3300050510 Bacteria 3806
301 nmdc:mga06r32_6369_c1 3300050510 Bacteria 10609
302 nmdc:mga06r32_679777_c1 3300050510 Bacteria 996
303 nmdc:mga08y16_125156_c1 3300050511 Unclassified 2674
304 nmdc:mga08y16_15972_c1 3300050511 Bacteria 7891
305 nmdc:mga08y16_267954_c1 3300050511 Unclassified 1763
306 nmdc:mga08y16_302994_c1 3300050511 Bacteria 1647
307 nmdc:mga08y16_5440_c1 3300050511 Bacteria 13315
308 nmdc:mga08y16_634086_c1 3300050511 Unclassified 1074
309 nmdc:mga0n895_1159_c1 3300050512 Bacteria 19270
310 nmdc:mga0n895_34056_c1 3300050512 Unclassified 4900
311 nmdc:mga0rr50_6649_c1 3300050513 Bacteria 7067
312 nmdc:mga0a205_307_c2 3300050515 Bacteria 5365
313 Ga0501084_0011329 3300054114 Bacteria 7385
314 Ga0501084_0236155 3300054114 Bacteria 1543
315 Ga0501084_0561139 3300054114 Bacteria 965
316 Ga0501082_0032645 3300060353 Bacteria 4491
317 Ga0501082_0270588 3300060353 Bacteria 1479
318 Ga0530510_0023849 3300061734 Bacteria 4362
319 Ga0530510_0086139 3300061734 Bacteria 2289
320 Ga0530510_0594355 3300061734 Unclassified 842
321 Ga0163163_10571455
322 MBSR1b_contig_9174838
323 Ga0065712_10068004
324 Ga0065715_10026660
325 Ga0065715_10094681
326 Ga0065715_10315153
327 Ga0070683_100005172
328 Ga0070690_100147243
329 Ga0070670_100022530
330 Ga0070670_100022840
331 Ga0068869_100134426
332 Ga0070666_10017223
333 Ga0068868_100067439
334 Ga0068868_100092053
335 Ga0070689_100139896
336 Ga0070691_10045318
337 Ga0070687_100016227
338 Ga0070661_100020476
339 Ga0070661_100067878
340 Ga0070669_100000637
341 Ga0070669_100013906
342 Ga0070669_100108507
343 Ga0070675_100127694
344 Ga0070675_100168844
345 Ga0070671_100051836
346 Ga0070671_100135761
347 Ga0070671_100271045
348 Ga0070674_100010674
349 Ga0070673_100024178
350 Ga0070673_100360017
351 Ga0070688_100072833
352 Ga0070667_100131776
353 Ga0070703_10119293
354 Ga0070700_100046081
355 Ga0070700_100386449
356 Ga0070694_100379059
357 Ga0070663_100024021
358 Ga0070663_100198434
359 Ga0070678_100714453
360 Ga0070662_100034186
361 Ga0070681_10217603
362 Ga0068867_100014138
363 Ga0070685_10197402
364 Ga0070699_100468085
365 Ga0070699_100599802
366 Ga0070679_100203598
367 Ga0070684_100000998
368 Ga0070684_100025641
369 Ga0070684_100134278
370 Ga0070684_100412009
371 Ga0070672_100042897
372 Ga0070672_100100493
373 Ga0070672_100568437
374 Ga0070686_100175468
375 Ga0070696_100447970
376 Ga0070693_100078943
377 Ga0070665_100333803
378 Ga0070665_100712420
379 Ga0070704_100142595
380 Ga0070664_100013741
381 Ga0070664_100205839
382 Ga0068854_100098668
383 Ga0070702_100211696
384 Ga0068852_100144187
385 Ga0068859_100055968
386 Ga0068864_100471749
387 Ga0068860_100255402
388 Ga0068862_100079368
389 Ga0068862_100082981
390 Ga0075365_10000825
391 Ga0075363_100271797
392 Ga0075364_10004281
393 Ga0075364_10072989
394 Ga0075362_10002204
395 Ga0075367_10004229
396 Ga0075367_10018450
397 Ga0075367_10255265
398 Ga0075366_10007619
399 Ga0075366_10125114
400 Ga0097621_100494318
401 Ga0097621_100646489
402 Ga0075370_10094941
403 Ga0075370_10198502
404 Ga0075428_100001079
405 Ga0075428_100009288
406 Ga0075430_100009046
407 Ga0075430_100030710
408 Ga0075430_100039483
409 Ga0075430_100181447
410 Ga0075430_100183389
411 Ga0075431_100013234
412 Ga0075431_100020050
413 Ga0075431_100060865
414 Ga0075431_100141527
415 Ga0075431_100174790
416 Ga0075431_100194350
417 Ga0075433_10081284
418 Ga0075434_100001383
419 Ga0075434_100052943
420 Ga0068865_100148480
421 Ga0097620_100055967
422 Ga0075435_100001593
423 Ga0075435_100036019
424 Ga0075435_100076624
425 Ga0111539_10000876
426 Ga0111539_10005229
427 Ga0111539_10086574
428 Ga0111539_10121239
429 Ga0111539_10149698
430 Ga0111539_10221836
431 Ga0111539_10238244
432 Ga0111539_10352782
433 Ga0105245_10299558
434 Ga0114129_10000895
435 Ga0114129_10003277
436 Ga0114129_10006336
437 Ga0114129_10012128
438 Ga0114129_10028607
439 Ga0114129_10304260
440 Ga0105243_10442369
441 Ga0105241_10392342
442 Ga0105241_10410963
443 Ga0105242_10057493
444 Ga0105248_10106641
445 Ga0105238_10701129
446 Ga0105249_10002058
447 Ga0105249_10145726
448 Ga0105249_10247243
449 Ga0105249_10470068
450 Ga0105239_10147130
451 Ga0105246_10205266
452 Ga0105246_10461994
453 Ga0105246_10475749
454 Ga0163162_10745607
455 Ga0157375_10719341
456 Ga0163163_10026836
457 Ga0157380_10169886
458 Ga0157377_10065441
459 Ga0157379_10087795
460 Ga0157379_10920620
461 Ga0207697_10001826
462 Ga0207697_10034699
463 Ga0207688_10046165
464 Ga0207645_10012900
465 Ga0207662_10013282
466 Ga0207681_10013892
467 Ga0207681_10233690
468 Ga0207650_10030631
469 Ga0207650_10058673
470 Ga0207650_10105705
471 Ga0207659_10131034
472 Ga0207644_10128532
473 Ga0207644_10275538
474 Ga0207690_10112090
475 Ga0207690_10146628
476 Ga0207706_10199838
477 Ga0207706_10289188
478 Ga0207706_10370035
479 Ga0207709_10110337
480 Ga0207709_10510816
481 Ga0207669_10027932
482 Ga0207669_10115280
483 Ga0207691_10003569
484 Ga0207711_10119615
485 Ga0207711_10314890
486 Ga0207689_10091007
487 Ga0207661_10016303
488 Ga0207661_10095889
489 Ga0207679_10172252
490 Ga0207651_10078801
491 Ga0207712_10010845
492 Ga0207712_10441104
493 Ga0207658_10044310
494 Ga0207658_10077619
495 Ga0207677_10121862
496 Ga0207677_10147714
497 Ga0207678_10016960
498 Ga0207678_10024824
499 Ga0207708_10029594
500 Ga0207708_10124101
501 Ga0207648_10023089
502 Ga0207648_10406681
503 Ga0207676_10321315
504 Ga0207675_100015996
505 Ga0207683_10048391
506 Ga0207683_10294403
507 Ga0207683_10429759
508 Ga0207698_10294492
509 Ga0207698_10427481
510 Ga0207428_10004308
511 Ga0207428_10011114
512 Ga0207428_10214410
513 Ga0207428_10406468
514 Ga0268266_10192674
515 Ga0268265_10029769
516 Ga0268265_10403056
517 Ga0307408_100019004
518 Ga0307408_100046598
519 Ga0307408_100075747
520 Ga0307405_10013628
521 Ga0307405_10168484
522 Ga0307410_10069544
523 Ga0307410_10109306
524 Ga0307407_10315771
525 Ga0307409_100036338
526 Ga0307409_100069487
527 Ga0307416_100008390
528 Ga0307416_100116341
529 Ga0307416_100199225
530 Ga0307416_100214901
531 Ga0307416_100245408
532 Ga0307416_100546393
533 Ga0307416_100680135
534 Ga0307414_10108573
535 Ga0307411_10566315
536 Ga0307415_100722650
537 Ga0373941_0093881
538 Ga0373960_0065035
539 Ga0373931_0052177
540 Ga0395905_0122150
541 Ga0439453_0005340
542 Ga0439450_001737
543 Ga0439435_0000836
544 Ga0439435_0014987
545 Ga0439435_0019143
546 Ga0439464_0003604
547 Ga0439460_0089141
548 Ga0451577_0736070
549 Ga0451576_0425181
550 Ga0495603_0076446
551 Ga0495622_0173214
552 Ga0495656_0078367
553 Ga0496100_0139807
554 Ga0496102_0304690
555 Ga0496104_0014102
556 Ga0496106_0050617
557 Ga0496106_0416919
558 Ga0496108_0013482
559 Ga0496109_0114980
560 Ga0496109_0171455
561 Ga0496109_0189529
562 Ga0496110_0044243
563 Ga0496111_0006943
564 Ga0496111_0227881
565 Ga0496112_0002090
566 Ga0496114_0168328
567 Ga0501291_005570
568 Ga0501298_009518
569 Ga0501299_004072
570 Ga0501034_0006685
571 Ga0501038_0077178
572 Ga0501039_0034579
573 Ga0501040_0045059
574 Ga0501040_0088084
575 Ga0501041_0108690
576 Ga0501046_0043579
577 Ga0501046_0451826
578 Ga0501047_0043273
579 Ga0501047_0526694
580 Ga0501048_0039211
581 Ga0501067_0060747
582 Ga0501071_0072599
583 Ga0501072_0029694
584 Ga0501072_0126480
585 Ga0501075_0034159
586 Ga0501075_0083731
587 Ga0501076_0096472
588 Ga0501076_0122889
589 Ga0501076_0149489
590 Ga0501202_027688
591 Ga0501217_029374
592 Ga0501233_055264
593 Ga0501079_0091292
594 Ga0501079_0442710
595 Ga0501081_0024394
596 Ga0501279_018741
597 Ga0501283_011308
598 Ga0501045_0069844
599 Ga0501212_018282
600 nmdc:mga00v17_183882_c1
601 nmdc:mga00v17_69685_c2
602 nmdc:mga0yw44_140769_c1
603 nmdc:mga0yw44_2136_c1
604 nmdc:mga0yw44_259530_c1
605 nmdc:mga0k408_155625_c1
606 nmdc:mga06z11_45450_c1
607 nmdc:mga07m45_28559_c1
608 nmdc:mga05p37_12045_c1
609 nmdc:mga05p37_1665_c1
610 nmdc:mga05p37_282545_c1
611 nmdc:mga05p37_43516_c1
612 nmdc:mga05p37_456689_c1
613 nmdc:mga05p37_68838_c1
614 nmdc:mga09592_3444_c1
615 nmdc:mga09592_67218_c1
616 nmdc:mga0qj67_151252_c1
617 nmdc:mga0qj67_17470_c1
618 nmdc:mga0qj67_9631_c1
619 nmdc:mga06r32_13043_c1
620 nmdc:mga06r32_55321_c1
621 nmdc:mga06r32_6369_c1
622 nmdc:mga06r32_679777_c1
623 nmdc:mga08y16_125156_c1
624 nmdc:mga08y16_15972_c1
625 nmdc:mga08y16_267954_c1
626 nmdc:mga08y16_302994_c1
627 nmdc:mga08y16_5440_c1
628 nmdc:mga08y16_634086_c1
629 nmdc:mga0n895_1159_c1
630 nmdc:mga0n895_34056_c1
631 nmdc:mga0rr50_6649_c1
632 nmdc:mga0a205_307_c2
633 Ga0501084_0011329
634 Ga0501084_0236155
635 Ga0501084_0561139
636 Ga0501082_0032645
637 Ga0501082_0270588
638 Ga0530510_0023849
639 Ga0530510_0086139
640 Ga0530510_0594355

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04784

DUF547

Protein of unknown function, DUF547

101

208

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f3p-assembly1.cif.gz_C crystal structure of the nucleoporin pair nup85-seh1, space group p21212 0.374 24 108
4wng-assembly1.cif.gz_A crystal structure of the tpr domain of lgn in complex with frmpd4/preso1 at 2.1 angstrom resolution 0.3423 49 256
3i4g-assembly1.cif.gz_A crystal structure of a susd-like carbohydrate binding protein (bf0978) from bacteroides fragilis nctc 9343 at 1.35 a resolution 0.2994 49 192
3sf4-assembly2.cif.gz_B crystal structure of the complex between the conserved cell polarity proteins inscuteable and lgn 0.2901 49 256
7kv3-assembly1.cif.gz_AAA surface glycan-binding protein a from bacteroides thetaiotaomicron in complex with laminarihexaose 0.2769 56 214
ID Description Score Start End Superfamily
af_I1K480_226_314_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6326 49 97 1.25.40.10
af_A4ID67_81_270_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.4429 233 266 3.40.220.10
af_I1K480_226_314_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3512 49 97 1.25.40.10
af_Q86YR5_21_363_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3411 49 254 1.25.40.10
af_Q80VA5_925_1264_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3104 34 253 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2W4RRQ2-F1-model_v4 DUF547 domain-containing protein 0.9779 28 277
AF-A0A2V8BV16-F1-model_v4 DUF547 domain-containing protein 0.9675 29 215
AF-A0A7X4I2X3-F1-model_v4 DUF547 domain-containing protein 0.9572 29 277
AF-A0A2V8FYX4-F1-model_v4 DUF547 domain-containing protein 0.9414 24 264
AF-A0A1Q7AMB0-F1-model_v4 DUF547 domain-containing protein 0.9371 24 276

Map