F405488

General Info

Members Datasets Scaffolds Average Seq Length
320 189 640 281

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100659930|Ga0075434_1006599302
Length 298
Sequence MPQLYLSMGYTSAMIAMLAVAAMAYAHPEQLVETDWVAAHAFENNLRIVDMRQTGYAEAHVPSAVYLSPVAIRDANNPPTFLPSPQAFADLMLKLGIYDTTRVVVYDERGGIYAARLWWILNYFGHSNVALMNGGWTKWTSDRRPTTAEVRSFFYNPPPAPFTPKPDSAWIATAADVVAAIDKPGIAILDARTAAEIEGTDLRNIKRGGFIPSSTPVYWEDLLNLPARTFKSAEELKQIYESRGVVPSKEVIAYCQVGMRASVDLFALHLIGYDKLRNYYGAWEEWGNRDDLPIATKK

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
133 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
134 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
135 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
136 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
137 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
138 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
139 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
142 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
147 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.38
Rhizosphere 95.62
Stem 0
Stem Tuber 0
Unclassified 13.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100659930 3300006871 Bacteria 1064
2 Ga0065712_10120941 3300005290 Bacteria 1631
3 Ga0065715_10321901 3300005293 Bacteria 1000
4 Ga0070658_10057603 3300005327 Bacteria 3161
5 Ga0070670_100103437 3300005331 Bacteria 2453
6 Ga0070670_100526479 3300005331 Bacteria 1053
7 Ga0070666_10007905 3300005335 Bacteria 6572
8 Ga0068868_100023367 3300005338 Bacteria 4678
9 Ga0070660_100020381 3300005339 Bacteria 4873
10 Ga0070689_100018422 3300005340 Bacteria 5144
11 Ga0070689_100048064 3300005340 Unclassified 3290
12 Ga0070687_100147564 3300005343 Unclassified 1377
13 Ga0070668_100036674 3300005347 Bacteria 3742
14 Ga0070668_100270628 3300005347 Unclassified 1416
15 Ga0070669_100097631 3300005353 Bacteria 2212
16 Ga0070675_100000178 3300005354 Bacteria 39555
17 Ga0070675_100057755 3300005354 Bacteria 3199
18 Ga0070674_100020156 3300005356 Bacteria 4253
19 Ga0070673_100420645 3300005364 Bacteria 1198
20 Ga0070673_100497812 3300005364 Bacteria 1102
21 Ga0070688_100030199 3300005365 Bacteria 3251
22 Ga0070688_100047338 3300005365 Bacteria 2667
23 Ga0070667_100033718 3300005367 Unclassified 4283
24 Ga0070709_10030638 3300005434 Bacteria 3230
25 Ga0070714_100029861 3300005435 Bacteria 4534
26 Ga0070713_100300683 3300005436 Bacteria 1477
27 Ga0070705_100200435 3300005440 Bacteria 1368
28 Ga0070694_100127041 3300005444 Bacteria 1837
29 Ga0070708_100156476 3300005445 Bacteria 2122
30 Ga0070678_100213879 3300005456 Bacteria 1599
31 Ga0068867_100054767 3300005459 Bacteria 2947
32 Ga0068867_100436047 3300005459 Bacteria 1113
33 Ga0070706_100126739 3300005467 Bacteria 2381
34 Ga0070707_100125872 3300005468 Unclassified 2490
35 Ga0070707_100398249 3300005468 Bacteria 1337
36 Ga0070707_100447857 3300005468 Unclassified 1252
37 Ga0070699_100002641 3300005518 Bacteria 16015
38 Ga0070679_100127040 3300005530 Bacteria 2532
39 Ga0070679_100127764 3300005530 Bacteria 2523
40 Ga0070697_100041098 3300005536 Bacteria 3741
41 Ga0070697_100235780 3300005536 Unclassified 1562
42 Ga0068853_100329679 3300005539 Bacteria 1416
43 Ga0070672_100055656 3300005543 Bacteria 3100
44 Ga0070672_100141946 3300005543 Bacteria 1982
45 Ga0070686_100000234 3300005544 Bacteria 37628
46 Ga0070686_100462015 3300005544 Bacteria 978
47 Ga0070695_100054313 3300005545 Unclassified 2578
48 Ga0070696_100022090 3300005546 Bacteria 4321
49 Ga0070665_100003157 3300005548 Bacteria 17727
50 Ga0070665_100003353 3300005548 Bacteria 17136
51 Ga0070704_100130967 3300005549 Bacteria 1944
52 Ga0070704_100152042 3300005549 Unclassified 1821
53 Ga0068855_100060919 3300005563 Bacteria 4410
54 Ga0070664_100077566 3300005564 Bacteria 2857
55 Ga0068857_100141956 3300005577 Bacteria 2171
56 Ga0068854_100000719 3300005578 Bacteria 19601
57 Ga0068854_100200113 3300005578 Bacteria 1570
58 Ga0070702_100113219 3300005615 Bacteria 1686
59 Ga0068859_100006403 3300005617 Bacteria 11947
60 Ga0068859_100110472 3300005617 Unclassified 2811
61 Ga0068859_100240392 3300005617 Unclassified 1900
62 Ga0068859_100530544 3300005617 Bacteria 1272
63 Ga0068864_100008930 3300005618 Bacteria 8262
64 Ga0068864_100429009 3300005618 Bacteria 1261
65 Ga0068864_100469675 3300005618 Bacteria 1206
66 Ga0068866_10045323 3300005718 Bacteria 2205
67 Ga0068863_100001105 3300005841 Bacteria 26956
68 Ga0068863_100088092 3300005841 Bacteria 2942
69 Ga0068858_100012669 3300005842 Bacteria 7947
70 Ga0068858_100014902 3300005842 Bacteria 7314
71 Ga0068862_100010664 3300005844 Bacteria 7591
72 Ga0081455_10095671 3300005937 Bacteria 2397
73 Ga0081455_10207007 3300005937 Bacteria 1464
74 Ga0081538_10053905 3300005981 Unclassified 2385
75 Ga0081539_10003386 3300005985 Bacteria 19733
76 Ga0075432_10042775 3300006058 Bacteria 1586
77 Ga0070715_10093682 3300006163 Unclassified 1387
78 Ga0097621_100010600 3300006237 Bacteria 6753
79 Ga0068871_100002910 3300006358 Bacteria 11737
80 Ga0075428_100292586 3300006844 Bacteria 1751
81 Ga0075431_100259437 3300006847 Bacteria 1764
82 Ga0075433_10063359 3300006852 Bacteria 3239
83 Ga0075433_10091378 3300006852 Bacteria 2691
84 Ga0075433_10138609 3300006852 Bacteria 2162
85 Ga0075433_10144276 3300006852 Bacteria 2116
86 Ga0075434_100000194 3300006871 Bacteria 40577
87 Ga0075434_100028522 3300006871 Bacteria 5485
88 Ga0075434_100054876 3300006871 Bacteria 3959
89 Ga0075434_100219602 3300006871 Bacteria 1920
90 Ga0075434_100314749 3300006871 Bacteria 1586
91 Ga0075434_100646337 3300006871 Unclassified 1076
92 Ga0068865_100002848 3300006881 Bacteria 10304
93 Ga0068865_100464840 3300006881 Bacteria 1049
94 Ga0075436_100000036 3300006914 Bacteria 84076
95 Ga0075436_100017875 3300006914 Bacteria 4855
96 Ga0075436_100044930 3300006914 Bacteria 3047
97 Ga0075436_100127194 3300006914 Bacteria 1785
98 Ga0097620_100006403 3300006931 Bacteria 11947
99 Ga0097620_100110468 3300006931 Unclassified 2811
100 Ga0097620_100240394 3300006931 Unclassified 1900
101 Ga0097620_100530551 3300006931 Bacteria 1272
102 Ga0075435_100000014 3300007076 Bacteria 100771
103 Ga0075435_100000237 3300007076 Bacteria 33932
104 Ga0075435_100002811 3300007076 Bacteria 11640
105 Ga0075435_100005807 3300007076 Bacteria 8672
106 Ga0075435_100008186 3300007076 Bacteria 7486
107 Ga0075435_100016420 3300007076 Bacteria 5582
108 Ga0075435_100310671 3300007076 Unclassified 1349
109 Ga0099794_10065553 3300007265 Bacteria 1771
110 Ga0111539_10005964 3300009094 Bacteria 15733
111 Ga0111539_10011793 3300009094 Bacteria 10959
112 Ga0111539_10142818 3300009094 Bacteria 2802
113 Ga0111539_10581173 3300009094 Unclassified 1305
114 Ga0105245_10131652 3300009098 Bacteria 2346
115 Ga0105245_10500281 3300009098 Bacteria 1231
116 Ga0105247_10021969 3300009101 Bacteria 3840
117 Ga0114129_10000263 3300009147 Bacteria 59355
118 Ga0114129_10007956 3300009147 Bacteria 15090
119 Ga0114129_10021949 3300009147 Bacteria 9058
120 Ga0114129_10036282 3300009147 Bacteria 6962
121 Ga0114129_10101790 3300009147 Bacteria 3974
122 Ga0114129_10117424 3300009147 Bacteria 3666
123 Ga0114129_10435248 3300009147 Bacteria 1723
124 Ga0114129_10532878 3300009147 Bacteria 1530
125 Ga0114129_10582417 3300009147 Bacteria 1452
126 Ga0105243_10013055 3300009148 Bacteria 6276
127 Ga0105241_10141083 3300009174 Bacteria 1962
128 Ga0105242_10001591 3300009176 Bacteria 17854
129 Ga0105242_10013968 3300009176 Bacteria 6214
130 Ga0105242_10155303 3300009176 Bacteria 1999
131 Ga0105248_10004479 3300009177 Bacteria 15455
132 Ga0105248_10048009 3300009177 Bacteria 4788
133 Ga0105237_10141352 3300009545 Bacteria 2401
134 Ga0105249_10182873 3300009553 Bacteria 2041
135 Ga0163162_10110546 3300013306 Unclassified 2845
136 Ga0163162_10726309 3300013306 Bacteria 1114
137 Ga0157375_10314350 3300013308 Bacteria 1731
138 Ga0157375_10369329 3300013308 Unclassified 1601
139 Ga0157375_10519113 3300013308 Bacteria 1354
140 Ga0163163_10356752 3300014325 Bacteria 1518
141 Ga0157380_10254212 3300014326 Unclassified 1592
142 Ga0157380_10258250 3300014326 Bacteria 1581
143 Ga0157379_10043057 3300014968 Bacteria 4031
144 Ga0157379_10249918 3300014968 Bacteria 1610
145 Ga0157379_10395564 3300014968 Unclassified 1269
146 Ga0157376_10121712 3300014969 Bacteria 2314
147 Ga0157376_10759005 3300014969 Bacteria 980
148 Ga0163161_10131404 3300017792 Bacteria 1889
149 Ga0207642_10027191 3300025899 Bacteria 2339
150 Ga0207710_10030197 3300025900 Bacteria 2363
151 Ga0207680_10037069 3300025903 Bacteria 2813
152 Ga0207680_10140869 3300025903 Bacteria 1599
153 Ga0207645_10328985 3300025907 Bacteria 1020
154 Ga0207707_10224669 3300025912 Bacteria 1634
155 Ga0207662_10291011 3300025918 Bacteria 1083
156 Ga0207657_10006130 3300025919 Bacteria 12495
157 Ga0207646_10102837 3300025922 Unclassified 2562
158 Ga0207646_10335612 3300025922 Bacteria 1366
159 Ga0207681_10124247 3300025923 Bacteria 1897
160 Ga0207681_10218537 3300025923 Bacteria 1473
161 Ga0207650_10430518 3300025925 Bacteria 1096
162 Ga0207650_10467098 3300025925 Bacteria 1052
163 Ga0207659_10000330 3300025926 Bacteria 28613
164 Ga0207687_10040080 3300025927 Bacteria 3209
165 Ga0207700_10322190 3300025928 Bacteria 1340
166 Ga0207664_10033156 3300025929 Bacteria 3965
167 Ga0207644_10019463 3300025931 Unclassified 4605
168 Ga0207706_10041023 3300025933 Bacteria 4103
169 Ga0207686_10006074 3300025934 Bacteria 6487
170 Ga0207686_10012478 3300025934 Bacteria 4672
171 Ga0207709_10257931 3300025935 Bacteria 1277
172 Ga0207670_10022521 3300025936 Bacteria 3906
173 Ga0207670_10148405 3300025936 Bacteria 1737
174 Ga0207669_10093546 3300025937 Bacteria 1965
175 Ga0207669_10113543 3300025937 Bacteria 1821
176 Ga0207704_10016540 3300025938 Bacteria 3792
177 Ga0207704_10329767 3300025938 Bacteria 1180
178 Ga0207691_10014309 3300025940 Bacteria 7566
179 Ga0207691_10092268 3300025940 Bacteria 2712
180 Ga0207691_10287901 3300025940 Bacteria 1413
181 Ga0207711_10004541 3300025941 Bacteria 11815
182 Ga0207711_10300821 3300025941 Bacteria 1480
183 Ga0207711_10323937 3300025941 Bacteria 1424
184 Ga0207711_10522159 3300025941 Bacteria 1107
185 Ga0207679_10187496 3300025945 Bacteria 1716
186 Ga0207667_10670384 3300025949 Bacteria 1041
187 Ga0207651_10020086 3300025960 Unclassified 4022
188 Ga0207651_10212335 3300025960 Bacteria 1559
189 Ga0207651_10410534 3300025960 Unclassified 1154
190 Ga0207712_10103981 3300025961 Bacteria 2117
191 Ga0207640_10404252 3300025981 Bacteria 1113
192 Ga0207658_10026879 3300025986 Unclassified 4039
193 Ga0207677_10136376 3300026023 Bacteria 1872
194 Ga0207677_10258554 3300026023 Bacteria 1418
195 Ga0207639_10079307 3300026041 Bacteria 2595
196 Ga0207708_10092047 3300026075 Bacteria 2339
197 Ga0207708_10240497 3300026075 Unclassified 1456
198 Ga0207641_10002161 3300026088 Bacteria 18517
199 Ga0207648_10017414 3300026089 Bacteria 6539
200 Ga0207676_10018387 3300026095 Bacteria 5080
201 Ga0207676_10302843 3300026095 Bacteria 1460
202 Ga0207674_10331210 3300026116 Bacteria 1472
203 Ga0207675_100004608 3300026118 Bacteria 13285
204 Ga0207698_10130600 3300026142 Bacteria 2146
205 Ga0207428_10070509 3300027907 Bacteria 2747
206 Ga0207428_10129336 3300027907 Unclassified 1933
207 Ga0268266_10012273 3300028379 Bacteria 7412
208 Ga0268265_10037611 3300028380 Bacteria 3553
209 Ga0268264_10147010 3300028381 Unclassified 2109
210 Ga0307408_100005476 3300031548 Bacteria 8493
211 Ga0307413_10010349 3300031824 Bacteria 4519
212 Ga0307413_10049915 3300031824 Bacteria 2511
213 Ga0307410_10157033 3300031852 Bacteria 1700
214 Ga0307412_10048993 3300031911 Bacteria 2781
215 Ga0307409_100034609 3300031995 Bacteria 3691
216 Ga0307416_100008586 3300032002 Bacteria 6605
217 Ga0307414_10061928 3300032004 Unclassified 2652
218 Ga0307411_10023257 3300032005 Bacteria 3667
219 Ga0307415_100012879 3300032126 Bacteria 4856
220 Ga0373930_0002105 3300034816 Bacteria 3048
221 Ga0373948_0014788 3300034817 Bacteria 1426
222 Ga0373958_0003130 3300034819 Bacteria 2369
223 Ga0373938_0001222 3300034957 Bacteria 4140
224 Ga0373929_0001863 3300035085 Bacteria 3950
225 Ga0373949_0004539 3300035090 Bacteria 3170
226 Ga0373951_0003548 3300035091 Bacteria 3768
227 Ga0373932_0002157 3300035112 Bacteria 5105
228 Ga0373939_0002904 3300035114 Bacteria 4027
229 Ga0373941_0002346 3300035115 Bacteria 4151
230 Ga0373957_0054982 3300035120 Bacteria 1530
231 Ga0373960_0007663 3300035121 Bacteria 2566
232 Ga0373960_0043626 3300035121 Bacteria 1307
233 Ga0373943_0183906 3300035170 Bacteria 1150
234 Ga0373955_0185092 3300035172 Bacteria 1237
235 Ga0373942_0007677 3300035207 Bacteria 2507
236 Ga0373961_0002815 3300035241 Bacteria 4438
237 Ga0373962_0029761 3300035242 Bacteria 1490
238 Ga0373931_0039857 3300035691 Bacteria 2461
239 Ga0373931_0075012 3300035691 Bacteria 1854
240 Ga0373927_0309875 3300035695 Bacteria 1039
241 Ga0373947_0073523 3300035725 Unclassified 2101
242 Ga0373937_0228769 3300036401 Bacteria 1751
243 Ga0373937_0476917 3300036401 Bacteria 1185
244 Ga0451576_0016344 3300045051 Bacteria 8195
245 Ga0451576_0420894 3300045051 Bacteria 1401
246 Ga0495603_0066219 3300046455 Bacteria 2128
247 Ga0495629_0136486 3300046459 Bacteria 1708
248 Ga0495582_0077562 3300046473 Unclassified 1843
249 Ga0495628_0226435 3300046516 Bacteria 1403
250 Ga0495628_0269236 3300046516 Unclassified 1268
251 Ga0495645_0009064 3300046543 Bacteria 6951
252 Ga0495635_0023063 3300046663 Bacteria 4338
253 Ga0495635_0075503 3300046663 Unclassified 2309
254 Ga0495599_0199655 3300046678 Bacteria 1229
255 Ga0495647_0016362 3300046681 Bacteria 2611
256 Ga0495658_0008919 3300046683 Unclassified 4987
257 Ga0495658_0302170 3300046683 Unclassified 1012
258 Ga0495684_0029542 3300047471 Unclassified 4208
259 Ga0496103_0182720 3300048906 Bacteria 1348
260 Ga0496104_0226297 3300048907 Bacteria 1783
261 Ga0496104_0592670 3300048907 Unclassified 1019
262 Ga0496106_0180622 3300048909 Bacteria 1675
263 Ga0496106_0559257 3300048909 Bacteria 918
264 Ga0496107_0112043 3300048910 Bacteria 2006
265 Ga0496107_0123279 3300048910 Bacteria 1910
266 Ga0496108_0014246 3300048911 Bacteria 6488
267 Ga0496111_0106018 3300048914 Bacteria 2069
268 Ga0496112_0011223 3300048915 Bacteria 8172
269 Ga0496113_0004209 3300048916 Bacteria 8797
270 Ga0496114_0025981 3300048917 Bacteria 4791
271 Ga0496114_0054278 3300048917 Bacteria 3342
272 Ga0496115_0068585 3300048918 Bacteria 2872
273 Ga0501290_008057 3300049513 Unclassified 1329
274 Ga0501041_0150118 3300049577 Archaea 1455
275 Ga0501076_0308169 3300049592 Unclassified 1298
276 nmdc:mga05p37_12149_c1 3300050507 Bacteria 10283
277 nmdc:mga05p37_12784_c1 3300050507 Bacteria 10033
278 nmdc:mga05p37_186625_c1 3300050507 Bacteria 2520
279 nmdc:mga05p37_25327_c1 3300050507 Bacteria 7215
280 nmdc:mga05p37_35650_c1 3300050507 Bacteria 6101
281 nmdc:mga05p37_47313_c1 3300050507 Bacteria 5290
282 nmdc:mga05p37_530133_c1 3300050507 Bacteria 1345
283 nmdc:mga05p37_60418_c1 3300050507 Bacteria 4667
284 nmdc:mga06r32_91910_c1 3300050510 Bacteria 2966
285 nmdc:mga08y16_3797_c1 3300050511 Bacteria 15728
286 nmdc:mga08y16_44217_c1 3300050511 Bacteria 4666
287 nmdc:mga08y16_7189_c1 3300050511 Bacteria 11682
288 nmdc:mga08y16_94527_c1 3300050511 Bacteria 3114
289 nmdc:mga0n895_150697_c1 3300050512 Bacteria 2356
290 nmdc:mga0n895_159962_c1 3300050512 Bacteria 2284
291 nmdc:mga0n895_22354_c1 3300050512 Bacteria 5930
292 nmdc:mga0n895_36041_c1 3300050512 Bacteria 4774
293 nmdc:mga0n895_402_c1 3300050512 Bacteria 29129
294 nmdc:mga0n895_603859_c1 3300050512 Unclassified 1099
295 nmdc:mga0n895_688766_c1 3300050512 Bacteria 1019
296 nmdc:mga0n895_697671_c1 3300050512 Bacteria 1011
297 nmdc:mga0rr50_12910_c1 3300050513 Bacteria 5418
298 nmdc:mga0rr50_21724_c1 3300050513 Bacteria 4388
299 nmdc:mga0rr50_284958_c1 3300050513 Bacteria 1379
300 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
301 nmdc:mga0rr50_79621_c1 3300050513 Bacteria 2524
302 nmdc:mga0rr50_9407_c1 3300050513 Bacteria 6142
303 nmdc:mga08x19_119_c1 3300050514 Bacteria 70188
304 nmdc:mga08x19_14077_c1 3300050514 Bacteria 4848
305 nmdc:mga08x19_87808_c1 3300050514 Bacteria 2049
306 nmdc:mga08x19_91256_c1 3300050514 Bacteria 2011
307 nmdc:mga0a205_10095_c2 3300050515 Bacteria 7515
308 nmdc:mga0a205_141723_c1 3300050515 Bacteria 2304
309 nmdc:mga0a205_142219_c1 3300050515 Bacteria 2299
310 nmdc:mga0a205_36106_c1 3300050515 Bacteria 4749
311 nmdc:mga0a205_44395_c1 3300050515 Unclassified 4284
312 nmdc:mga0a205_48042_c1 3300050515 Bacteria 4118
313 nmdc:mga0a205_67883_c1 3300050515 Bacteria 3444
314 Ga0495619_0043318 3300053085 Bacteria 2950
315 Ga0590071_000082 3300059421 Bacteria 26104
316 Ga0590074_004225 3300059423 Bacteria 2374
317 Ga0590075_000227 3300059424 Bacteria 15799
318 Ga0590075_001047 3300059424 Bacteria 7137
319 Ga0590077_000014 3300059426 Bacteria 39311
320 Ga0501082_0212632 3300060353 Bacteria 1682
321 Ga0075434_100659930
322 Ga0065712_10120941
323 Ga0065715_10321901
324 Ga0070658_10057603
325 Ga0070670_100103437
326 Ga0070670_100526479
327 Ga0070666_10007905
328 Ga0068868_100023367
329 Ga0070660_100020381
330 Ga0070689_100018422
331 Ga0070689_100048064
332 Ga0070687_100147564
333 Ga0070668_100036674
334 Ga0070668_100270628
335 Ga0070669_100097631
336 Ga0070675_100000178
337 Ga0070675_100057755
338 Ga0070674_100020156
339 Ga0070673_100420645
340 Ga0070673_100497812
341 Ga0070688_100030199
342 Ga0070688_100047338
343 Ga0070667_100033718
344 Ga0070709_10030638
345 Ga0070714_100029861
346 Ga0070713_100300683
347 Ga0070705_100200435
348 Ga0070694_100127041
349 Ga0070708_100156476
350 Ga0070678_100213879
351 Ga0068867_100054767
352 Ga0068867_100436047
353 Ga0070706_100126739
354 Ga0070707_100125872
355 Ga0070707_100398249
356 Ga0070707_100447857
357 Ga0070699_100002641
358 Ga0070679_100127040
359 Ga0070679_100127764
360 Ga0070697_100041098
361 Ga0070697_100235780
362 Ga0068853_100329679
363 Ga0070672_100055656
364 Ga0070672_100141946
365 Ga0070686_100000234
366 Ga0070686_100462015
367 Ga0070695_100054313
368 Ga0070696_100022090
369 Ga0070665_100003157
370 Ga0070665_100003353
371 Ga0070704_100130967
372 Ga0070704_100152042
373 Ga0068855_100060919
374 Ga0070664_100077566
375 Ga0068857_100141956
376 Ga0068854_100000719
377 Ga0068854_100200113
378 Ga0070702_100113219
379 Ga0068859_100006403
380 Ga0068859_100110472
381 Ga0068859_100240392
382 Ga0068859_100530544
383 Ga0068864_100008930
384 Ga0068864_100429009
385 Ga0068864_100469675
386 Ga0068866_10045323
387 Ga0068863_100001105
388 Ga0068863_100088092
389 Ga0068858_100012669
390 Ga0068858_100014902
391 Ga0068862_100010664
392 Ga0081455_10095671
393 Ga0081455_10207007
394 Ga0081538_10053905
395 Ga0081539_10003386
396 Ga0075432_10042775
397 Ga0070715_10093682
398 Ga0097621_100010600
399 Ga0068871_100002910
400 Ga0075428_100292586
401 Ga0075431_100259437
402 Ga0075433_10063359
403 Ga0075433_10091378
404 Ga0075433_10138609
405 Ga0075433_10144276
406 Ga0075434_100000194
407 Ga0075434_100028522
408 Ga0075434_100054876
409 Ga0075434_100219602
410 Ga0075434_100314749
411 Ga0075434_100646337
412 Ga0068865_100002848
413 Ga0068865_100464840
414 Ga0075436_100000036
415 Ga0075436_100017875
416 Ga0075436_100044930
417 Ga0075436_100127194
418 Ga0097620_100006403
419 Ga0097620_100110468
420 Ga0097620_100240394
421 Ga0097620_100530551
422 Ga0075435_100000014
423 Ga0075435_100000237
424 Ga0075435_100002811
425 Ga0075435_100005807
426 Ga0075435_100008186
427 Ga0075435_100016420
428 Ga0075435_100310671
429 Ga0099794_10065553
430 Ga0111539_10005964
431 Ga0111539_10011793
432 Ga0111539_10142818
433 Ga0111539_10581173
434 Ga0105245_10131652
435 Ga0105245_10500281
436 Ga0105247_10021969
437 Ga0114129_10000263
438 Ga0114129_10007956
439 Ga0114129_10021949
440 Ga0114129_10036282
441 Ga0114129_10101790
442 Ga0114129_10117424
443 Ga0114129_10435248
444 Ga0114129_10532878
445 Ga0114129_10582417
446 Ga0105243_10013055
447 Ga0105241_10141083
448 Ga0105242_10001591
449 Ga0105242_10013968
450 Ga0105242_10155303
451 Ga0105248_10004479
452 Ga0105248_10048009
453 Ga0105237_10141352
454 Ga0105249_10182873
455 Ga0163162_10110546
456 Ga0163162_10726309
457 Ga0157375_10314350
458 Ga0157375_10369329
459 Ga0157375_10519113
460 Ga0163163_10356752
461 Ga0157380_10254212
462 Ga0157380_10258250
463 Ga0157379_10043057
464 Ga0157379_10249918
465 Ga0157379_10395564
466 Ga0157376_10121712
467 Ga0157376_10759005
468 Ga0163161_10131404
469 Ga0207642_10027191
470 Ga0207710_10030197
471 Ga0207680_10037069
472 Ga0207680_10140869
473 Ga0207645_10328985
474 Ga0207707_10224669
475 Ga0207662_10291011
476 Ga0207657_10006130
477 Ga0207646_10102837
478 Ga0207646_10335612
479 Ga0207681_10124247
480 Ga0207681_10218537
481 Ga0207650_10430518
482 Ga0207650_10467098
483 Ga0207659_10000330
484 Ga0207687_10040080
485 Ga0207700_10322190
486 Ga0207664_10033156
487 Ga0207644_10019463
488 Ga0207706_10041023
489 Ga0207686_10006074
490 Ga0207686_10012478
491 Ga0207709_10257931
492 Ga0207670_10022521
493 Ga0207670_10148405
494 Ga0207669_10093546
495 Ga0207669_10113543
496 Ga0207704_10016540
497 Ga0207704_10329767
498 Ga0207691_10014309
499 Ga0207691_10092268
500 Ga0207691_10287901
501 Ga0207711_10004541
502 Ga0207711_10300821
503 Ga0207711_10323937
504 Ga0207711_10522159
505 Ga0207679_10187496
506 Ga0207667_10670384
507 Ga0207651_10020086
508 Ga0207651_10212335
509 Ga0207651_10410534
510 Ga0207712_10103981
511 Ga0207640_10404252
512 Ga0207658_10026879
513 Ga0207677_10136376
514 Ga0207677_10258554
515 Ga0207639_10079307
516 Ga0207708_10092047
517 Ga0207708_10240497
518 Ga0207641_10002161
519 Ga0207648_10017414
520 Ga0207676_10018387
521 Ga0207676_10302843
522 Ga0207674_10331210
523 Ga0207675_100004608
524 Ga0207698_10130600
525 Ga0207428_10070509
526 Ga0207428_10129336
527 Ga0268266_10012273
528 Ga0268265_10037611
529 Ga0268264_10147010
530 Ga0307408_100005476
531 Ga0307413_10010349
532 Ga0307413_10049915
533 Ga0307410_10157033
534 Ga0307412_10048993
535 Ga0307409_100034609
536 Ga0307416_100008586
537 Ga0307414_10061928
538 Ga0307411_10023257
539 Ga0307415_100012879
540 Ga0373930_0002105
541 Ga0373948_0014788
542 Ga0373958_0003130
543 Ga0373938_0001222
544 Ga0373929_0001863
545 Ga0373949_0004539
546 Ga0373951_0003548
547 Ga0373932_0002157
548 Ga0373939_0002904
549 Ga0373941_0002346
550 Ga0373957_0054982
551 Ga0373960_0007663
552 Ga0373960_0043626
553 Ga0373943_0183906
554 Ga0373955_0185092
555 Ga0373942_0007677
556 Ga0373961_0002815
557 Ga0373962_0029761
558 Ga0373931_0039857
559 Ga0373931_0075012
560 Ga0373927_0309875
561 Ga0373947_0073523
562 Ga0373937_0228769
563 Ga0373937_0476917
564 Ga0451576_0016344
565 Ga0451576_0420894
566 Ga0495603_0066219
567 Ga0495629_0136486
568 Ga0495582_0077562
569 Ga0495628_0226435
570 Ga0495628_0269236
571 Ga0495645_0009064
572 Ga0495635_0023063
573 Ga0495635_0075503
574 Ga0495599_0199655
575 Ga0495647_0016362
576 Ga0495658_0008919
577 Ga0495658_0302170
578 Ga0495684_0029542
579 Ga0496103_0182720
580 Ga0496104_0226297
581 Ga0496104_0592670
582 Ga0496106_0180622
583 Ga0496106_0559257
584 Ga0496107_0112043
585 Ga0496107_0123279
586 Ga0496108_0014246
587 Ga0496111_0106018
588 Ga0496112_0011223
589 Ga0496113_0004209
590 Ga0496114_0025981
591 Ga0496114_0054278
592 Ga0496115_0068585
593 Ga0501290_008057
594 Ga0501041_0150118
595 Ga0501076_0308169
596 nmdc:mga05p37_12149_c1
597 nmdc:mga05p37_12784_c1
598 nmdc:mga05p37_186625_c1
599 nmdc:mga05p37_25327_c1
600 nmdc:mga05p37_35650_c1
601 nmdc:mga05p37_47313_c1
602 nmdc:mga05p37_530133_c1
603 nmdc:mga05p37_60418_c1
604 nmdc:mga06r32_91910_c1
605 nmdc:mga08y16_3797_c1
606 nmdc:mga08y16_44217_c1
607 nmdc:mga08y16_7189_c1
608 nmdc:mga08y16_94527_c1
609 nmdc:mga0n895_150697_c1
610 nmdc:mga0n895_159962_c1
611 nmdc:mga0n895_22354_c1
612 nmdc:mga0n895_36041_c1
613 nmdc:mga0n895_402_c1
614 nmdc:mga0n895_603859_c1
615 nmdc:mga0n895_688766_c1
616 nmdc:mga0n895_697671_c1
617 nmdc:mga0rr50_12910_c1
618 nmdc:mga0rr50_21724_c1
619 nmdc:mga0rr50_284958_c1
620 nmdc:mga0rr50_2_c1
621 nmdc:mga0rr50_79621_c1
622 nmdc:mga0rr50_9407_c1
623 nmdc:mga08x19_119_c1
624 nmdc:mga08x19_14077_c1
625 nmdc:mga08x19_87808_c1
626 nmdc:mga08x19_91256_c1
627 nmdc:mga0a205_10095_c2
628 nmdc:mga0a205_141723_c1
629 nmdc:mga0a205_142219_c1
630 nmdc:mga0a205_36106_c1
631 nmdc:mga0a205_44395_c1
632 nmdc:mga0a205_48042_c1
633 nmdc:mga0a205_67883_c1
634 Ga0495619_0043318
635 Ga0590071_000082
636 Ga0590074_004225
637 Ga0590075_000227
638 Ga0590075_001047
639 Ga0590077_000014
640 Ga0501082_0212632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

33

142

0.83

PF00581

Rhodanese

Rhodanese-like domain

173

289

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uar-assembly1.cif.gz_A crystal structure of rhodanese from thermus thermophilus hb8 0.9288 10 283
3hwi-assembly1.cif.gz_A crystal structure of probable thiosulfate sulfurtransferase cysa2 (rhodanese-like protein) from mycobacterium tuberculosis 0.9262 13 282
3p3a-assembly1.cif.gz_B crystal structure of a putative thiosulfate sulfurtransferase from mycobacterium thermoresistible 0.924 11 280
1boi-assembly1.cif.gz_A n-terminally truncated rhodanese 0.9233 17 274
3hwi-assembly1.cif.gz_A crystal structure of probable thiosulfate sulfurtransferase cysa2 (rhodanese-like protein) from mycobacterium tuberculosis 0.9229 13 282
ID Description Score Start End Superfamily
1uarA01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9266 10 151 3.40.250.10
af_P9WHF5_161_279_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9213 155 278 3.40.250.10
1uarA01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9203 10 151 3.40.250.10
af_O17730_1_176_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9201 16 149 3.40.250.10
1urhB01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9201 16 148 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A1Q7AGU5-F1-model_v4 Rhodanese domain-containing protein 0.9859 37 282
AF-A0A2V8CPJ9-F1-model_v4 Rhodanese domain-containing protein 0.984 1 281 GO:0004792
AF-A0A1Q7AGU5-F1-model_v4 Rhodanese domain-containing protein 0.9819 37 282
AF-A0A2V8CPJ9-F1-model_v4 Rhodanese domain-containing protein 0.9771 1 281 GO:0004792
AF-A0A7C1FAA9-F1-model_v4 Sulfurtransferase 0.9762 11 280 GO:0004792

Map