F405297

General Info

Members Datasets Scaffolds Average Seq Length
319 182 638 133

Family's Representative Sequence

Representative Sequence 3300050490|nmdc:mga03n38_451296_c1|nmdc:mga03n38_451296_c1_213_689
Length 158
Sequence VQRFDDDVVPGRELLAGIHHCAYCTGAMQIVAALFVENFELRQAPGPSTRIDLTGAMFSMAAPSPAPVTIAPHLVALIYCPPDEPGSGVFEVVFRKGLDEDDEQVARNVSPFTVDPGKFTYRLVRGELEFDEYGQIVAHCRVDRGPWHLVPFTLLPPV

Samples

Sample ID Description Type Environment
1 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
96 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
97 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
98 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
101 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
110 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
111 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
112 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
113 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
114 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
115 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
116 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
120 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.99
Nodule 0
Rhizoplane 11.6
Rhizosphere 69.91
Stem 0
Stem Tuber 0
Unclassified 16.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga03n38_451296_c1 3300050490 Bacteria 715
2 Ga0070670_101557876 3300005331 Unclassified 607
3 Ga0068868_100585629 3300005338 Bacteria 987
4 Ga0068868_101270062 3300005338 Bacteria 683
5 Ga0070689_100055900 3300005340 Bacteria 3059
6 Ga0070687_100757408 3300005343 Unclassified 684
7 Ga0070687_101363267 3300005343 Unclassified 529
8 Ga0070669_100721740 3300005353 Bacteria 843
9 Ga0070675_100382464 3300005354 Bacteria 1253
10 Ga0070671_100457956 3300005355 Bacteria 1095
11 Ga0070671_101522743 3300005355 Bacteria 592
12 Ga0070674_100031276 3300005356 Bacteria 3526
13 Ga0070673_100937364 3300005364 Bacteria 804
14 Ga0070688_100397801 3300005365 Bacteria 1019
15 Ga0070667_100134250 3300005367 Bacteria 2163
16 Ga0070667_100291712 3300005367 Bacteria 1467
17 Ga0070711_101091846 3300005439 Bacteria 687
18 Ga0070700_100041131 3300005441 Unclassified 2833
19 Ga0070678_100388008 3300005456 Bacteria 1210
20 Ga0070678_101328150 3300005456 Bacteria 670
21 Ga0068867_100015336 3300005459 Bacteria 5433
22 Ga0070685_10052972 3300005466 Bacteria 2349
23 Ga0070685_10153572 3300005466 Bacteria 1461
24 Ga0070684_100798812 3300005535 Bacteria 882
25 Ga0070672_100550506 3300005543 Bacteria 1002
26 Ga0068854_101588056 3300005578 Unclassified 596
27 Ga0070702_100088876 3300005615 Bacteria 1869
28 Ga0068859_100289397 3300005617 Bacteria 1731
29 Ga0068859_100324300 3300005617 Unclassified 1634
30 Ga0068864_101239764 3300005618 Bacteria 745
31 Ga0068866_10107383 3300005718 Bacteria 1551
32 Ga0068861_100405014 3300005719 Bacteria 1211
33 Ga0068861_100962062 3300005719 Bacteria 813
34 Ga0068861_101161896 3300005719 Unclassified 745
35 Ga0068870_10908638 3300005840 Bacteria 622
36 Ga0068863_100013960 3300005841 Bacteria 7743
37 Ga0068858_100027963 3300005842 Bacteria 5240
38 Ga0068858_100137636 3300005842 Bacteria 2292
39 Ga0068860_100048008 3300005843 Bacteria 4069
40 Ga0068860_100089728 3300005843 Bacteria 2927
41 Ga0068860_100278420 3300005843 Bacteria 1634
42 Ga0068860_101404752 3300005843 Bacteria 719
43 Ga0068862_100459647 3300005844 Unclassified 1201
44 Ga0068862_100622927 3300005844 Unclassified 1038
45 Ga0068862_100897867 3300005844 Bacteria 871
46 Ga0075365_10000071 3300006038 Bacteria 30680
47 Ga0075365_10013659 3300006038 Bacteria 4868
48 Ga0075365_10114821 3300006038 Bacteria 1853
49 Ga0075365_10297532 3300006038 Bacteria 1135
50 Ga0075365_10429518 3300006038 Bacteria 933
51 Ga0075368_10013153 3300006042 Bacteria 3036
52 Ga0075363_100028550 3300006048 Bacteria 2871
53 Ga0075363_100097877 3300006048 Bacteria 1622
54 Ga0075363_100422252 3300006048 Unclassified 785
55 Ga0075364_10007674 3300006051 Bacteria 6418
56 Ga0075364_10012934 3300006051 Bacteria 5122
57 Ga0075364_10023706 3300006051 Bacteria 3888
58 Ga0075364_10030154 3300006051 Bacteria 3481
59 Ga0075364_10147592 3300006051 Bacteria 1584
60 Ga0075362_10023358 3300006177 Bacteria 2615
61 Ga0075362_10054328 3300006177 Bacteria 1800
62 Ga0075362_10285491 3300006177 Bacteria 817
63 Ga0075367_10078144 3300006178 Bacteria 1998
64 Ga0075367_10188892 3300006178 Bacteria 1285
65 Ga0075367_10379075 3300006178 Bacteria 894
66 Ga0075369_10046574 3300006186 Bacteria 1867
67 Ga0075366_10272302 3300006195 Bacteria 1034
68 Ga0075370_10151566 3300006353 Bacteria 1359
69 Ga0075370_10239668 3300006353 Bacteria 1074
70 Ga0075370_10678346 3300006353 Unclassified 626
71 Ga0068871_100390121 3300006358 Bacteria 1238
72 Ga0068865_100072798 3300006881 Bacteria 2442
73 Ga0068865_100203048 3300006881 Bacteria 1540
74 Ga0097620_100289415 3300006931 Bacteria 1731
75 Ga0097620_100324289 3300006931 Unclassified 1634
76 Ga0105251_10029362 3300009011 Bacteria 2770
77 Ga0105250_10495694 3300009092 Unclassified 554
78 Ga0105245_10699352 3300009098 Bacteria 1047
79 Ga0105245_11247597 3300009098 Bacteria 792
80 Ga0105245_11367550 3300009098 Bacteria 758
81 Ga0114129_10631795 3300009147 Bacteria 1384
82 Ga0114129_11042743 3300009147 Bacteria 1027
83 Ga0105243_10031549 3300009148 Bacteria 4086
84 Ga0105243_10991071 3300009148 Unclassified 842
85 Ga0105243_11436954 3300009148 Bacteria 711
86 Ga0105243_12120220 3300009148 Bacteria 598
87 Ga0105242_10014988 3300009176 Bacteria 6009
88 Ga0105248_10179399 3300009177 Bacteria 2387
89 Ga0105248_11566381 3300009177 Bacteria 746
90 Ga0105237_12739111 3300009545 Unclassified 504
91 Ga0105238_11494174 3300009551 Unclassified 704
92 Ga0105249_10165040 3300009553 Bacteria 2143
93 Ga0105249_10716751 3300009553 Bacteria 1061
94 Ga0105249_12324558 3300009553 Unclassified 609
95 Ga0105249_13075406 3300009553 Bacteria 536
96 Ga0105239_10269267 3300010375 Bacteria 1916
97 Ga0157378_10002711 3300013297 Bacteria 15769
98 Ga0157378_10250894 3300013297 Bacteria 1694
99 Ga0157378_10385422 3300013297 Bacteria 1377
100 Ga0163162_10303594 3300013306 Bacteria 1728
101 Ga0163162_10543615 3300013306 Bacteria 1290
102 Ga0163162_10637194 3300013306 Bacteria 1190
103 Ga0163162_12738593 3300013306 Unclassified 568
104 Ga0157375_10079055 3300013308 Bacteria 3323
105 Ga0157375_10374640 3300013308 Bacteria 1590
106 Ga0163163_10064375 3300014325 Bacteria 3638
107 Ga0157380_10061867 3300014326 Bacteria 2997
108 Ga0157380_12542915 3300014326 Bacteria 578
109 Ga0157377_11353783 3300014745 Unclassified 559
110 Ga0157379_10028156 3300014968 Bacteria 5002
111 Ga0157379_10038363 3300014968 Bacteria 4275
112 Ga0157376_10034597 3300014969 Bacteria 4081
113 Ga0157376_10426930 3300014969 Unclassified 1287
114 Ga0157376_10487076 3300014969 Bacteria 1209
115 Ga0163161_10225950 3300017792 Bacteria 1451
116 Ga0163161_11408697 3300017792 Bacteria 609
117 Ga0207666_1005223 3300025271 Bacteria 1652
118 Ga0207697_10044287 3300025315 Bacteria 1831
119 Ga0207682_10033287 3300025893 Bacteria 2074
120 Ga0207642_10012215 3300025899 Bacteria 3093
121 Ga0207688_10065891 3300025901 Bacteria 2048
122 Ga0207645_11181221 3300025907 Bacteria 514
123 Ga0207662_10736111 3300025918 Unclassified 693
124 Ga0207662_11037356 3300025918 Unclassified 583
125 Ga0207681_10989674 3300025923 Bacteria 705
126 Ga0207687_10674616 3300025927 Unclassified 876
127 Ga0207687_11236145 3300025927 Bacteria 642
128 Ga0207664_10506357 3300025929 Bacteria 1081
129 Ga0207644_10300150 3300025931 Bacteria 1294
130 Ga0207706_10059303 3300025933 Bacteria 3370
131 Ga0207686_10473527 3300025934 Unclassified 967
132 Ga0207670_10315130 3300025936 Unclassified 1229
133 Ga0207669_10034896 3300025937 Bacteria 2856
134 Ga0207704_10019838 3300025938 Bacteria 3542
135 Ga0207691_10716152 3300025940 Bacteria 843
136 Ga0207711_11073573 3300025941 Bacteria 746
137 Ga0207651_10640145 3300025960 Bacteria 933
138 Ga0207712_10073698 3300025961 Bacteria 2463
139 Ga0207712_10133504 3300025961 Bacteria 1895
140 Ga0207712_10491784 3300025961 Unclassified 1047
141 Ga0207712_11339525 3300025961 Unclassified 640
142 Ga0207668_10754417 3300025972 Bacteria 859
143 Ga0207640_10116953 3300025981 Bacteria 1902
144 Ga0207658_10108136 3300025986 Bacteria 2193
145 Ga0207658_10255272 3300025986 Bacteria 1492
146 Ga0207677_10441317 3300026023 Bacteria 1113
147 Ga0207703_10041195 3300026035 Bacteria 3699
148 Ga0207703_10378411 3300026035 Bacteria 1309
149 Ga0207708_10096464 3300026075 Bacteria 2285
150 Ga0207648_10009661 3300026089 Bacteria 9224
151 Ga0207648_10217758 3300026089 Bacteria 1696
152 Ga0207675_100078030 3300026118 Bacteria 3103
153 Ga0207683_10053671 3300026121 Bacteria 3534
154 Ga0268265_10338113 3300028380 Bacteria 1370
155 Ga0268265_10935986 3300028380 Bacteria 853
156 Ga0268264_10037328 3300028381 Bacteria 4006
157 Ga0268264_10174898 3300028381 Bacteria 1945
158 Ga0268264_10201777 3300028381 Bacteria 1820
159 Ga0265760_10039637 3300031090 Bacteria 1402
160 Ga0316575_10381728 3300031665 Bacteria 603
161 Ga0316579_10069377 3300031691 Bacteria 1668
162 Ga0316576_10000733 3300031727 Bacteria 16248
163 Ga0316576_10006011 3300031727 Bacteria 7501
164 Ga0316576_10013683 3300031727 Bacteria 5402
165 Ga0316576_10046460 3300031727 Bacteria 3143
166 Ga0316576_10057824 3300031727 Bacteria 2835
167 Ga0316578_10005553 3300031728 Bacteria 6128
168 Ga0316578_10086727 3300031728 Bacteria 1866
169 Ga0316578_10149627 3300031728 Bacteria 1406
170 Ga0307413_10080735 3300031824 Bacteria 2083
171 Ga0316585_10039630 3300032137 Bacteria 1499
172 Ga0316580_10025002 3300032139 Bacteria 1846
173 Ga0316574_0005941 3300035398 Bacteria 6549
174 Ga0316574_0023902 3300035398 Bacteria 3653
175 Ga0316574_0292683 3300035398 Bacteria 1036
176 Ga0316574_0356182 3300035398 Bacteria 925
177 Ga0373931_0546979 3300035691 Bacteria 752
178 Ga0316582_0199627 3300036647 Bacteria 1364
179 Ga0316582_0345171 3300036647 Bacteria 1024
180 Ga0316584_0015600 3300036712 Bacteria 5434
181 Ga0316584_0022160 3300036712 Bacteria 4631
182 Ga0316584_0367211 3300036712 Bacteria 1031
183 Ga0436364_1497971 3300037853 Bacteria 1056
184 Ga0400483_141406 3300039062 Bacteria 39180
185 Ga0400483_234221 3300039062 Bacteria 62054
186 Ga0436365_1684510 3300039437 Unclassified 1221
187 Ga0439465_0128925 3300041413 Unclassified 892
188 Ga0451791_1478098 3300041451 Bacteria 593
189 Ga0451793_0990435 3300041452 Unclassified 604
190 Ga0451797_0024862 3300041453 Unclassified 605
191 Ga0451797_0994683 3300041453 Bacteria 538
192 Ga0451797_1245711 3300041453 Unclassified 635
193 Ga0451837_1654337 3300041494 Bacteria 550
194 Ga0451849_1076375 3300041505 Bacteria 1645
195 Ga0451843_0349066 3300041509 Unclassified 829
196 Ga0439431_0090338 3300041997 Unclassified 834
197 Ga0451577_0009196 3300042876 Bacteria 9533
198 Ga0466969_0138432 3300044656 Bacteria 1126
199 Ga0466966_0086067 3300044684 Bacteria 1954
200 Ga0466961_0099384 3300044693 Bacteria 1834
201 Ga0466963_0473236 3300044694 Unclassified 884
202 Ga0466963_0734150 3300044694 Bacteria 697
203 Ga0453684_0006714 3300044712 Bacteria 21692
204 Ga0466959_0182587 3300045049 Bacteria 1467
205 Ga0466958_0241568 3300045836 Bacteria 1154
206 Ga0466967_0134679 3300045976 Bacteria 2297
207 Ga0495603_0308621 3300046455 Bacteria 909
208 Ga0495629_0861907 3300046459 Unclassified 595
209 Ga0495641_0024071 3300046461 Bacteria 3011
210 Ga0495664_0355504 3300046477 Bacteria 882
211 Ga0495634_0038224 3300046642 Bacteria 3273
212 Ga0495658_0428942 3300046683 Unclassified 844
213 Ga0495670_0032155 3300046691 Bacteria 2609
214 Ga0495649_0201038 3300046694 Unclassified 1035
215 Ga0496100_0180011 3300048903 Bacteria 1528
216 Ga0496100_0442837 3300048903 Unclassified 995
217 Ga0496101_0002986 3300048904 Bacteria 10419
218 Ga0496103_0146836 3300048906 Unclassified 1510
219 Ga0496104_0010672 3300048907 Bacteria 8211
220 Ga0496104_0023537 3300048907 Bacteria 5663
221 Ga0496104_0710462 3300048907 Unclassified 913
222 Ga0496105_0060281 3300048908 Bacteria 3131
223 Ga0496105_0203006 3300048908 Bacteria 1618
224 Ga0496105_0567675 3300048908 Bacteria 884
225 Ga0496106_0112372 3300048909 Bacteria 2123
226 Ga0496106_0877234 3300048909 Bacteria 709
227 Ga0496108_0761865 3300048911 Bacteria 837
228 Ga0496109_0153332 3300048912 Bacteria 2158
229 Ga0496109_0197406 3300048912 Unclassified 1892
230 Ga0496109_0243507 3300048912 Bacteria 1693
231 Ga0496109_0399102 3300048912 Bacteria 1299
232 Ga0496109_0760193 3300048912 Bacteria 907
233 Ga0496110_0003359 3300048913 Bacteria 12218
234 Ga0496110_0016363 3300048913 Bacteria 6192
235 Ga0496110_0042048 3300048913 Bacteria 3989
236 Ga0496110_1132785 3300048913 Unclassified 691
237 Ga0496111_0012541 3300048914 Bacteria 5743
238 Ga0496111_0066945 3300048914 Bacteria 2609
239 Ga0496111_0117815 3300048914 Bacteria 1960
240 Ga0496111_0301812 3300048914 Bacteria 1187
241 Ga0496114_0005752 3300048917 Bacteria 9733
242 Ga0496114_0044468 3300048917 Bacteria 3685
243 Ga0496114_0250415 3300048917 Bacteria 1559
244 Ga0496114_0449626 3300048917 Bacteria 1141
245 Ga0496114_0651054 3300048917 Bacteria 927
246 Ga0496115_0506702 3300048918 Unclassified 969
247 Ga0496126_1246940 3300048929 Unclassified 544
248 Ga0501031_0063668 3300049568 Bacteria 2402
249 Ga0501031_0279941 3300049568 Bacteria 1082
250 Ga0501031_0853995 3300049568 Bacteria 583
251 Ga0501034_0021602 3300049571 Bacteria 6557
252 Ga0501036_0032332 3300049572 Bacteria 4420
253 Ga0501039_0882253 3300049575 Unclassified 697
254 Ga0501040_0076575 3300049576 Bacteria 2313
255 Ga0501041_0038869 3300049577 Bacteria 2886
256 Ga0501042_0047152 3300049578 Bacteria 3072
257 Ga0501042_0341775 3300049578 Bacteria 1082
258 Ga0501042_0546238 3300049578 Bacteria 842
259 Ga0501042_1230006 3300049578 Unclassified 546
260 Ga0501046_0636553 3300049580 Unclassified 755
261 Ga0501048_0041593 3300049582 Bacteria 3291
262 Ga0501048_0107304 3300049582 Bacteria 1971
263 Ga0501069_0000168 3300049585 Bacteria 29253
264 Ga0501070_0000030 3300049586 Bacteria 139270
265 Ga0501070_0509053 3300049586 Bacteria 967
266 Ga0501071_0007190 3300049587 Bacteria 7282
267 Ga0501071_0017157 3300049587 Bacteria 4989
268 Ga0501071_0046274 3300049587 Bacteria 3125
269 Ga0501073_0391121 3300049589 Bacteria 961
270 Ga0501075_0082825 3300049591 Bacteria 2430
271 Ga0501075_0140986 3300049591 Bacteria 1837
272 Ga0501075_0539545 3300049591 Bacteria 890
273 Ga0501076_0044448 3300049592 Bacteria 3503
274 Ga0501076_0251104 3300049592 Bacteria 1447
275 Ga0501076_0775692 3300049592 Unclassified 791
276 Ga0501077_0610131 3300049593 Unclassified 701
277 Ga0501079_0156585 3300049741 Bacteria 1776
278 Ga0501080_0001263 3300049742 Bacteria 21034
279 Ga0501080_0223921 3300049742 Bacteria 1721
280 Ga0501035_0128547 3300049822 Bacteria 2210
281 Ga0501035_0149321 3300049822 Bacteria 2029
282 Ga0501035_0174690 3300049822 Bacteria 1854
283 Ga0501044_0171186 3300049823 Bacteria 2143
284 Ga0501044_0634096 3300049823 Unclassified 959
285 Ga0501045_0014510 3300049824 Bacteria 5585
286 Ga0501045_0052545 3300049824 Bacteria 2975
287 Ga0501045_0545524 3300049824 Bacteria 860
288 nmdc:mga03683_251575_c1 3300050489 Bacteria 821
289 nmdc:mga03683_46956_c1 3300050489 Bacteria 1791
290 nmdc:mga03n38_239188_c1 3300050490 Bacteria 955
291 nmdc:mga03n38_27610_c1 3300050490 Bacteria 2357
292 nmdc:mga03n38_326721_c1 3300050490 Bacteria 829
293 nmdc:mga03n38_54886_c1 3300050490 Bacteria 1793
294 nmdc:mga00v17_10088_c1 3300050491 Bacteria 5144
295 nmdc:mga00v17_175181_c1 3300050491 Bacteria 1383
296 nmdc:mga00v17_217424_c1 3300050491 Bacteria 1237
297 nmdc:mga00v17_237962_c1 3300050491 Bacteria 1180
298 nmdc:mga00v17_23963_c1 3300050491 Bacteria 3536
299 nmdc:mga00v17_480939_c1 3300050491 Bacteria 805
300 nmdc:mga00v17_625_c1 3300050491 Bacteria 19623
301 nmdc:mga0yw44_28023_c1 3300050492 Bacteria 3236
302 nmdc:mga0yw44_32828_c1 3300050492 Bacteria 3028
303 nmdc:mga0yw44_3347_c1 3300050492 Bacteria 7104
304 nmdc:mga0yw44_70491_c1 3300050492 Bacteria 2167
305 nmdc:mga0k408_261615_c1 3300050493 Bacteria 1033
306 nmdc:mga06z11_19192_c1 3300050494 Bacteria 3138
307 nmdc:mga06z11_468092_c1 3300050494 Bacteria 762
308 nmdc:mga04h51_519335_c1 3300050495 Bacteria 510
309 nmdc:mga07m45_635089_c1 3300050496 Unclassified 616
310 nmdc:mga05p37_1058735_c1 3300050507 Unclassified 854
311 nmdc:mga0sz30_19197_c2 3300050516 Bacteria 1767
312 Ga0495619_0686666 3300053085 Bacteria 697
313 Ga0495619_1005473 3300053085 Bacteria 558
314 Ga0500568_0064289 3300053139 Bacteria 1414
315 Ga0500616_0000813 3300053153 Bacteria 35573
316 Ga0501084_0557358 3300054114 Bacteria 968
317 Ga0501082_0280920 3300060353 Bacteria 1449
318 Ga0501082_0333861 3300060353 Bacteria 1321
319 Ga0530510_0159717 3300061734 Bacteria 1667
320 nmdc:mga03n38_451296_c1
321 Ga0070670_101557876
322 Ga0068868_100585629
323 Ga0068868_101270062
324 Ga0070689_100055900
325 Ga0070687_100757408
326 Ga0070687_101363267
327 Ga0070669_100721740
328 Ga0070675_100382464
329 Ga0070671_100457956
330 Ga0070671_101522743
331 Ga0070674_100031276
332 Ga0070673_100937364
333 Ga0070688_100397801
334 Ga0070667_100134250
335 Ga0070667_100291712
336 Ga0070711_101091846
337 Ga0070700_100041131
338 Ga0070678_100388008
339 Ga0070678_101328150
340 Ga0068867_100015336
341 Ga0070685_10052972
342 Ga0070685_10153572
343 Ga0070684_100798812
344 Ga0070672_100550506
345 Ga0068854_101588056
346 Ga0070702_100088876
347 Ga0068859_100289397
348 Ga0068859_100324300
349 Ga0068864_101239764
350 Ga0068866_10107383
351 Ga0068861_100405014
352 Ga0068861_100962062
353 Ga0068861_101161896
354 Ga0068870_10908638
355 Ga0068863_100013960
356 Ga0068858_100027963
357 Ga0068858_100137636
358 Ga0068860_100048008
359 Ga0068860_100089728
360 Ga0068860_100278420
361 Ga0068860_101404752
362 Ga0068862_100459647
363 Ga0068862_100622927
364 Ga0068862_100897867
365 Ga0075365_10000071
366 Ga0075365_10013659
367 Ga0075365_10114821
368 Ga0075365_10297532
369 Ga0075365_10429518
370 Ga0075368_10013153
371 Ga0075363_100028550
372 Ga0075363_100097877
373 Ga0075363_100422252
374 Ga0075364_10007674
375 Ga0075364_10012934
376 Ga0075364_10023706
377 Ga0075364_10030154
378 Ga0075364_10147592
379 Ga0075362_10023358
380 Ga0075362_10054328
381 Ga0075362_10285491
382 Ga0075367_10078144
383 Ga0075367_10188892
384 Ga0075367_10379075
385 Ga0075369_10046574
386 Ga0075366_10272302
387 Ga0075370_10151566
388 Ga0075370_10239668
389 Ga0075370_10678346
390 Ga0068871_100390121
391 Ga0068865_100072798
392 Ga0068865_100203048
393 Ga0097620_100289415
394 Ga0097620_100324289
395 Ga0105251_10029362
396 Ga0105250_10495694
397 Ga0105245_10699352
398 Ga0105245_11247597
399 Ga0105245_11367550
400 Ga0114129_10631795
401 Ga0114129_11042743
402 Ga0105243_10031549
403 Ga0105243_10991071
404 Ga0105243_11436954
405 Ga0105243_12120220
406 Ga0105242_10014988
407 Ga0105248_10179399
408 Ga0105248_11566381
409 Ga0105237_12739111
410 Ga0105238_11494174
411 Ga0105249_10165040
412 Ga0105249_10716751
413 Ga0105249_12324558
414 Ga0105249_13075406
415 Ga0105239_10269267
416 Ga0157378_10002711
417 Ga0157378_10250894
418 Ga0157378_10385422
419 Ga0163162_10303594
420 Ga0163162_10543615
421 Ga0163162_10637194
422 Ga0163162_12738593
423 Ga0157375_10079055
424 Ga0157375_10374640
425 Ga0163163_10064375
426 Ga0157380_10061867
427 Ga0157380_12542915
428 Ga0157377_11353783
429 Ga0157379_10028156
430 Ga0157379_10038363
431 Ga0157376_10034597
432 Ga0157376_10426930
433 Ga0157376_10487076
434 Ga0163161_10225950
435 Ga0163161_11408697
436 Ga0207666_1005223
437 Ga0207697_10044287
438 Ga0207682_10033287
439 Ga0207642_10012215
440 Ga0207688_10065891
441 Ga0207645_11181221
442 Ga0207662_10736111
443 Ga0207662_11037356
444 Ga0207681_10989674
445 Ga0207687_10674616
446 Ga0207687_11236145
447 Ga0207664_10506357
448 Ga0207644_10300150
449 Ga0207706_10059303
450 Ga0207686_10473527
451 Ga0207670_10315130
452 Ga0207669_10034896
453 Ga0207704_10019838
454 Ga0207691_10716152
455 Ga0207711_11073573
456 Ga0207651_10640145
457 Ga0207712_10073698
458 Ga0207712_10133504
459 Ga0207712_10491784
460 Ga0207712_11339525
461 Ga0207668_10754417
462 Ga0207640_10116953
463 Ga0207658_10108136
464 Ga0207658_10255272
465 Ga0207677_10441317
466 Ga0207703_10041195
467 Ga0207703_10378411
468 Ga0207708_10096464
469 Ga0207648_10009661
470 Ga0207648_10217758
471 Ga0207675_100078030
472 Ga0207683_10053671
473 Ga0268265_10338113
474 Ga0268265_10935986
475 Ga0268264_10037328
476 Ga0268264_10174898
477 Ga0268264_10201777
478 Ga0265760_10039637
479 Ga0316575_10381728
480 Ga0316579_10069377
481 Ga0316576_10000733
482 Ga0316576_10006011
483 Ga0316576_10013683
484 Ga0316576_10046460
485 Ga0316576_10057824
486 Ga0316578_10005553
487 Ga0316578_10086727
488 Ga0316578_10149627
489 Ga0307413_10080735
490 Ga0316585_10039630
491 Ga0316580_10025002
492 Ga0316574_0005941
493 Ga0316574_0023902
494 Ga0316574_0292683
495 Ga0316574_0356182
496 Ga0373931_0546979
497 Ga0316582_0199627
498 Ga0316582_0345171
499 Ga0316584_0015600
500 Ga0316584_0022160
501 Ga0316584_0367211
502 Ga0436364_1497971
503 Ga0400483_141406
504 Ga0400483_234221
505 Ga0436365_1684510
506 Ga0439465_0128925
507 Ga0451791_1478098
508 Ga0451793_0990435
509 Ga0451797_0024862
510 Ga0451797_0994683
511 Ga0451797_1245711
512 Ga0451837_1654337
513 Ga0451849_1076375
514 Ga0451843_0349066
515 Ga0439431_0090338
516 Ga0451577_0009196
517 Ga0466969_0138432
518 Ga0466966_0086067
519 Ga0466961_0099384
520 Ga0466963_0473236
521 Ga0466963_0734150
522 Ga0453684_0006714
523 Ga0466959_0182587
524 Ga0466958_0241568
525 Ga0466967_0134679
526 Ga0495603_0308621
527 Ga0495629_0861907
528 Ga0495641_0024071
529 Ga0495664_0355504
530 Ga0495634_0038224
531 Ga0495658_0428942
532 Ga0495670_0032155
533 Ga0495649_0201038
534 Ga0496100_0180011
535 Ga0496100_0442837
536 Ga0496101_0002986
537 Ga0496103_0146836
538 Ga0496104_0010672
539 Ga0496104_0023537
540 Ga0496104_0710462
541 Ga0496105_0060281
542 Ga0496105_0203006
543 Ga0496105_0567675
544 Ga0496106_0112372
545 Ga0496106_0877234
546 Ga0496108_0761865
547 Ga0496109_0153332
548 Ga0496109_0197406
549 Ga0496109_0243507
550 Ga0496109_0399102
551 Ga0496109_0760193
552 Ga0496110_0003359
553 Ga0496110_0016363
554 Ga0496110_0042048
555 Ga0496110_1132785
556 Ga0496111_0012541
557 Ga0496111_0066945
558 Ga0496111_0117815
559 Ga0496111_0301812
560 Ga0496114_0005752
561 Ga0496114_0044468
562 Ga0496114_0250415
563 Ga0496114_0449626
564 Ga0496114_0651054
565 Ga0496115_0506702
566 Ga0496126_1246940
567 Ga0501031_0063668
568 Ga0501031_0279941
569 Ga0501031_0853995
570 Ga0501034_0021602
571 Ga0501036_0032332
572 Ga0501039_0882253
573 Ga0501040_0076575
574 Ga0501041_0038869
575 Ga0501042_0047152
576 Ga0501042_0341775
577 Ga0501042_0546238
578 Ga0501042_1230006
579 Ga0501046_0636553
580 Ga0501048_0041593
581 Ga0501048_0107304
582 Ga0501069_0000168
583 Ga0501070_0000030
584 Ga0501070_0509053
585 Ga0501071_0007190
586 Ga0501071_0017157
587 Ga0501071_0046274
588 Ga0501073_0391121
589 Ga0501075_0082825
590 Ga0501075_0140986
591 Ga0501075_0539545
592 Ga0501076_0044448
593 Ga0501076_0251104
594 Ga0501076_0775692
595 Ga0501077_0610131
596 Ga0501079_0156585
597 Ga0501080_0001263
598 Ga0501080_0223921
599 Ga0501035_0128547
600 Ga0501035_0149321
601 Ga0501035_0174690
602 Ga0501044_0171186
603 Ga0501044_0634096
604 Ga0501045_0014510
605 Ga0501045_0052545
606 Ga0501045_0545524
607 nmdc:mga03683_251575_c1
608 nmdc:mga03683_46956_c1
609 nmdc:mga03n38_239188_c1
610 nmdc:mga03n38_27610_c1
611 nmdc:mga03n38_326721_c1
612 nmdc:mga03n38_54886_c1
613 nmdc:mga00v17_10088_c1
614 nmdc:mga00v17_175181_c1
615 nmdc:mga00v17_217424_c1
616 nmdc:mga00v17_237962_c1
617 nmdc:mga00v17_23963_c1
618 nmdc:mga00v17_480939_c1
619 nmdc:mga00v17_625_c1
620 nmdc:mga0yw44_28023_c1
621 nmdc:mga0yw44_32828_c1
622 nmdc:mga0yw44_3347_c1
623 nmdc:mga0yw44_70491_c1
624 nmdc:mga0k408_261615_c1
625 nmdc:mga06z11_19192_c1
626 nmdc:mga06z11_468092_c1
627 nmdc:mga04h51_519335_c1
628 nmdc:mga07m45_635089_c1
629 nmdc:mga05p37_1058735_c1
630 nmdc:mga0sz30_19197_c2
631 Ga0495619_0686666
632 Ga0495619_1005473
633 Ga0500568_0064289
634 Ga0500616_0000813
635 Ga0501084_0557358
636 Ga0501082_0280920
637 Ga0501082_0333861
638 Ga0530510_0159717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5axh-assembly1.cif.gz_A crystal structure of thermophilic dextranase from thermoanaerobacter pseudethanolicus, d312g mutant in complex with isomaltohexaose 0.8306 42 127
5axg-assembly1.cif.gz_B crystal structure of thermophilic dextranase from thermoanaerobacter pseudethanolicus 0.8242 42 127
3wnp-assembly1.cif.gz_A d308a, f268v, d469y, a513v, and y515s quintuple mutant of bacillus circulans t-3040 cycloisomaltooligosaccharide glucanotransferase complexed with isomaltoundecaose 0.8212 44 127
3wnn-assembly2.cif.gz_B d308a mutant of bacillus circulans t-3040 cycloisomaltooligosaccharide glucanotransferase complexed with isomaltooctaose 0.7862 44 127
3wnk-assembly1.cif.gz_A crystal structure of bacillus circulans t-3040 cycloisomaltooligosaccharide glucanotransferase 0.7807 38 127
ID Description Score Start End Superfamily
af_A0A0R4IGK8_472_586_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7536 44 130 2.60.40.10
4ypjB02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7401 42 128 2.60.40.10
3fn9D02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7292 39 127 2.60.40.10
5dmyC02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7267 42 126 2.60.40.10
3wnoB01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7211 8 127 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A356WIP3-F1-model_v4 Uncharacterized protein 0.9923 2 132
AF-A0A388P2D4-F1-model_v4 Uncharacterized protein 0.9921 1 132
AF-A0A388P2D4-F1-model_v4 Uncharacterized protein 0.9847 1 132
AF-A0A6B1B6K2-F1-model_v4 Uncharacterized protein 0.9834 1 132
AF-A0A356WIP3-F1-model_v4 Uncharacterized protein 0.9775 2 132

Map