F405138

General Info

Members Datasets Scaffolds Average Seq Length
319 220 638 166

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10072637|Ga0307513_100726373
Length 194
Sequence MTSHMPTTTTTQMATHTAVSPVSATAAYWTTLDSPLGQLLLTADESGALTSLSVPGQKGGRTLESVEAAEGGGWRRDPGPFRAAEVQLAAYFAGELTRFQLELRSSGTAFRQRVWDALDSVPYGETTTYGRIAARIGASRAAVRAVGGAIGANPLLVVRPCHRVIGADGSLTGYAGGLDRKRRLLGLEGVPLAP

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
11 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
12 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
13 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
14 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
15 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
16 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
17 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
18 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
19 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
24 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
25 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
26 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
27 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
28 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
29 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
30 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
31 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
32 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
33 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
34 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
35 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
36 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
37 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
38 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
39 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
40 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
41 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
42 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
43 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
44 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
45 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
46 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
47 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
48 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
49 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
50 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
51 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
52 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
53 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
54 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
55 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
56 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
57 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
58 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
59 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
60 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
61 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
64 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
65 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
66 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
69 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
70 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
71 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
72 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
73 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
74 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
75 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
76 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
77 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
78 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
81 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
82 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
83 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
84 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
85 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
88 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
89 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
90 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
91 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
98 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
99 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
100 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
101 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
102 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
103 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
107 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
108 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
114 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
115 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
116 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
117 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
118 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
138 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
142 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
143 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
144 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
145 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
146 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
147 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
148 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
149 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
150 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
151 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
152 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
153 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
154 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
155 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
156 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
157 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
158 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
159 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
160 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
161 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
163 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
164 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
165 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
166 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
167 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
168 2643221548 Streptomyces sp. Root55 Isolate Unclassified
169 2643221578 Streptomyces sp. Root63 Isolate Unclassified
170 2643221647 Streptomyces sp. Root369 Isolate Unclassified
171 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
172 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
173 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
174 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
175 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
176 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
177 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
178 2808606448 Streptomyces sp. 193411 Isolate Unclassified
179 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
180 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
181 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
182 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
183 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
184 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
185 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
186 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
187 2862574272 Streptomyces sp. AcE210 Isolate Nodule
188 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
189 2867428634 Streptomyces sp. RP5T Isolate Unclassified
190 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
191 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
192 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
193 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
194 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
195 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
196 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
197 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
198 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
199 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
200 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
201 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
202 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
203 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
204 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
205 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
206 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
207 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
208 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
209 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
210 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
211 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
212 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
213 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
214 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
215 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
216 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
217 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
218 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
219 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
220 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.19
Metatranscriptomes 0.31
Isolates 18.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.34
Nodule 1.25
Rhizoplane 1.25
Rhizosphere 73.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10072637 3300031456 Bacteria 3585
2 rootH1_10085245 3300003316 Bacteria 1087
3 rootH1_10014852 3300003323 Bacteria 2196
4 rootH1_10025719 3300003323 Bacteria 4403
5 JGI25160J50197_1006559 3300003354 Bacteria 4692
6 JGI25160J50197_1042309 3300003354 Bacteria 1038
7 JGI25160J50197_1056794 3300003354 Bacteria 800
8 Ga0006562J51391_1200404 3300003578 Bacteria 810
9 Ga0070683_100221999 3300005329 Bacteria 1796
10 Ga0070714_100247676 3300005435 Bacteria 1647
11 Ga0070706_100261965 3300005467 Bacteria 1614
12 Ga0075365_10181670 3300006038 Bacteria 1471
13 Ga0075370_10248073 3300006353 Bacteria 1055
14 Ga0105251_10065977 3300009011 Bacteria 1693
15 Ga0105250_10130117 3300009092 Bacteria 1039
16 Ga0105250_10310030 3300009092 Bacteria 684
17 Ga0105246_11624648 3300011119 Bacteria 612
18 Ga0157376_10863465 3300014969 Bacteria 921
19 Ga0183367_1001 3300015688 Bacteria 1225545
20 Ga0213876_10053181 3300021384 Bacteria 2139
21 Ga0213875_10013693 3300021388 Bacteria 3975
22 Ga0207426_1000496 3300025302 Bacteria 58627
23 Ga0207426_1001090 3300025302 Bacteria 25193
24 Ga0207426_1003010 3300025302 Bacteria 9786
25 Ga0207713_1071783 3300025735 Bacteria 1276
26 Ga0207684_10298543 3300025910 Bacteria 1389
27 Ga0207664_10131993 3300025929 Bacteria 2103
28 Ga0209371_1016327 3300027312 Bacteria 1963
29 Ga0307517_10007803 3300028786 Bacteria 15519
30 Ga0268256_1020654 3300030500 Bacteria 1771
31 Ga0307513_10252563 3300031456 Bacteria 1559
32 Ga0307508_10013860 3300031616 Bacteria 7355
33 Ga0307508_10049775 3300031616 Bacteria 3731
34 Ga0307514_10034710 3300031649 Bacteria 4018
35 Ga0307514_10174061 3300031649 Bacteria 1400
36 Ga0307516_10006658 3300031730 Bacteria 13504
37 Ga0307516_10204507 3300031730 Bacteria 1692
38 Ga0307413_10543191 3300031824 Bacteria 941
39 Ga0307410_10399302 3300031852 Bacteria 1110
40 Ga0307409_100208608 3300031995 Bacteria 1754
41 Ga0307416_101544107 3300032002 Bacteria 769
42 Ga0307510_10162019 3300033180 Bacteria 1832
43 Ga0395898_0156070 3300037466 Bacteria 2183
44 Ga0395898_0566520 3300037466 Bacteria 1078
45 Ga0436364_0115873 3300037853 Bacteria 11611
46 Ga0436364_0369741 3300037853 Bacteria 15551
47 Ga0436365_0420796 3300039437 Bacteria 75046
48 Ga0436365_1854358 3300039437 Bacteria 1165
49 Ga0436363_1536543 3300039450 Bacteria 914
50 Ga0439439_0009033 3300041406 Bacteria 2364
51 Ga0439439_0025985 3300041406 Bacteria 1474
52 Ga0451802_0283623 3300041460 Bacteria 1025
53 Ga0451843_0698191 3300041509 Bacteria 625
54 Ga0451853_0718212 3300041512 Bacteria 7900
55 Ga0451853_0733643 3300041512 Bacteria 1484
56 Ga0451853_3852879 3300041512 Bacteria 2129
57 Ga0439433_0060713 3300041999 Bacteria 901
58 Ga0439448_0009454 3300042005 Bacteria 2874
59 Ga0439449_0026876 3300042007 Bacteria 2147
60 Ga0439454_013302 3300042011 Bacteria 1127
61 Ga0439455_0021947 3300042012 Bacteria 1526
62 Ga0439457_001711 3300042014 Bacteria 6504
63 Ga0439457_001777 3300042014 Bacteria 6377
64 Ga0439462_0001568 3300042015 Bacteria 5133
65 Ga0439462_0089922 3300042015 Bacteria 842
66 Ga0450903_000402 3300042138 Bacteria 9276
67 Ga0439458_0002801 3300042157 Bacteria 4198
68 Ga0439458_0067730 3300042157 Bacteria 898
69 Ga0466969_0058169 3300044656 Bacteria 1882
70 Ga0466972_0104400 3300044658 Bacteria 1340
71 Ga0466965_0000777 3300044683 Bacteria 12021
72 Ga0466965_0171733 3300044683 Bacteria 1141
73 Ga0466966_0008788 3300044684 Bacteria 6687
74 Ga0466966_0566269 3300044684 Bacteria 684
75 Ga0466961_0051455 3300044693 Bacteria 2630
76 Ga0466963_0000347 3300044694 Bacteria 20989
77 Ga0466963_1081696 3300044694 Bacteria 564
78 Ga0466964_0000964 3300044706 Bacteria 9513
79 Ga0466971_0021299 3300044719 Bacteria 2885
80 Ga0466970_0009893 3300044765 Bacteria 4828
81 Ga0466970_0025836 3300044765 Bacteria 3076
82 Ga0466957_0000506 3300044842 Bacteria 19520
83 Ga0466959_0025933 3300045049 Bacteria 4346
84 Ga0466958_0000794 3300045836 Bacteria 13913
85 Ga0466967_0078211 3300045976 Bacteria 2979
86 Ga0495627_162393 3300046453 Bacteria 621
87 Ga0495592_0112936 3300046454 Bacteria 1920
88 Ga0495603_0001054 3300046455 Bacteria 15984
89 Ga0495603_0002607 3300046455 Bacteria 10645
90 Ga0495603_0005484 3300046455 Bacteria 7572
91 Ga0495603_0021663 3300046455 Bacteria 3892
92 Ga0495603_0148094 3300046455 Bacteria 1364
93 Ga0495603_0217186 3300046455 Bacteria 1103
94 Ga0495590_0049980 3300046457 Bacteria 1459
95 Ga0495629_0001213 3300046459 Bacteria 20237
96 Ga0495629_0006056 3300046459 Bacteria 8987
97 Ga0495629_0121958 3300046459 Bacteria 1816
98 Ga0495629_0357858 3300046459 Bacteria 995
99 Ga0495638_0064510 3300046460 Bacteria 2256
100 Ga0495638_0238577 3300046460 Bacteria 1008
101 Ga0495638_0482206 3300046460 Bacteria 628
102 Ga0495653_0018094 3300046463 Bacteria 5728
103 Ga0495580_0056140 3300046472 Bacteria 2774
104 Ga0495582_0105203 3300046473 Bacteria 1582
105 Ga0495605_0158362 3300046474 Bacteria 1006
106 Ga0495639_0012226 3300046475 Bacteria 3703
107 Ga0495662_0045676 3300046476 Bacteria 2114
108 Ga0495662_0183091 3300046476 Bacteria 1032
109 Ga0495664_0002084 3300046477 Bacteria 10697
110 Ga0495664_0003156 3300046477 Bacteria 8948
111 Ga0495594_0000149 3300046499 Bacteria 33577
112 Ga0495594_0021528 3300046499 Bacteria 3441
113 Ga0495594_0103454 3300046499 Bacteria 1603
114 Ga0495594_0377893 3300046499 Bacteria 806
115 Ga0495596_0060076 3300046500 Bacteria 1481
116 Ga0495608_0000535 3300046511 Bacteria 26081
117 Ga0495628_0023724 3300046516 Bacteria 5030
118 Ga0495628_0165180 3300046516 Bacteria 1681
119 Ga0495631_0034350 3300046518 Bacteria 2274
120 Ga0495631_0222452 3300046518 Bacteria 806
121 Ga0495632_0080220 3300046519 Bacteria 1557
122 Ga0495643_0025202 3300046522 Bacteria 3367
123 Ga0495666_0006805 3300046526 Bacteria 5739
124 Ga0495652_0020376 3300046529 Bacteria 5895
125 Ga0495665_0010239 3300046531 Bacteria 5077
126 Ga0495640_0007070 3300046533 Bacteria 8836
127 Ga0495586_0008073 3300046535 Bacteria 5613
128 Ga0495587_0002037 3300046536 Bacteria 13489
129 Ga0495587_0121269 3300046536 Bacteria 1498
130 Ga0495645_0039415 3300046543 Bacteria 3446
131 Ga0495645_0071400 3300046543 Bacteria 2503
132 Ga0495645_0262941 3300046543 Bacteria 1141
133 Ga0495622_0031672 3300046557 Bacteria 2471
134 Ga0495622_0053056 3300046557 Bacteria 1881
135 Ga0495622_0070633 3300046557 Bacteria 1611
136 Ga0495633_0398972 3300046558 Bacteria 622
137 Ga0495667_0020784 3300046559 Bacteria 4429
138 Ga0495668_0117579 3300046616 Bacteria 1454
139 Ga0495668_0247460 3300046616 Bacteria 976
140 Ga0495634_0001912 3300046642 Bacteria 17835
141 Ga0495634_0054172 3300046642 Bacteria 2685
142 Ga0495611_0043634 3300046648 Bacteria 2005
143 Ga0495625_0194436 3300046660 Bacteria 1342
144 Ga0495661_0186392 3300046665 Bacteria 1096
145 Ga0495588_0001764 3300046674 Bacteria 9207
146 Ga0495588_0002729 3300046674 Bacteria 7569
147 Ga0495588_0053712 3300046674 Bacteria 2078
148 Ga0495588_0170880 3300046674 Bacteria 1149
149 Ga0495588_0287630 3300046674 Bacteria 866
150 Ga0495657_0001278 3300046675 Bacteria 21878
151 Ga0495657_0031580 3300046675 Bacteria 3700
152 Ga0495599_0059171 3300046678 Bacteria 2396
153 Ga0495623_0026909 3300046679 Bacteria 3700
154 Ga0495646_0011791 3300046680 Bacteria 5558
155 Ga0495646_0063163 3300046680 Bacteria 2199
156 Ga0495658_0015471 3300046683 Bacteria 3915
157 Ga0495658_0039084 3300046683 Bacteria 2631
158 Ga0495613_0005563 3300046689 Bacteria 9461
159 Ga0495613_0014695 3300046689 Bacteria 5809
160 Ga0495613_0055246 3300046689 Bacteria 2918
161 Ga0495613_0262832 3300046689 Bacteria 1202
162 Ga0495613_0511152 3300046689 Bacteria 808
163 Ga0495670_0018711 3300046691 Bacteria 3412
164 Ga0495589_0009722 3300046794 Bacteria 4996
165 Ga0495589_0017791 3300046794 Bacteria 3646
166 Ga0495589_0047989 3300046794 Bacteria 2114
167 Ga0495589_0080340 3300046794 Bacteria 1586
168 Ga0495589_0249375 3300046794 Bacteria 830
169 Ga0495600_0073007 3300046809 Bacteria 2240
170 Ga0495600_0135525 3300046809 Bacteria 1600
171 Ga0495600_0593584 3300046809 Bacteria 673
172 Ga0495581_0003595 3300047315 Bacteria 8917
173 Ga0495581_0011337 3300047315 Bacteria 5157
174 Ga0495581_0201774 3300047315 Bacteria 1163
175 Ga0495604_0000216 3300047317 Bacteria 52795
176 Ga0495604_0000746 3300047317 Bacteria 27316
177 Ga0495636_0099593 3300047318 Bacteria 1269
178 Ga0495636_0110831 3300047318 Bacteria 1207
179 Ga0495636_0233000 3300047318 Bacteria 848
180 Ga0495636_0264358 3300047318 Bacteria 798
181 Ga0495674_0022246 3300047319 Bacteria 5846
182 Ga0495676_0001615 3300047321 Bacteria 19605
183 Ga0495676_0001955 3300047321 Bacteria 18096
184 Ga0495676_0009231 3300047321 Bacteria 8986
185 Ga0495676_0014369 3300047321 Bacteria 7085
186 Ga0495676_0042602 3300047321 Bacteria 3724
187 Ga0495676_0073231 3300047321 Bacteria 2627
188 Ga0495676_0120583 3300047321 Bacteria 1908
189 Ga0495676_0437370 3300047321 Bacteria 864
190 Ga0495683_0284383 3300047323 Bacteria 715
191 Ga0495687_018329 3300047443 Bacteria 3461
192 Ga0495687_038711 3300047443 Bacteria 2114
193 Ga0495687_060205 3300047443 Bacteria 1567
194 Ga0495675_0036992 3300047444 Bacteria 3110
195 Ga0495675_0049116 3300047444 Bacteria 2682
196 Ga0495675_0066935 3300047444 Bacteria 2270
197 Ga0495679_091763 3300047446 Bacteria 851
198 Ga0495685_000810 3300047447 Bacteria 9574
199 Ga0495685_001546 3300047447 Bacteria 7060
200 Ga0495685_008562 3300047447 Bacteria 3399
201 Ga0495685_016143 3300047447 Bacteria 2551
202 Ga0495685_066666 3300047447 Bacteria 1209
203 Ga0495681_0017257 3300047470 Bacteria 4016
204 Ga0495681_0196327 3300047470 Bacteria 821
205 Ga0495684_0019480 3300047471 Bacteria 5225
206 Ga0495684_0081264 3300047471 Bacteria 2460
207 Ga0495593_0003082 3300047673 Bacteria 10022
208 Ga0495593_0006931 3300047673 Bacteria 6636
209 Ga0495602_0033544 3300048088 Bacteria 4815
210 Ga0495602_0139777 3300048088 Bacteria 1918
211 Ga0495602_0815921 3300048088 Bacteria 625
212 Ga0495614_0000308 3300048089 Bacteria 19362
213 Ga0495614_0011532 3300048089 Bacteria 3887
214 Ga0495614_0043661 3300048089 Bacteria 1923
215 Ga0496108_0159222 3300048911 Bacteria 1951
216 Ga0496113_0645127 3300048916 Bacteria 847
217 Ga0496125_0418074 3300048928 Bacteria 778
218 Ga0501033_0058900 3300049570 Bacteria 2836
219 Ga0501033_0081825 3300049570 Bacteria 2368
220 Ga0501036_0014819 3300049572 Bacteria 6502
221 Ga0501036_0109984 3300049572 Bacteria 2328
222 Ga0501038_0107936 3300049574 Bacteria 2309
223 Ga0501039_0002034 3300049575 Bacteria 14978
224 Ga0501043_0017370 3300049579 Bacteria 5642
225 Ga0501046_0082437 3300049580 Bacteria 2484
226 Ga0501047_0052140 3300049581 Bacteria 3954
227 Ga0501068_0110170 3300049584 Bacteria 1711
228 Ga0501070_0036091 3300049586 Bacteria 4128
229 Ga0501074_0018444 3300049590 Bacteria 5069
230 Ga0501044_0623793 3300049823 Bacteria 969
231 nmdc:mga0yw44_160579_c1 3300050492 Bacteria 1471
232 nmdc:mga07m45_219275_c1 3300050496 Bacteria 1106
233 Ga0495601_0014713 3300053077 Bacteria 4720
234 Ga0495619_0106997 3300053085 Bacteria 1907
235 Ga0500578_0020384 3300053086 Bacteria 4260
236 Ga0500644_0024659 3300053088 Bacteria 1841
237 Ga0500583_0284730 3300053092 Bacteria 811
238 Ga0500566_0032491 3300053094 Bacteria 3044
239 Ga0500640_014556 3300053095 Bacteria 3278
240 Ga0500553_053567 3300053101 Bacteria 1925
241 Ga0500553_114528 3300053101 Bacteria 1126
242 Ga0500556_0124596 3300053104 Bacteria 1007
243 Ga0500560_014199 3300053107 Bacteria 2116
244 Ga0500572_008970 3300053111 Bacteria 2353
245 Ga0500614_182559 3300053123 Bacteria 642
246 Ga0500621_026902 3300053126 Bacteria 2260
247 Ga0500652_002733 3300053131 Bacteria 5324
248 Ga0500658_0009576 3300053134 Bacteria 3572
249 Ga0500559_0332217 3300053136 Bacteria 712
250 Ga0500561_0003318 3300053137 Bacteria 2803
251 Ga0500600_0014502 3300053149 Bacteria 4790
252 Ga0500600_0099854 3300053149 Bacteria 1533
253 Ga0500600_0283587 3300053149 Bacteria 720
254 Ga0500616_0016641 3300053153 Bacteria 4181
255 Ga0500624_002057 3300053157 Bacteria 2818
256 Ga0500633_0038418 3300053160 Bacteria 1594
257 Ga0500634_0100876 3300053161 Bacteria 1444
258 Ga0501084_0871609 3300054114 Bacteria 757
259 Ga0466962_0005626 3300061719 Bacteria 6019
260 Ga0466962_0010806 3300061719 Bacteria 4389
261 2547407596 2547132111 Bacteria 8013147
262 2554256848 2554235005 Bacteria 6457341
263 2585295872 2582581312 Bacteria 7308206
264 2585309365 2582581313 Bacteria 10042643
265 2616901975 2616644941 Bacteria 8510691
266 2643764813 2643221548 Bacteria 8053412
267 2643902870 2643221578 Bacteria 9213798
268 2644264656 2643221647 Bacteria 10741251
269 2644404620 2643221673 Bacteria 9196637
270 2644462198 2643221682 Bacteria 6743283
271 2784591305 2784132148 Bacteria 8627943
272 2785340359 2784746763 Bacteria 9783172
273 2785372411 2784746768 Bacteria 10036182
274 2786673542 2786546132 Bacteria 10419719
275 2793982372 2791355406 Bacteria 11364898
276 2809234886 2808606448 Bacteria 8656184
277 2812355115 2811994879 Bacteria 9313447
278 2812477861 2811994917 Bacteria 7761064
279 2819697531 2818991463 Bacteria 7948711
280 2819745766 2818991472 Bacteria 10089953
281 2862283675 2862281513 Bacteria 9621493
282 2862291867 2862290372 Bacteria 7471434
283 2862389391 2862382967 Bacteria 10317375
284 2862511040 2862507626 Bacteria 9425308
285 2862574567 2862574272 Bacteria 10567477
286 2862576675 2862574272 Bacteria 10567477
287 2863409495 2863404153 Bacteria 9672205
288 2867437697 2867428634 Bacteria 9590268
289 2873157996 2873151551 Bacteria 8625867
290 2875395984 2875391855 Bacteria 7600475
291 2877678249 2877676314 Bacteria 9512378
292 2919472688 2919468124 Bacteria 9133025
293 2946048628 2946045630 Bacteria 8527308
294 2946070780 2946064051 Bacteria 8957905
295 2947226010 2947224130 Bacteria 9938529
296 2954383143 2954380949 Bacteria 10050426
297 2954679848 2954673503 Bacteria 9685905
298 2954684305 2954682443 Bacteria 9862841
299 2954693855 2954691527 Bacteria 10720516
300 2954708966 2954701450 Bacteria 10834262
301 2954713486 2954711539 Bacteria 10867210
302 2954723451 2954721474 Bacteria 10456478
303 2954738379 2954731030 Bacteria 10243860
304 2954742354 2954740390 Bacteria 10229294
305 2954757240 2954749733 Bacteria 10366972
306 2954761324 2954759201 Bacteria 9358192
307 2966600241 2966598605 Bacteria 7676064
308 2990067859 2990059506 Bacteria 9321252
309 8008563766 8008558824 Bacteria 10610750
310 8025480488 8025478263 Bacteria 8209203
311 8047901504 8047893842 Bacteria 11723082
312 8048136316 8048127548 Bacteria 11053136
313 8048357389 8048356638 Bacteria 11044339
314 8048378442 8048369669 Bacteria 11666822
315 8048387543 8048379754 Bacteria 11877923
316 8048412868 8048406513 Bacteria 8936924
317 8054165424 8054160619 Bacteria 7783213
318 8056447309 8056447290 Bacteria 7680491
319 8056667136 8056667051 Bacteria 6953971
320 Ga0307513_10072637
321 rootH1_10085245
322 rootH1_10014852
323 rootH1_10025719
324 JGI25160J50197_1006559
325 JGI25160J50197_1042309
326 JGI25160J50197_1056794
327 Ga0006562J51391_1200404
328 Ga0070683_100221999
329 Ga0070714_100247676
330 Ga0070706_100261965
331 Ga0075365_10181670
332 Ga0075370_10248073
333 Ga0105251_10065977
334 Ga0105250_10130117
335 Ga0105250_10310030
336 Ga0105246_11624648
337 Ga0157376_10863465
338 Ga0183367_1001
339 Ga0213876_10053181
340 Ga0213875_10013693
341 Ga0207426_1000496
342 Ga0207426_1001090
343 Ga0207426_1003010
344 Ga0207713_1071783
345 Ga0207684_10298543
346 Ga0207664_10131993
347 Ga0209371_1016327
348 Ga0307517_10007803
349 Ga0268256_1020654
350 Ga0307513_10252563
351 Ga0307508_10013860
352 Ga0307508_10049775
353 Ga0307514_10034710
354 Ga0307514_10174061
355 Ga0307516_10006658
356 Ga0307516_10204507
357 Ga0307413_10543191
358 Ga0307410_10399302
359 Ga0307409_100208608
360 Ga0307416_101544107
361 Ga0307510_10162019
362 Ga0395898_0156070
363 Ga0395898_0566520
364 Ga0436364_0115873
365 Ga0436364_0369741
366 Ga0436365_0420796
367 Ga0436365_1854358
368 Ga0436363_1536543
369 Ga0439439_0009033
370 Ga0439439_0025985
371 Ga0451802_0283623
372 Ga0451843_0698191
373 Ga0451853_0718212
374 Ga0451853_0733643
375 Ga0451853_3852879
376 Ga0439433_0060713
377 Ga0439448_0009454
378 Ga0439449_0026876
379 Ga0439454_013302
380 Ga0439455_0021947
381 Ga0439457_001711
382 Ga0439457_001777
383 Ga0439462_0001568
384 Ga0439462_0089922
385 Ga0450903_000402
386 Ga0439458_0002801
387 Ga0439458_0067730
388 Ga0466969_0058169
389 Ga0466972_0104400
390 Ga0466965_0000777
391 Ga0466965_0171733
392 Ga0466966_0008788
393 Ga0466966_0566269
394 Ga0466961_0051455
395 Ga0466963_0000347
396 Ga0466963_1081696
397 Ga0466964_0000964
398 Ga0466971_0021299
399 Ga0466970_0009893
400 Ga0466970_0025836
401 Ga0466957_0000506
402 Ga0466959_0025933
403 Ga0466958_0000794
404 Ga0466967_0078211
405 Ga0495627_162393
406 Ga0495592_0112936
407 Ga0495603_0001054
408 Ga0495603_0002607
409 Ga0495603_0005484
410 Ga0495603_0021663
411 Ga0495603_0148094
412 Ga0495603_0217186
413 Ga0495590_0049980
414 Ga0495629_0001213
415 Ga0495629_0006056
416 Ga0495629_0121958
417 Ga0495629_0357858
418 Ga0495638_0064510
419 Ga0495638_0238577
420 Ga0495638_0482206
421 Ga0495653_0018094
422 Ga0495580_0056140
423 Ga0495582_0105203
424 Ga0495605_0158362
425 Ga0495639_0012226
426 Ga0495662_0045676
427 Ga0495662_0183091
428 Ga0495664_0002084
429 Ga0495664_0003156
430 Ga0495594_0000149
431 Ga0495594_0021528
432 Ga0495594_0103454
433 Ga0495594_0377893
434 Ga0495596_0060076
435 Ga0495608_0000535
436 Ga0495628_0023724
437 Ga0495628_0165180
438 Ga0495631_0034350
439 Ga0495631_0222452
440 Ga0495632_0080220
441 Ga0495643_0025202
442 Ga0495666_0006805
443 Ga0495652_0020376
444 Ga0495665_0010239
445 Ga0495640_0007070
446 Ga0495586_0008073
447 Ga0495587_0002037
448 Ga0495587_0121269
449 Ga0495645_0039415
450 Ga0495645_0071400
451 Ga0495645_0262941
452 Ga0495622_0031672
453 Ga0495622_0053056
454 Ga0495622_0070633
455 Ga0495633_0398972
456 Ga0495667_0020784
457 Ga0495668_0117579
458 Ga0495668_0247460
459 Ga0495634_0001912
460 Ga0495634_0054172
461 Ga0495611_0043634
462 Ga0495625_0194436
463 Ga0495661_0186392
464 Ga0495588_0001764
465 Ga0495588_0002729
466 Ga0495588_0053712
467 Ga0495588_0170880
468 Ga0495588_0287630
469 Ga0495657_0001278
470 Ga0495657_0031580
471 Ga0495599_0059171
472 Ga0495623_0026909
473 Ga0495646_0011791
474 Ga0495646_0063163
475 Ga0495658_0015471
476 Ga0495658_0039084
477 Ga0495613_0005563
478 Ga0495613_0014695
479 Ga0495613_0055246
480 Ga0495613_0262832
481 Ga0495613_0511152
482 Ga0495670_0018711
483 Ga0495589_0009722
484 Ga0495589_0017791
485 Ga0495589_0047989
486 Ga0495589_0080340
487 Ga0495589_0249375
488 Ga0495600_0073007
489 Ga0495600_0135525
490 Ga0495600_0593584
491 Ga0495581_0003595
492 Ga0495581_0011337
493 Ga0495581_0201774
494 Ga0495604_0000216
495 Ga0495604_0000746
496 Ga0495636_0099593
497 Ga0495636_0110831
498 Ga0495636_0233000
499 Ga0495636_0264358
500 Ga0495674_0022246
501 Ga0495676_0001615
502 Ga0495676_0001955
503 Ga0495676_0009231
504 Ga0495676_0014369
505 Ga0495676_0042602
506 Ga0495676_0073231
507 Ga0495676_0120583
508 Ga0495676_0437370
509 Ga0495683_0284383
510 Ga0495687_018329
511 Ga0495687_038711
512 Ga0495687_060205
513 Ga0495675_0036992
514 Ga0495675_0049116
515 Ga0495675_0066935
516 Ga0495679_091763
517 Ga0495685_000810
518 Ga0495685_001546
519 Ga0495685_008562
520 Ga0495685_016143
521 Ga0495685_066666
522 Ga0495681_0017257
523 Ga0495681_0196327
524 Ga0495684_0019480
525 Ga0495684_0081264
526 Ga0495593_0003082
527 Ga0495593_0006931
528 Ga0495602_0033544
529 Ga0495602_0139777
530 Ga0495602_0815921
531 Ga0495614_0000308
532 Ga0495614_0011532
533 Ga0495614_0043661
534 Ga0496108_0159222
535 Ga0496113_0645127
536 Ga0496125_0418074
537 Ga0501033_0058900
538 Ga0501033_0081825
539 Ga0501036_0014819
540 Ga0501036_0109984
541 Ga0501038_0107936
542 Ga0501039_0002034
543 Ga0501043_0017370
544 Ga0501046_0082437
545 Ga0501047_0052140
546 Ga0501068_0110170
547 Ga0501070_0036091
548 Ga0501074_0018444
549 Ga0501044_0623793
550 nmdc:mga0yw44_160579_c1
551 nmdc:mga07m45_219275_c1
552 Ga0495601_0014713
553 Ga0495619_0106997
554 Ga0500578_0020384
555 Ga0500644_0024659
556 Ga0500583_0284730
557 Ga0500566_0032491
558 Ga0500640_014556
559 Ga0500553_053567
560 Ga0500553_114528
561 Ga0500556_0124596
562 Ga0500560_014199
563 Ga0500572_008970
564 Ga0500614_182559
565 Ga0500621_026902
566 Ga0500652_002733
567 Ga0500658_0009576
568 Ga0500559_0332217
569 Ga0500561_0003318
570 Ga0500600_0014502
571 Ga0500600_0099854
572 Ga0500600_0283587
573 Ga0500616_0016641
574 Ga0500624_002057
575 Ga0500633_0038418
576 Ga0500634_0100876
577 Ga0501084_0871609
578 Ga0466962_0005626
579 Ga0466962_0010806
580 2547407596
581 2554256848
582 2585295872
583 2585309365
584 2616901975
585 2643764813
586 2643902870
587 2644264656
588 2644404620
589 2644462198
590 2784591305
591 2785340359
592 2785372411
593 2786673542
594 2793982372
595 2809234886
596 2812355115
597 2812477861
598 2819697531
599 2819745766
600 2862283675
601 2862291867
602 2862389391
603 2862511040
604 2862574567
605 2862576675
606 2863409495
607 2867437697
608 2873157996
609 2875395984
610 2877678249
611 2919472688
612 2946048628
613 2946070780
614 2947226010
615 2954383143
616 2954679848
617 2954684305
618 2954693855
619 2954708966
620 2954713486
621 2954723451
622 2954738379
623 2954742354
624 2954757240
625 2954761324
626 2966600241
627 2990067859
628 8008563766
629 8025480488
630 8047901504
631 8048136316
632 8048357389
633 8048378442
634 8048387543
635 8048412868
636 8054165424
637 8056447309
638 8056667136

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01035

DNA_binding_1

6-O-methylguanine DNA methyltransferase, DNA binding domain

109

190

0.97

PF02870

Methyltransf_1N

6-O-methylguanine DNA methyltransferase, ribonuclease-like domain

27

105

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wx9-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis ogt in complex with dna 0.9559 1 157
4wx9-assembly1.cif.gz_C-4 crystal structure of mycobacterium tuberculosis ogt in complex with dna 0.9521 1 157
4wx9-assembly1.cif.gz_C-4 crystal structure of mycobacterium tuberculosis ogt in complex with dna 0.923 1 157
4zye-assembly1.cif.gz_A crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase 0.9222 2 156
4zyd-assembly2.cif.gz_A-3 crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase in complex with modified dna 0.9211 1 156
ID Description Score Start End Superfamily
af_Q2FV75_68_159_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9616 70 155 1.10.10.10
af_P26188_97_181_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9555 73 158 1.10.10.10
af_Q4DAC5_49_134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9531 73 158 1.10.10.10
5llqB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9465 74 156 1.10.10.10
af_Q5A0Y8_92_172_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.946 73 156 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A270QPB4-F1-model_v4 deleted 1.003 2 157
AF-A0A5J6H3M2-F1-model_v4 deleted 1.003 2 158
AF-A0A6G4B7K5-F1-model_v4 deleted 1.002 2 158
AF-S4ML79-F1-model_v4 Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63) (6-O-methylguanine-DNA methyltransferase) (MGMT) (O-6-methylguanine-DNA-alkyltransferase) 1.002 2 158 GO:0003908
GO:0005737
GO:0006307
GO:0032259
AF-A0A7W7XVD0-F1-model_v4 deleted 1.002 2 156

Map