F405078

General Info

Members Datasets Scaffolds Average Seq Length
319 210 307 522

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10050381|Ga0157374_100503813
Length 583
Sequence LATILQRWIKNIFKILLQIEKIDLTLCHVDAMKISYYQISVMKRNFFXXXLLTFTASVAMAQLNGEAPRVKIANGELEGVNESGIKTFKGVPFAAPPVDKFRWREPQPVQNWSGIRKADKFGPRAMQLPVFGDMNFRSDGMHEDCLYLNVWTPAKTGSEKLPVLVYFYGGGFMAGDGSELRYDGESMARKGIVAVTVNYRLGIFGFLSHPELTKESPHHASGNYGLLDQSAALQWVQKNIAAFGGDPKKITIAGESAGSFSVSAQMASPLSKNIIAGAIGESGSLLGLSPTASLKEAEKAGADFGTSIKANSLADLRAMPADQLLKATANAGFGRFPICTDGYFFPKSPLEIFEKGEQAHVPLLVGWNSQEMVYQMIMGQDKPTLDNYKKTVEKLYGDKSAEAMTVYSASNDEEAEQVATDLASDRFIGFSTWKWSDVQSKTGGKPVYRYLYARPRPQMRSEMGNARAGLAGGVIKDTSANKPPAMPPARGAVHSAEIEYALGNLSTNRVYDWQPEDYKVSEIMQALFANFIKTGNPNGLGVPEWPAVDSNKGVQVMHIDVDTKAIEDKNGKRYLFMDKTAKK

Samples

Sample ID Description Type Environment
1 2738541297 Duganella sp. GV083 Isolate Unclassified
2 2738541357 Duganella sp. GV053 Isolate Unclassified
3 2738543003 Duganella sp. GV066 Isolate Unclassified
4 2738543026 Duganella sp. GV089 Isolate Unclassified
5 2738543029 Duganella sp. GV039 Isolate Unclassified
6 2818991444 Filimonas endophytica 3197 Isolate Unclassified
7 2821131069 Duganella sp. 1224 Isolate Unclassified
8 2842711865 Duganella sp. R-73148 Isolate Unclassified
9 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
10 2857558681 Duganella sp. R-74565 Isolate Unclassified
11 2857564685 Duganella sp. R-74599 Isolate Unclassified
12 2919476304 Duganella sp. 3397 Isolate Unclassified
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
143 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
144 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
186 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
194 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
208 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
209 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.24
Metatranscriptomes 0
Isolates 3.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.09
Nodule 0
Rhizoplane 1.88
Rhizosphere 80.88
Stem 0
Stem Tuber 0
Unclassified 8.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000178 3300001989 Bacteria 21194
2 JGI25154J39366_1001504 3300002738 Bacteria 8152
3 JGI25406J46586_10007419 3300003203 Bacteria 5004
4 JGI25153J46596_10021137 3300003215 Unclassified 2434
5 rootH2_10027304 3300003320 Bacteria 8765
6 rootL2_10075322 3300003322 Bacteria 4037
7 rootL2_10149750 3300003322 Bacteria 2115
8 Ga0055529_1000341 3300003763 Bacteria 52197
9 Ga0055526_1000018 3300003771 Bacteria 198838
10 Ga0055526_1000029 3300003771 Bacteria 148855
11 Ga0055526_1013471 3300003771 Unclassified 3455
12 Ga0055528_1000120 3300003790 Bacteria 62209
13 Ga0055530_10005694 3300003791 Bacteria 5818
14 Ga0065165_1000012 3300005262 Bacteria 303241
15 Ga0070658_10000141 3300005327 Bacteria 63684
16 Ga0070658_10028955 3300005327 Bacteria 4447
17 Ga0070658_10040376 3300005327 Bacteria 3764
18 Ga0070683_100004444 3300005329 Bacteria 11560
19 Ga0070683_100008516 3300005329 Bacteria 8715
20 Ga0070683_100025263 3300005329 Bacteria 5332
21 Ga0070690_100006555 3300005330 Bacteria 6608
22 Ga0070670_100136812 3300005331 Bacteria 2117
23 Ga0068869_100062532 3300005334 Bacteria 2733
24 Ga0070682_100086110 3300005337 Bacteria 2045
25 Ga0068868_100019468 3300005338 Bacteria 5086
26 Ga0068868_100030524 3300005338 Bacteria 4133
27 Ga0070660_100017541 3300005339 Bacteria 5219
28 Ga0070689_100082846 3300005340 Bacteria 2520
29 Ga0070687_100022800 3300005343 Bacteria 2966
30 Ga0070661_100001488 3300005344 Bacteria 16275
31 Ga0070669_100002314 3300005353 Bacteria 13789
32 Ga0070669_100002875 3300005353 Bacteria 12417
33 Ga0070669_100048901 3300005353 Unclassified 3087
34 Ga0070675_100023993 3300005354 Bacteria 4882
35 Ga0070675_100106036 3300005354 Bacteria 2372
36 Ga0070671_100067848 3300005355 Bacteria 2974
37 Ga0070674_100024364 3300005356 Bacteria 3926
38 Ga0070673_100019982 3300005364 Bacteria 4821
39 Ga0070688_100001493 3300005365 Bacteria 11653
40 Ga0070688_100009230 3300005365 Bacteria 5384
41 Ga0070659_100016040 3300005366 Bacteria 5620
42 Ga0070659_100079802 3300005366 Bacteria 2612
43 Ga0070667_100041213 3300005367 Bacteria 3873
44 Ga0070667_100042279 3300005367 Bacteria 3824
45 Ga0070667_100046547 3300005367 Bacteria 3649
46 Ga0070709_10005617 3300005434 Bacteria 6790
47 Ga0070714_100084609 3300005435 Bacteria 2768
48 Ga0070711_100012818 3300005439 Bacteria 5250
49 Ga0070663_100116346 3300005455 Bacteria 2015
50 Ga0070678_100023069 3300005456 Bacteria 4139
51 Ga0070662_100031643 3300005457 Bacteria 3714
52 Ga0070685_10022188 3300005466 Bacteria 3457
53 Ga0070685_10036660 3300005466 Bacteria 2773
54 Ga0070685_10052206 3300005466 Bacteria 2365
55 Ga0070707_100000707 3300005468 Bacteria 33278
56 Ga0070707_100046786 3300005468 Bacteria 4140
57 Ga0070699_100011793 3300005518 Bacteria 7542
58 Ga0070699_100040637 3300005518 Bacteria 4026
59 Ga0070679_100052552 3300005530 Bacteria 4057
60 Ga0070684_100006173 3300005535 Bacteria 9242
61 Ga0070684_100024079 3300005535 Bacteria 5103
62 Ga0070684_100026830 3300005535 Bacteria 4856
63 Ga0070684_100033154 3300005535 Bacteria 4407
64 Ga0068853_100001327 3300005539 Bacteria 17802
65 Ga0068855_100100253 3300005563 Bacteria 3335
66 Ga0068855_100138913 3300005563 Bacteria 2771
67 Ga0068855_100232961 3300005563 Bacteria 2061
68 Ga0068855_100254880 3300005563 Bacteria 1956
69 Ga0070664_100000360 3300005564 Bacteria 33570
70 Ga0070664_100013638 3300005564 Bacteria 6623
71 Ga0070664_100043242 3300005564 Bacteria 3801
72 Ga0070664_100044452 3300005564 Bacteria 3750
73 Ga0068857_100000323 3300005577 Bacteria 32881
74 Ga0068857_100034671 3300005577 Bacteria 4464
75 Ga0068854_100068328 3300005578 Bacteria 2591
76 Ga0068856_100034937 3300005614 Bacteria 4925
77 Ga0068856_100154296 3300005614 Bacteria 2306
78 Ga0070702_100034378 3300005615 Bacteria 2794
79 Ga0068852_100016477 3300005616 Bacteria 5765
80 Ga0068859_100071304 3300005617 Unclassified 3510
81 Ga0068859_100134350 3300005617 Bacteria 2546
82 Ga0068864_100059330 3300005618 Bacteria 3310
83 Ga0068858_100024468 3300005842 Bacteria 5625
84 Ga0081455_10003135 3300005937 Bacteria 19234
85 Ga0081455_10065435 3300005937 Bacteria 3040
86 Ga0081539_10000402 3300005985 Bacteria 92866
87 Ga0081539_10003510 3300005985 Bacteria 19129
88 Ga0081539_10006618 3300005985 Bacteria 11000
89 Ga0070717_10007552 3300006028 Bacteria 8079
90 Ga0097621_100023199 3300006237 Bacteria 4826
91 Ga0068871_100037784 3300006358 Unclassified 3853
92 Ga0068871_100097392 3300006358 Bacteria 2459
93 Ga0075428_100112125 3300006844 Bacteria 2970
94 Ga0075431_100073912 3300006847 Bacteria 3517
95 Ga0075431_100081436 3300006847 Bacteria 3342
96 Ga0068865_100042019 3300006881 Bacteria 3115
97 Ga0097620_100071311 3300006931 Unclassified 3510
98 Ga0097620_100134350 3300006931 Bacteria 2546
99 Ga0105244_10011767 3300009036 Bacteria 5220
100 Ga0105240_10000063 3300009093 Bacteria 215936
101 Ga0105240_10000071 3300009093 Bacteria 204197
102 Ga0111539_10011987 3300009094 Bacteria 10872
103 Ga0105241_10036766 3300009174 Bacteria 3686
104 Ga0105242_10047546 3300009176 Bacteria 3484
105 Ga0105249_10157898 3300009553 Bacteria 2189
106 Ga0105249_10215910 3300009553 Bacteria 1885
107 Ga0105239_10000079 3300010375 Bacteria 135513
108 Ga0105239_10002585 3300010375 Bacteria 22929
109 Ga0105239_10014535 3300010375 Bacteria 8734
110 Ga0105246_10086121 3300011119 Bacteria 2252
111 Ga0157373_10023916 3300013100 Bacteria 4427
112 Ga0157371_10000494 3300013102 Bacteria 47840
113 Ga0157371_10016138 3300013102 Bacteria 5583
114 Ga0157371_10025020 3300013102 Bacteria 4356
115 Ga0157370_10015111 3300013104 Bacteria 7865
116 Ga0157369_10128118 3300013105 Bacteria 2690
117 Ga0157369_10308399 3300013105 Unclassified 1646
118 Ga0157374_10000003 3300013296 Bacteria 854471
119 Ga0157374_10012676 3300013296 Bacteria 7341
120 Ga0157374_10019255 3300013296 Bacteria 6038
121 Ga0157374_10023675 3300013296 Bacteria 5496
122 Ga0157374_10050381 3300013296 Bacteria 3870
123 Ga0157374_10077315 3300013296 Bacteria 3149
124 Ga0157374_10113390 3300013296 Bacteria 2609
125 Ga0157378_10003948 3300013297 Bacteria 13102
126 Ga0163162_10014163 3300013306 Bacteria 7792
127 Ga0163162_10021128 3300013306 Bacteria 6403
128 Ga0163162_10022082 3300013306 Bacteria 6271
129 Ga0163162_10204514 3300013306 Bacteria 2104
130 Ga0157372_10000813 3300013307 Bacteria 33849
131 Ga0157372_10014011 3300013307 Bacteria 8566
132 Ga0157372_10254539 3300013307 Bacteria 2038
133 Ga0163163_10002119 3300014325 Bacteria 16744
134 Ga0163163_10068552 3300014325 Bacteria 3530
135 Ga0157377_10041368 3300014745 Bacteria 2557
136 Ga0157376_10003534 3300014969 Bacteria 10778
137 Ga0157376_10035449 3300014969 Bacteria 4036
138 Ga0182006_1000017 3300015261 Bacteria 299454
139 Ga0182005_1000051 3300015265 Bacteria 114808
140 Ga0163161_10018156 3300017792 Bacteria 4931
141 Ga0213876_10021694 3300021384 Bacteria 3397
142 Ga0207425_1000211 3300025245 Bacteria 46314
143 Ga0209455_1000037 3300025272 Bacteria 464097
144 Ga0209673_1000016 3300025273 Bacteria 506202
145 Ga0209673_1000111 3300025273 Bacteria 180094
146 Ga0209673_1023425 3300025273 Unclassified 2103
147 Ga0209025_1001605 3300025294 Bacteria 28394
148 Ga0209564_1000009 3300025295 Bacteria 950196
149 Ga0209564_1000068 3300025295 Bacteria 311171
150 Ga0209564_1001661 3300025295 Bacteria 21364
151 Ga0209564_1001737 3300025295 Bacteria 20427
152 Ga0209758_1001186 3300025297 Bacteria 32950
153 Ga0209758_1001215 3300025297 Bacteria 32372
154 Ga0209758_1002513 3300025297 Bacteria 18609
155 Ga0209050_1002034 3300025298 Bacteria 18714
156 Ga0207426_1000002 3300025302 Bacteria 1249660
157 Ga0207426_1003728 3300025302 Bacteria 7960
158 Ga0209257_1002577 3300025304 Bacteria 17636
159 Ga0207656_10027317 3300025321 Bacteria 2334
160 Ga0207688_10029475 3300025901 Bacteria 3022
161 Ga0207645_10046883 3300025907 Bacteria 2760
162 Ga0207705_10000587 3300025909 Bacteria 30561
163 Ga0207684_10025510 3300025910 Bacteria 5037
164 Ga0207707_10011799 3300025912 Bacteria 7602
165 Ga0207695_10000068 3300025913 Bacteria 324859
166 Ga0207695_10000133 3300025913 Bacteria 222573
167 Ga0207695_10043676 3300025913 Bacteria 4776
168 Ga0207662_10041746 3300025918 Unclassified 2702
169 Ga0207657_10018767 3300025919 Bacteria 6588
170 Ga0207649_10002021 3300025920 Bacteria 11533
171 Ga0207646_10000236 3300025922 Bacteria 76096
172 Ga0207646_10002883 3300025922 Bacteria 19953
173 Ga0207646_10005925 3300025922 Bacteria 12752
174 Ga0207659_10038203 3300025926 Bacteria 3337
175 Ga0207664_10011556 3300025929 Bacteria 6284
176 Ga0207644_10034280 3300025931 Unclassified 3551
177 Ga0207644_10035825 3300025931 Unclassified 3480
178 Ga0207690_10019573 3300025932 Bacteria 4171
179 Ga0207706_10006646 3300025933 Bacteria 10694
180 Ga0207706_10008847 3300025933 Bacteria 9267
181 Ga0207706_10048996 3300025933 Unclassified 3734
182 Ga0207691_10003797 3300025940 Bacteria 14662
183 Ga0207691_10041834 3300025940 Bacteria 4227
184 Ga0207691_10070927 3300025940 Unclassified 3146
185 Ga0207711_10141328 3300025941 Bacteria 2166
186 Ga0207689_10005900 3300025942 Bacteria 10850
187 Ga0207689_10013446 3300025942 Bacteria 6989
188 Ga0207689_10021414 3300025942 Bacteria 5436
189 Ga0207661_10060786 3300025944 Bacteria 3050
190 Ga0207661_10084554 3300025944 Bacteria 2628
191 Ga0207679_10000575 3300025945 Bacteria 24610
192 Ga0207679_10010610 3300025945 Bacteria 5936
193 Ga0207679_10027386 3300025945 Bacteria 3941
194 Ga0207679_10155558 3300025945 Bacteria 1866
195 Ga0207667_10026274 3300025949 Bacteria 6363
196 Ga0207667_10082545 3300025949 Bacteria 3329
197 Ga0207668_10045217 3300025972 Bacteria 3001
198 Ga0207658_10078656 3300025986 Bacteria 2521
199 Ga0207658_10162251 3300025986 Bacteria 1833
200 Ga0207677_10011712 3300026023 Bacteria 5009
201 Ga0207703_10030917 3300026035 Bacteria 4233
202 Ga0207639_10004446 3300026041 Bacteria 9460
203 Ga0207702_10104818 3300026078 Unclassified 2503
204 Ga0207702_10181152 3300026078 Bacteria 1940
205 Ga0207648_10019561 3300026089 Bacteria 6111
206 Ga0207676_10032739 3300026095 Bacteria 3921
207 Ga0207674_10001817 3300026116 Bacteria 27232
208 Ga0207683_10015716 3300026121 Bacteria 6441
209 Ga0207698_10011192 3300026142 Bacteria 5805
210 Ga0207428_10006847 3300027907 Bacteria 10451
211 Ga0268264_10076562 3300028381 Bacteria 2847
212 Ga0307515_10000057 3300028794 Bacteria 261695
213 Ga0316177_1161913 3300030731 Bacteria 4431
214 Ga0316183_1004801 3300030742 Bacteria 53681
215 Ga0316181_1138860 3300030744 Bacteria 58548
216 Ga0316181_1293286 3300030744 Unclassified 1977
217 Ga0373955_0070096 3300035172 Bacteria 1958
218 Ga0316584_0041441 3300036712 Bacteria 3432
219 Ga0395899_0000145 3300037312 Bacteria 107297
220 Ga0395899_0000264 3300037312 Bacteria 68569
221 Ga0395905_0011974 3300037471 Bacteria 8363
222 Ga0436365_0109276 3300039437 Bacteria 2070
223 Ga0436365_0342852 3300039437 Bacteria 4062
224 Ga0436365_1533409 3300039437 Bacteria 3883
225 Ga0436363_0161216 3300039450 Bacteria 7738
226 Ga0451577_0212610 3300042876 Bacteria 1747
227 Ga0466972_0000004 3300044658 Bacteria 314413
228 Ga0466961_0037754 3300044693 Bacteria 3099
229 Ga0453684_0065346 3300044712 Bacteria 4640
230 Ga0466970_0000038 3300044765 Bacteria 47830
231 Ga0466959_0005499 3300045049 Bacteria 8687
232 Ga0451576_0045795 3300045051 Bacteria 4605
233 Ga0495617_000003 3300046452 Bacteria 541914
234 Ga0495638_0013474 3300046460 Bacteria 5566
235 Ga0495653_0000002 3300046463 Bacteria 507262
236 Ga0495650_0000072 3300046471 Bacteria 257886
237 Ga0495650_0000267 3300046471 Bacteria 100234
238 Ga0495650_0001047 3300046471 Bacteria 30813
239 Ga0495650_0005469 3300046471 Bacteria 8238
240 Ga0495580_0061062 3300046472 Bacteria 2647
241 Ga0495605_0000068 3300046474 Bacteria 137743
242 Ga0495585_0002789 3300046492 Bacteria 12177
243 Ga0495607_0002200 3300046501 Bacteria 16172
244 Ga0495606_0000001 3300046507 Bacteria 592123
245 Ga0495606_0000030 3300046507 Bacteria 249484
246 Ga0495606_0000220 3300046507 Bacteria 101211
247 Ga0495606_0002860 3300046507 Bacteria 19101
248 Ga0495610_0000003 3300046512 Bacteria 1203910
249 Ga0495610_0004339 3300046512 Bacteria 10528
250 Ga0495610_0008145 3300046512 Bacteria 6844
251 Ga0495628_0090629 3300046516 Bacteria 2367
252 Ga0495637_0000937 3300046520 Bacteria 18653
253 Ga0495643_0000028 3300046522 Bacteria 262886
254 Ga0495648_0016248 3300046524 Bacteria 5369
255 Ga0495648_0039269 3300046524 Bacteria 3013
256 Ga0495648_0045996 3300046524 Bacteria 2709
257 Ga0495654_0000037 3300046530 Bacteria 188218
258 Ga0495654_0014672 3300046530 Bacteria 4166
259 Ga0495609_0027989 3300046538 Bacteria 2574
260 Ga0495597_0000072 3300046542 Bacteria 87914
261 Ga0495597_0008659 3300046542 Bacteria 5086
262 Ga0495622_0000361 3300046557 Bacteria 32027
263 Ga0495633_0002540 3300046558 Bacteria 12804
264 Ga0495633_0020713 3300046558 Bacteria 3302
265 Ga0495668_0000452 3300046616 Bacteria 52507
266 Ga0495668_0000512 3300046616 Bacteria 48355
267 Ga0495668_0002400 3300046616 Bacteria 15521
268 Ga0495625_0000697 3300046660 Bacteria 47751
269 Ga0495625_0062361 3300046660 Bacteria 2635
270 Ga0495623_0028301 3300046679 Bacteria 3605
271 Ga0495671_0000010 3300046692 Bacteria 368641
272 Ga0495649_0008244 3300046694 Bacteria 6277
273 Ga0495600_0159567 3300046809 Bacteria 1458
274 Ga0495660_0003687 3300046810 Bacteria 9421
275 Ga0495672_0000212 3300047320 Bacteria 83026
276 Ga0495679_019713 3300047446 Bacteria 2362
277 Ga0495673_0000003 3300047469 Bacteria 1491337
278 Ga0495673_0000016 3300047469 Bacteria 580643
279 Ga0495686_0017218 3300047472 Bacteria 4874
280 Ga0495602_0177919 3300048088 Bacteria 1644
281 Ga0496109_0000457 3300048912 Bacteria 35038
282 Ga0496109_0004084 3300048912 Bacteria 12202
283 Ga0496109_0093959 3300048912 Bacteria 2776
284 Ga0496110_0031861 3300048913 Bacteria 4551
285 Ga0496112_0224045 3300048915 Bacteria 1836
286 Ga0496113_0100662 3300048916 Bacteria 2239
287 Ga0496122_0043946 3300048925 Bacteria 3494
288 Ga0496122_0086675 3300048925 Bacteria 2154
289 Ga0496123_0005534 3300048926 Bacteria 12680
290 Ga0496124_0037156 3300048927 Bacteria 4239
291 Ga0495678_000029 3300049459 Bacteria 219803
292 Ga0501032_0085910 3300049569 Unclassified 2091
293 Ga0501037_0028748 3300049573 Bacteria 4107
294 Ga0501038_0020879 3300049574 Bacteria 5886
295 Ga0501043_0006481 3300049579 Bacteria 9399
296 Ga0501047_0098968 3300049581 Bacteria 2795
297 nmdc:mga05p37_33458_c1 3300050507 Bacteria 6295
298 nmdc:mga06r32_96326_c1 3300050510 Bacteria 2898
299 nmdc:mga08y16_2563_c1 3300050511 Bacteria 18689
300 nmdc:mga08y16_4054_c1 3300050511 Bacteria 15288
301 nmdc:mga0n895_98218_c1 3300050512 Bacteria 2935
302 nmdc:mga0a205_139939_c1 3300050515 Bacteria 2320
303 Ga0500641_0018378 3300053096 Bacteria 2629
304 Ga0500618_000297 3300053125 Bacteria 37721
305 Ga0500586_000014 3300053145 Bacteria 37183
306 Ga0500586_002900 3300053145 Bacteria 3965
307 Ga0466962_0018189 3300061719 Bacteria 3381

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046809 Ga0495600_0159567 Ga0495600_0159567_111_1445 420
2 3300048915 Ga0496112_0224045 Ga0496112_0224045_24_1346 438
3 3300048088 Ga0495602_0177919 Ga0495602_0177919_249_1625 451
4 3300046507 Ga0495606_0000001 Ga0495606_0000001_210131_211666 454
5 3300046512 Ga0495610_0008145 Ga0495610_0008145_81_1616 454
6 3300046558 Ga0495633_0020713 Ga0495633_0020713_1605_3140 454
7 3300046616 Ga0495668_0000452 Ga0495668_0000452_27997_29532 454
8 3300047472 Ga0495686_0017218 Ga0495686_0017218_695_2230 454
9 3300049581 Ga0501047_0098968 Ga0501047_0098968_1398_2768 456
10 3300046660 Ga0495625_0000697 Ga0495625_0000697_43910_45454 457
11 3300013105 Ga0157369_10308399 Ga0157369_103083992 460
12 3300009094 Ga0111539_10011987 Ga0111539_100119875 463
13 3300027907 Ga0207428_10006847 Ga0207428_100068473 463
14 3300046460 Ga0495638_0013474 Ga0495638_0013474_3184_4728 463
15 3300050511 nmdc:mga08y16_4054_c1 nmdc:mga08y16_4054_c1_4068_5624 463
16 3300003322 rootL2_10075322 rootL2_100753223 464
17 3300046471 Ga0495650_0000072 Ga0495650_0000072_68441_69973 465
18 3300046616 Ga0495668_0002400 Ga0495668_0002400_610_2142 465
19 3300046512 Ga0495610_0004339 Ga0495610_0004339_8345_9886 470
20 3300025245 Ga0207425_1000211 Ga0207425_100021117 472
21 3300025294 Ga0209025_1001605 Ga0209025_10016057 472
22 3300025297 Ga0209758_1001186 Ga0209758_10011865 472
23 3300005617 Ga0068859_100134350 Ga0068859_1001343501 475
24 3300006931 Ga0097620_100134350 Ga0097620_1001343501 475
25 3300048925 Ga0496122_0043946 Ga0496122_0043946_1182_2693 478
26 3300048926 Ga0496123_0005534 Ga0496123_0005534_572_2083 478
27 3300013296 Ga0157374_10000003 Ga0157374_10000003667 480
28 3300046471 Ga0495650_0001047 Ga0495650_0001047_27809_29353 480
29 3300003322 rootL2_10149750 rootL2_101497502 482
30 3300003763 Ga0055529_1000341 Ga0055529_100034128 482
31 3300025272 Ga0209455_1000037 Ga0209455_1000037421 482
32 3300046507 Ga0495606_0000220 Ga0495606_0000220_32870_34498 482
33 3300046520 Ga0495637_0000937 Ga0495637_0000937_13833_15359 483
34 3300046530 Ga0495654_0000037 Ga0495654_0000037_7841_9367 483
35 3300046522 Ga0495643_0000028 Ga0495643_0000028_194047_195567 484
36 3300046524 Ga0495648_0016248 Ga0495648_0016248_2537_4057 484
37 3300046542 Ga0495597_0000072 Ga0495597_0000072_69579_71096 484
38 3300046660 Ga0495625_0062361 Ga0495625_0062361_536_2056 484
39 3300047320 Ga0495672_0000212 Ga0495672_0000212_45429_46949 484
40 3300047446 Ga0495679_019713 Ga0495679_019713_107_1627 484
41 3300049459 Ga0495678_000029 Ga0495678_000029_41402_42922 484
42 3300005340 Ga0070689_100082846 Ga0070689_1000828462 485
43 3300005353 Ga0070669_100002314 Ga0070669_10000231410 485
44 3300005365 Ga0070688_100009230 Ga0070688_1000092303 485
45 3300005367 Ga0070667_100041213 Ga0070667_1000412132 485
46 3300005466 Ga0070685_10036660 Ga0070685_100366602 485
47 3300005466 Ga0070685_10052206 Ga0070685_100522061 485
48 3300011119 Ga0105246_10086121 Ga0105246_100861212 485
49 3300025940 Ga0207691_10041834 Ga0207691_100418342 485
50 3300046524 Ga0495648_0045996 Ga0495648_0045996_212_1723 485
51 3300046557 Ga0495622_0000361 Ga0495622_0000361_14788_16377 485
52 3300053125 Ga0500618_000297 Ga0500618_000297_20834_22363 485
53 3300003771 Ga0055526_1000018 Ga0055526_100001886 486
54 3300025295 Ga0209564_1000068 Ga0209564_1000068192 486
55 3300046507 Ga0495606_0000030 Ga0495606_0000030_142033_143544 486
56 3300046692 Ga0495671_0000010 Ga0495671_0000010_119833_121353 487
57 3300010375 Ga0105239_10014535 Ga0105239_100145353 488
58 3300025907 Ga0207645_10046883 Ga0207645_100468832 489
59 3300046512 Ga0495610_0000003 Ga0495610_0000003_863703_865223 489
60 3300046558 Ga0495633_0002540 Ga0495633_0002540_7231_8754 489
61 3300053145 Ga0500586_000014 Ga0500586_000014_11440_12963 489
62 3300046471 Ga0495650_0005469 Ga0495650_0005469_4629_6155 490
63 3300005434 Ga0070709_10005617 Ga0070709_100056173 491
64 3300005439 Ga0070711_100012818 Ga0070711_1000128182 491
65 3300003320 rootH2_10027304 rootH2_100273044 492
66 3300005435 Ga0070714_100084609 Ga0070714_1000846092 492
67 3300005563 Ga0068855_100232961 Ga0068855_1002329612 492
68 3300005614 Ga0068856_100154296 Ga0068856_1001542962 492
69 3300015261 Ga0182006_1000017 Ga0182006_100001740 492
70 3300025929 Ga0207664_10011556 Ga0207664_100115563 492
71 3300025949 Ga0207667_10082545 Ga0207667_100825452 492
72 3300026078 Ga0207702_10181152 Ga0207702_101811522 492
73 3300021384 Ga0213876_10021694 Ga0213876_100216942 498
74 3300039437 Ga0436365_0342852 Ga0436365_0342852_995_2632 498
75 iso_pu_bacteria 2857564685 2857567011 498
76 3300046452 Ga0495617_000003 Ga0495617_000003_177277_178788 499
77 3300046463 Ga0495653_0000002 Ga0495653_0000002_361099_362610 499
78 3300046471 Ga0495650_0000267 Ga0495650_0000267_91722_93233 499
79 3300046492 Ga0495585_0002789 Ga0495585_0002789_10129_11640 499
80 3300046524 Ga0495648_0039269 Ga0495648_0039269_212_1723 499
81 3300046530 Ga0495654_0014672 Ga0495654_0014672_473_1984 499
82 3300046616 Ga0495668_0000512 Ga0495668_0000512_12667_14178 499
83 3300046810 Ga0495660_0003687 Ga0495660_0003687_2802_4313 499
84 3300047469 Ga0495673_0000003 Ga0495673_0000003_1040382_1041893 499
85 3300047469 Ga0495673_0000016 Ga0495673_0000016_330226_331737 499
86 3300048925 Ga0496122_0086675 Ga0496122_0086675_308_1819 499
87 3300048927 Ga0496124_0037156 Ga0496124_0037156_177_1694 499
88 3300053145 Ga0500586_002900 Ga0500586_002900_174_1685 499
89 iso_pu_bacteria 2738541297 2738829811 499
90 iso_pu_bacteria 2738541357 2739153607 499
91 iso_pu_bacteria 2738543003 2739195527 499
92 iso_pu_bacteria 2738543026 2739322003 499
93 iso_pu_bacteria 2738543029 2739340244 499
94 iso_pu_bacteria 2821131069 2821131770 499
95 3300002738 JGI25154J39366_1001504 JGI25154J39366_10015042 500
96 3300037312 Ga0395899_0000145 Ga0395899_0000145_45199_46770 500
97 3300046474 Ga0495605_0000068 Ga0495605_0000068_30421_31935 500
98 3300005356 Ga0070674_100024364 Ga0070674_1000243643 501
99 3300037312 Ga0395899_0000264 Ga0395899_0000264_65493_67013 501
100 3300003771 Ga0055526_1000029 Ga0055526_1000029114 502
101 3300009036 Ga0105244_10011767 Ga0105244_100117672 502
102 3300025295 Ga0209564_1000009 Ga0209564_100000919 502
103 3300046507 Ga0495606_0002860 Ga0495606_0002860_1914_3437 503
104 3300046694 Ga0495649_0008244 Ga0495649_0008244_4317_5846 503
105 iso_pu_bacteria 2842711865 2842715433 503
106 iso_pu_bacteria 2857558681 2857559208 503
107 3300046538 Ga0495609_0027989 Ga0495609_0027989_725_2284 504
108 3300046542 Ga0495597_0008659 Ga0495597_0008659_907_2466 504
109 3300013104 Ga0157370_10015111 Ga0157370_100151115 506
110 3300046501 Ga0495607_0002200 Ga0495607_0002200_3960_5588 506
111 3300005353 Ga0070669_100002875 Ga0070669_1000028753 507
112 3300005327 Ga0070658_10000141 Ga0070658_1000014112 508
113 3300025909 Ga0207705_10000587 Ga0207705_1000058723 508
114 3300025913 Ga0207695_10043676 Ga0207695_100436765 508
115 3300005563 Ga0068855_100100253 Ga0068855_1001002532 510
116 3300010375 Ga0105239_10000079 Ga0105239_100000797 510
117 3300013307 Ga0157372_10000813 Ga0157372_1000081315 510
118 3300025949 Ga0207667_10026274 Ga0207667_100262745 510
119 3300044693 Ga0466961_0037754 Ga0466961_0037754_345_2009 510
120 3300045049 Ga0466959_0005499 Ga0466959_0005499_3027_4691 510
121 3300048912 Ga0496109_0093959 Ga0496109_0093959_723_2276 510
122 3300061719 Ga0466962_0018189 Ga0466962_0018189_1220_2884 510
123 3300009093 Ga0105240_10000063 Ga0105240_1000006377 511
124 3300009093 Ga0105240_10000071 Ga0105240_1000007182 511
125 3300010375 Ga0105239_10002585 Ga0105239_1000258513 511
126 3300015265 Ga0182005_1000051 Ga0182005_100005174 511
127 3300025913 Ga0207695_10000068 Ga0207695_1000006865 511
128 3300025913 Ga0207695_10000133 Ga0207695_1000013381 511
129 3300036712 Ga0316584_0041441 Ga0316584_0041441_1029_2594 511
130 3300045051 Ga0451576_0045795 Ga0451576_0045795_1393_2964 511
131 3300046472 Ga0495580_0061062 Ga0495580_0061062_534_2117 511
132 iso_pu_bacteria 2919476304 2919478297 511
133 3300009553 Ga0105249_10157898 Ga0105249_101578982 512
134 3300039437 Ga0436365_0109276 Ga0436365_0109276_254_1852 513
135 3300039450 Ga0436363_0161216 Ga0436363_0161216_1429_3027 513
136 3300005337 Ga0070682_100086110 Ga0070682_1000861102 514
137 3300005530 Ga0070679_100052552 Ga0070679_1000525527 514
138 3300005563 Ga0068855_100138913 Ga0068855_1001389132 514
139 3300025912 Ga0207707_10011799 Ga0207707_100117997 514
140 3300005353 Ga0070669_100048901 Ga0070669_1000489011 517
141 3300005616 Ga0068852_100016477 Ga0068852_1000164773 517
142 3300025918 Ga0207662_10041746 Ga0207662_100417461 517
143 3300025940 Ga0207691_10003797 Ga0207691_100037972 517
144 3300025942 Ga0207689_10005900 Ga0207689_100059003 517
145 3300026142 Ga0207698_10011192 Ga0207698_100111923 517
146 3300037471 Ga0395905_0011974 Ga0395905_0011974_4143_5885 517
147 3300005327 Ga0070658_10040376 Ga0070658_100403761 518
148 3300005468 Ga0070707_100046786 Ga0070707_1000467863 518
149 3300005518 Ga0070699_100011793 Ga0070699_1000117937 518
150 3300005535 Ga0070684_100026830 Ga0070684_1000268303 518
151 3300005564 Ga0070664_100044452 Ga0070664_1000444522 518
152 3300005577 Ga0068857_100034671 Ga0068857_1000346712 518
153 3300005618 Ga0068864_100059330 Ga0068864_1000593302 518
154 3300006028 Ga0070717_10007552 Ga0070717_1000755210 518
155 3300014325 Ga0163163_10068552 Ga0163163_100685522 518
156 3300025910 Ga0207684_10025510 Ga0207684_100255103 518
157 3300025922 Ga0207646_10002883 Ga0207646_1000288312 518
158 3300025922 Ga0207646_10005925 Ga0207646_1000592510 518
159 3300025945 Ga0207679_10027386 Ga0207679_100273862 518
160 3300026095 Ga0207676_10032739 Ga0207676_100327392 518
161 3300048916 Ga0496113_0100662 Ga0496113_0100662_179_1792 518
162 3300048912 Ga0496109_0004084 Ga0496109_0004084_7684_9312 520
163 3300044765 Ga0466970_0000038 Ga0466970_0000038_40669_42294 522
164 3300006844 Ga0075428_100112125 Ga0075428_1001121252 523
165 3300050507 nmdc:mga05p37_33458_c1 nmdc:mga05p37_33458_c1_2714_4300 523
166 3300005367 Ga0070667_100042279 Ga0070667_1000422793 524
167 3300017792 Ga0163161_10018156 Ga0163161_100181564 524
168 3300026121 Ga0207683_10015716 Ga0207683_100157164 524
169 3300013102 Ga0157371_10025020 Ga0157371_100250204 525
170 3300013307 Ga0157372_10014011 Ga0157372_100140116 525
171 3300050511 nmdc:mga08y16_2563_c1 nmdc:mga08y16_2563_c1_9898_11493 526
172 3300050515 nmdc:mga0a205_139939_c1 nmdc:mga0a205_139939_c1_494_2089 526
173 3300013102 Ga0157371_10000494 Ga0157371_1000049425 527
174 3300005329 Ga0070683_100008516 Ga0070683_1000085167 528
175 3300005343 Ga0070687_100022800 Ga0070687_1000228002 528
176 3300005355 Ga0070671_100067848 Ga0070671_1000678482 528
177 3300005364 Ga0070673_100019982 Ga0070673_1000199823 528
178 3300005615 Ga0070702_100034378 Ga0070702_1000343782 528
179 3300005985 Ga0081539_10000402 Ga0081539_1000040244 528
180 3300006881 Ga0068865_100042019 Ga0068865_1000420192 528
181 3300025931 Ga0207644_10034280 Ga0207644_100342801 528
182 3300025941 Ga0207711_10141328 Ga0207711_101413282 528
183 3300025944 Ga0207661_10060786 Ga0207661_100607862 528
184 3300025972 Ga0207668_10045217 Ga0207668_100452171 528
185 3300025986 Ga0207658_10078656 Ga0207658_100786562 528
186 3300026089 Ga0207648_10019561 Ga0207648_100195614 528
187 3300003203 JGI25406J46586_10007419 JGI25406J46586_100074192 529
188 3300005339 Ga0070660_100017541 Ga0070660_1000175413 530
189 3300005354 Ga0070675_100023993 Ga0070675_1000239934 530
190 3300005366 Ga0070659_100079802 Ga0070659_1000798021 530
191 iso_pu_bacteria 2818991444 2819589353 531
192 3300046679 Ga0495623_0028301 Ga0495623_0028301_1733_3364 532
193 3300005327 Ga0070658_10028955 Ga0070658_100289553 533
194 3300005535 Ga0070684_100033154 Ga0070684_1000331542 533
195 3300005564 Ga0070664_100013638 Ga0070664_1000136382 533
196 3300025321 Ga0207656_10027317 Ga0207656_100273171 533
197 3300025945 Ga0207679_10010610 Ga0207679_100106102 533
198 3300005937 Ga0081455_10065435 Ga0081455_100654352 534
199 3300006237 Ga0097621_100023199 Ga0097621_1000231995 534
200 3300006358 Ga0068871_100037784 Ga0068871_1000377845 534
201 3300013306 Ga0163162_10014163 Ga0163162_100141635 534
202 3300014969 Ga0157376_10003534 Ga0157376_100035344 534
203 3300025297 Ga0209758_1002513 Ga0209758_100251311 534
204 3300049569 Ga0501032_0085910 Ga0501032_0085910_249_1865 534
205 3300049573 Ga0501037_0028748 Ga0501037_0028748_1654_3270 534
206 3300049574 Ga0501038_0020879 Ga0501038_0020879_3162_4778 534
207 3300049579 Ga0501043_0006481 Ga0501043_0006481_5541_7157 534
208 3300005338 Ga0068868_100019468 Ga0068868_1000194682 535
209 3300005468 Ga0070707_100000707 Ga0070707_10000070713 535
210 3300005518 Ga0070699_100040637 Ga0070699_1000406372 535
211 3300005937 Ga0081455_10003135 Ga0081455_1000313516 535
212 3300005985 Ga0081539_10003510 Ga0081539_100035103 535
213 3300006847 Ga0075431_100073912 Ga0075431_1000739122 535
214 3300006847 Ga0075431_100081436 Ga0075431_1000814362 535
215 3300013297 Ga0157378_10003948 Ga0157378_100039482 535
216 3300014745 Ga0157377_10041368 Ga0157377_100413682 535
217 3300025901 Ga0207688_10029475 Ga0207688_100294752 535
218 3300025922 Ga0207646_10000236 Ga0207646_1000023650 535
219 3300026035 Ga0207703_10030917 Ga0207703_100309172 535
220 3300044712 Ga0453684_0065346 Ga0453684_0065346_1557_3197 535
221 3300048912 Ga0496109_0000457 Ga0496109_0000457_23411_25036 535
222 3300050510 nmdc:mga06r32_96326_c1 nmdc:mga06r32_96326_c1_367_2004 535
223 3300050512 nmdc:mga0n895_98218_c1 nmdc:mga0n895_98218_c1_653_2290 535
224 3300053096 Ga0500641_0018378 Ga0500641_0018378_27_1652 535
225 3300025302 Ga0207426_1000002 Ga0207426_1000002768 536
226 3300028794 Ga0307515_10000057 Ga0307515_1000005762 536
227 3300042876 Ga0451577_0212610 Ga0451577_0212610_96_1718 536
228 iso_pu_bacteria 2842903701 2842907872 536
229 3300005563 Ga0068855_100254880 Ga0068855_1002548802 537
230 3300005564 Ga0070664_100043242 Ga0070664_1000432424 537
231 3300005578 Ga0068854_100068328 Ga0068854_1000683282 537
232 3300005614 Ga0068856_100034937 Ga0068856_1000349372 537
233 3300005985 Ga0081539_10006618 Ga0081539_100066188 537
234 3300009174 Ga0105241_10036766 Ga0105241_100367662 537
235 3300013100 Ga0157373_10023916 Ga0157373_100239162 537
236 3300013102 Ga0157371_10016138 Ga0157371_100161382 537
237 3300013105 Ga0157369_10128118 Ga0157369_101281182 537
238 3300013296 Ga0157374_10012676 Ga0157374_100126762 537
239 3300013307 Ga0157372_10254539 Ga0157372_102545392 537
240 3300025919 Ga0207657_10018767 Ga0207657_100187674 537
241 3300025933 Ga0207706_10008847 Ga0207706_100088472 537
242 3300026078 Ga0207702_10104818 Ga0207702_101048181 537
243 3300039437 Ga0436365_1533409 Ga0436365_1533409_158_1810 537
244 3300044658 Ga0466972_0000004 Ga0466972_0000004_88540_90174 537
245 3300005329 Ga0070683_100004444 Ga0070683_1000044444 538
246 3300005329 Ga0070683_100025263 Ga0070683_1000252633 538
247 3300005330 Ga0070690_100006555 Ga0070690_1000065551 538
248 3300005331 Ga0070670_100136812 Ga0070670_1001368121 538
249 3300005334 Ga0068869_100062532 Ga0068869_1000625322 538
250 3300005338 Ga0068868_100030524 Ga0068868_1000305242 538
251 3300005344 Ga0070661_100001488 Ga0070661_1000014885 538
252 3300005354 Ga0070675_100106036 Ga0070675_1001060362 538
253 3300005365 Ga0070688_100001493 Ga0070688_1000014935 538
254 3300005366 Ga0070659_100016040 Ga0070659_1000160402 538
255 3300005367 Ga0070667_100046547 Ga0070667_1000465473 538
256 3300005455 Ga0070663_100116346 Ga0070663_1001163462 538
257 3300005456 Ga0070678_100023069 Ga0070678_1000230693 538
258 3300005457 Ga0070662_100031643 Ga0070662_1000316433 538
259 3300005466 Ga0070685_10022188 Ga0070685_100221882 538
260 3300005535 Ga0070684_100006173 Ga0070684_1000061735 538
261 3300005535 Ga0070684_100024079 Ga0070684_1000240793 538
262 3300005539 Ga0068853_100001327 Ga0068853_10000132711 538
263 3300005564 Ga0070664_100000360 Ga0070664_1000003605 538
264 3300005577 Ga0068857_100000323 Ga0068857_10000032322 538
265 3300005617 Ga0068859_100071304 Ga0068859_1000713042 538
266 3300005842 Ga0068858_100024468 Ga0068858_1000244683 538
267 3300006358 Ga0068871_100097392 Ga0068871_1000973921 538
268 3300006931 Ga0097620_100071311 Ga0097620_1000713112 538
269 3300009176 Ga0105242_10047546 Ga0105242_100475462 538
270 3300009553 Ga0105249_10215910 Ga0105249_102159101 538
271 3300013296 Ga0157374_10019255 Ga0157374_100192552 538
272 3300013296 Ga0157374_10023675 Ga0157374_100236753 538
273 3300013296 Ga0157374_10050381 Ga0157374_100503813 538
274 3300013296 Ga0157374_10077315 Ga0157374_100773152 538
275 3300013296 Ga0157374_10113390 Ga0157374_101133901 538
276 3300013306 Ga0163162_10021128 Ga0163162_100211285 538
277 3300013306 Ga0163162_10022082 Ga0163162_100220823 538
278 3300013306 Ga0163162_10204514 Ga0163162_102045141 538
279 3300014325 Ga0163163_10002119 Ga0163163_100021193 538
280 3300014969 Ga0157376_10035449 Ga0157376_100354492 538
281 3300025920 Ga0207649_10002021 Ga0207649_100020217 538
282 3300025926 Ga0207659_10038203 Ga0207659_100382033 538
283 3300025931 Ga0207644_10035825 Ga0207644_100358251 538
284 3300025932 Ga0207690_10019573 Ga0207690_100195732 538
285 3300025933 Ga0207706_10006646 Ga0207706_100066468 538
286 3300025933 Ga0207706_10048996 Ga0207706_100489965 538
287 3300025940 Ga0207691_10070927 Ga0207691_100709271 538
288 3300025942 Ga0207689_10013446 Ga0207689_100134465 538
289 3300025942 Ga0207689_10021414 Ga0207689_100214145 538
290 3300025944 Ga0207661_10084554 Ga0207661_100845542 538
291 3300025945 Ga0207679_10000575 Ga0207679_100005757 538
292 3300025945 Ga0207679_10155558 Ga0207679_101555581 538
293 3300025986 Ga0207658_10162251 Ga0207658_101622511 538
294 3300026023 Ga0207677_10011712 Ga0207677_100117122 538
295 3300026041 Ga0207639_10004446 Ga0207639_100044462 538
296 3300026116 Ga0207674_10001817 Ga0207674_1000181722 538
297 3300028381 Ga0268264_10076562 Ga0268264_100765621 538
298 3300030731 Ga0316177_1161913 Ga0316177_11619132 538
299 3300030742 Ga0316183_1004801 Ga0316183_100480117 538
300 3300030744 Ga0316181_1138860 Ga0316181_113886027 538
301 3300030744 Ga0316181_1293286 Ga0316181_12932861 538
302 3300035172 Ga0373955_0070096 Ga0373955_0070096_171_1799 538
303 3300046516 Ga0495628_0090629 Ga0495628_0090629_317_1945 538
304 3300048913 Ga0496110_0031861 Ga0496110_0031861_2467_4095 538
305 3300001989 JGI24739J22299_10000178 JGI24739J22299_100001788 544
306 3300003215 JGI25153J46596_10021137 JGI25153J46596_100211372 544
307 3300003771 Ga0055526_1013471 Ga0055526_10134712 544
308 3300003790 Ga0055528_1000120 Ga0055528_10001202 544
309 3300003791 Ga0055530_10005694 Ga0055530_100056943 544
310 3300005262 Ga0065165_1000012 Ga0065165_1000012253 544
311 3300025273 Ga0209673_1000016 Ga0209673_1000016317 544
312 3300025273 Ga0209673_1000111 Ga0209673_1000111127 544
313 3300025273 Ga0209673_1023425 Ga0209673_10234252 544
314 3300025295 Ga0209564_1001661 Ga0209564_10016619 544
315 3300025295 Ga0209564_1001737 Ga0209564_10017374 544
316 3300025297 Ga0209758_1001215 Ga0209758_100121515 544
317 3300025298 Ga0209050_1002034 Ga0209050_10020343 544
318 3300025302 Ga0207426_1003728 Ga0207426_10037284 544
319 3300025304 Ga0209257_1002577 Ga0209257_10025778 544

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00135

COesterase

Carboxylesterase family

66

577

0.86

PF20434

BD-FAE

BD-FAE

148

273

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p1p-assembly1.cif.gz_bb crystal structure of human acetylcholinesterase in complex with (e)-3-hydroxy-6-(3-(4-(4-(((2r,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2h-pyran-2-yl)oxy)butyl)-1h-1,2,3-triazol-1-yl)propyl)picolinaldehyde oxime 0.8975 26 267
2ogs-assembly1.cif.gz_A crystal structure of the geobacillus stearothermophilus carboxylesterase est55 at ph 6.2 0.8634 28 537
3k9b-assembly4.cif.gz_C crystal structure of human liver carboxylesterase 1 (hce1) in covalent complex with the nerve agent cyclosarin (gf) 0.8625 29 538
3k9b-assembly4.cif.gz_C crystal structure of human liver carboxylesterase 1 (hce1) in covalent complex with the nerve agent cyclosarin (gf) 0.8571 29 538
2ogs-assembly1.cif.gz_A crystal structure of the geobacillus stearothermophilus carboxylesterase est55 at ph 6.2 0.8565 28 537
ID Description Score Start End Superfamily
2ogsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8634 28 537 3.40.50.1820
3k9bC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8625 29 538 3.40.50.1820
3k9bC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8571 29 538 3.40.50.1820
2ogsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8565 28 537 3.40.50.1820
af_Q54RL3_36_542_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8521 27 541 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A646FSZ5-F1-model_v4 deleted 0.97 28 267
AF-A0A5B9G0A8-F1-model_v4 Carboxylic ester hydrolase (EC 3.1.1.-) 0.9677 27 542 GO:0016787
AF-A0A3D2NCN8-F1-model_v4 deleted 0.9654 29 247
AF-A0A4Q3NYV3-F1-model_v4 deleted 0.9649 103 413
AF-A0A2M9CRS4-F1-model_v4 Carboxylic ester hydrolase (EC 3.1.1.-) 0.9569 29 543 GO:0052689

Feature Viewer

pLDDT pTM Quality
89.62 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map