F405078
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 319 | 210 | 307 | 522 |
Family's Representative Sequence
| Representative Sequence | 3300013296|Ga0157374_10050381|Ga0157374_100503813 |
| Length | 583 |
| Sequence | LATILQRWIKNIFKILLQIEKIDLTLCHVDAMKISYYQISVMKRNFFXXXLLTFTASVAMAQLNGEAPRVKIANGELEGVNESGIKTFKGVPFAAPPVDKFRWREPQPVQNWSGIRKADKFGPRAMQLPVFGDMNFRSDGMHEDCLYLNVWTPAKTGSEKLPVLVYFYGGGFMAGDGSELRYDGESMARKGIVAVTVNYRLGIFGFLSHPELTKESPHHASGNYGLLDQSAALQWVQKNIAAFGGDPKKITIAGESAGSFSVSAQMASPLSKNIIAGAIGESGSLLGLSPTASLKEAEKAGADFGTSIKANSLADLRAMPADQLLKATANAGFGRFPICTDGYFFPKSPLEIFEKGEQAHVPLLVGWNSQEMVYQMIMGQDKPTLDNYKKTVEKLYGDKSAEAMTVYSASNDEEAEQVATDLASDRFIGFSTWKWSDVQSKTGGKPVYRYLYARPRPQMRSEMGNARAGLAGGVIKDTSANKPPAMPPARGAVHSAEIEYALGNLSTNRVYDWQPEDYKVSEIMQALFANFIKTGNPNGLGVPEWPAVDSNKGVQVMHIDVDTKAIEDKNGKRYLFMDKTAKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 2 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 3 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 4 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 5 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 6 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 7 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 8 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 9 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 10 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 11 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 12 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 15 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 97 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 142 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 143 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 144 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 145 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 146 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 147 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 148 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 149 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 150 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 151 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 152 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 153 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 154 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 155 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 156 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 157 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 158 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 191 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 192 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 193 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 194 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 195 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 196 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 208 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 209 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 210 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.24 |
| Metatranscriptomes | 0 |
| Isolates | 3.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.09 |
| Nodule | 0 |
| Rhizoplane | 1.88 |
| Rhizosphere | 80.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10000178 | 3300001989 | Bacteria | 21194 |
| 2 | JGI25154J39366_1001504 | 3300002738 | Bacteria | 8152 |
| 3 | JGI25406J46586_10007419 | 3300003203 | Bacteria | 5004 |
| 4 | JGI25153J46596_10021137 | 3300003215 | Unclassified | 2434 |
| 5 | rootH2_10027304 | 3300003320 | Bacteria | 8765 |
| 6 | rootL2_10075322 | 3300003322 | Bacteria | 4037 |
| 7 | rootL2_10149750 | 3300003322 | Bacteria | 2115 |
| 8 | Ga0055529_1000341 | 3300003763 | Bacteria | 52197 |
| 9 | Ga0055526_1000018 | 3300003771 | Bacteria | 198838 |
| 10 | Ga0055526_1000029 | 3300003771 | Bacteria | 148855 |
| 11 | Ga0055526_1013471 | 3300003771 | Unclassified | 3455 |
| 12 | Ga0055528_1000120 | 3300003790 | Bacteria | 62209 |
| 13 | Ga0055530_10005694 | 3300003791 | Bacteria | 5818 |
| 14 | Ga0065165_1000012 | 3300005262 | Bacteria | 303241 |
| 15 | Ga0070658_10000141 | 3300005327 | Bacteria | 63684 |
| 16 | Ga0070658_10028955 | 3300005327 | Bacteria | 4447 |
| 17 | Ga0070658_10040376 | 3300005327 | Bacteria | 3764 |
| 18 | Ga0070683_100004444 | 3300005329 | Bacteria | 11560 |
| 19 | Ga0070683_100008516 | 3300005329 | Bacteria | 8715 |
| 20 | Ga0070683_100025263 | 3300005329 | Bacteria | 5332 |
| 21 | Ga0070690_100006555 | 3300005330 | Bacteria | 6608 |
| 22 | Ga0070670_100136812 | 3300005331 | Bacteria | 2117 |
| 23 | Ga0068869_100062532 | 3300005334 | Bacteria | 2733 |
| 24 | Ga0070682_100086110 | 3300005337 | Bacteria | 2045 |
| 25 | Ga0068868_100019468 | 3300005338 | Bacteria | 5086 |
| 26 | Ga0068868_100030524 | 3300005338 | Bacteria | 4133 |
| 27 | Ga0070660_100017541 | 3300005339 | Bacteria | 5219 |
| 28 | Ga0070689_100082846 | 3300005340 | Bacteria | 2520 |
| 29 | Ga0070687_100022800 | 3300005343 | Bacteria | 2966 |
| 30 | Ga0070661_100001488 | 3300005344 | Bacteria | 16275 |
| 31 | Ga0070669_100002314 | 3300005353 | Bacteria | 13789 |
| 32 | Ga0070669_100002875 | 3300005353 | Bacteria | 12417 |
| 33 | Ga0070669_100048901 | 3300005353 | Unclassified | 3087 |
| 34 | Ga0070675_100023993 | 3300005354 | Bacteria | 4882 |
| 35 | Ga0070675_100106036 | 3300005354 | Bacteria | 2372 |
| 36 | Ga0070671_100067848 | 3300005355 | Bacteria | 2974 |
| 37 | Ga0070674_100024364 | 3300005356 | Bacteria | 3926 |
| 38 | Ga0070673_100019982 | 3300005364 | Bacteria | 4821 |
| 39 | Ga0070688_100001493 | 3300005365 | Bacteria | 11653 |
| 40 | Ga0070688_100009230 | 3300005365 | Bacteria | 5384 |
| 41 | Ga0070659_100016040 | 3300005366 | Bacteria | 5620 |
| 42 | Ga0070659_100079802 | 3300005366 | Bacteria | 2612 |
| 43 | Ga0070667_100041213 | 3300005367 | Bacteria | 3873 |
| 44 | Ga0070667_100042279 | 3300005367 | Bacteria | 3824 |
| 45 | Ga0070667_100046547 | 3300005367 | Bacteria | 3649 |
| 46 | Ga0070709_10005617 | 3300005434 | Bacteria | 6790 |
| 47 | Ga0070714_100084609 | 3300005435 | Bacteria | 2768 |
| 48 | Ga0070711_100012818 | 3300005439 | Bacteria | 5250 |
| 49 | Ga0070663_100116346 | 3300005455 | Bacteria | 2015 |
| 50 | Ga0070678_100023069 | 3300005456 | Bacteria | 4139 |
| 51 | Ga0070662_100031643 | 3300005457 | Bacteria | 3714 |
| 52 | Ga0070685_10022188 | 3300005466 | Bacteria | 3457 |
| 53 | Ga0070685_10036660 | 3300005466 | Bacteria | 2773 |
| 54 | Ga0070685_10052206 | 3300005466 | Bacteria | 2365 |
| 55 | Ga0070707_100000707 | 3300005468 | Bacteria | 33278 |
| 56 | Ga0070707_100046786 | 3300005468 | Bacteria | 4140 |
| 57 | Ga0070699_100011793 | 3300005518 | Bacteria | 7542 |
| 58 | Ga0070699_100040637 | 3300005518 | Bacteria | 4026 |
| 59 | Ga0070679_100052552 | 3300005530 | Bacteria | 4057 |
| 60 | Ga0070684_100006173 | 3300005535 | Bacteria | 9242 |
| 61 | Ga0070684_100024079 | 3300005535 | Bacteria | 5103 |
| 62 | Ga0070684_100026830 | 3300005535 | Bacteria | 4856 |
| 63 | Ga0070684_100033154 | 3300005535 | Bacteria | 4407 |
| 64 | Ga0068853_100001327 | 3300005539 | Bacteria | 17802 |
| 65 | Ga0068855_100100253 | 3300005563 | Bacteria | 3335 |
| 66 | Ga0068855_100138913 | 3300005563 | Bacteria | 2771 |
| 67 | Ga0068855_100232961 | 3300005563 | Bacteria | 2061 |
| 68 | Ga0068855_100254880 | 3300005563 | Bacteria | 1956 |
| 69 | Ga0070664_100000360 | 3300005564 | Bacteria | 33570 |
| 70 | Ga0070664_100013638 | 3300005564 | Bacteria | 6623 |
| 71 | Ga0070664_100043242 | 3300005564 | Bacteria | 3801 |
| 72 | Ga0070664_100044452 | 3300005564 | Bacteria | 3750 |
| 73 | Ga0068857_100000323 | 3300005577 | Bacteria | 32881 |
| 74 | Ga0068857_100034671 | 3300005577 | Bacteria | 4464 |
| 75 | Ga0068854_100068328 | 3300005578 | Bacteria | 2591 |
| 76 | Ga0068856_100034937 | 3300005614 | Bacteria | 4925 |
| 77 | Ga0068856_100154296 | 3300005614 | Bacteria | 2306 |
| 78 | Ga0070702_100034378 | 3300005615 | Bacteria | 2794 |
| 79 | Ga0068852_100016477 | 3300005616 | Bacteria | 5765 |
| 80 | Ga0068859_100071304 | 3300005617 | Unclassified | 3510 |
| 81 | Ga0068859_100134350 | 3300005617 | Bacteria | 2546 |
| 82 | Ga0068864_100059330 | 3300005618 | Bacteria | 3310 |
| 83 | Ga0068858_100024468 | 3300005842 | Bacteria | 5625 |
| 84 | Ga0081455_10003135 | 3300005937 | Bacteria | 19234 |
| 85 | Ga0081455_10065435 | 3300005937 | Bacteria | 3040 |
| 86 | Ga0081539_10000402 | 3300005985 | Bacteria | 92866 |
| 87 | Ga0081539_10003510 | 3300005985 | Bacteria | 19129 |
| 88 | Ga0081539_10006618 | 3300005985 | Bacteria | 11000 |
| 89 | Ga0070717_10007552 | 3300006028 | Bacteria | 8079 |
| 90 | Ga0097621_100023199 | 3300006237 | Bacteria | 4826 |
| 91 | Ga0068871_100037784 | 3300006358 | Unclassified | 3853 |
| 92 | Ga0068871_100097392 | 3300006358 | Bacteria | 2459 |
| 93 | Ga0075428_100112125 | 3300006844 | Bacteria | 2970 |
| 94 | Ga0075431_100073912 | 3300006847 | Bacteria | 3517 |
| 95 | Ga0075431_100081436 | 3300006847 | Bacteria | 3342 |
| 96 | Ga0068865_100042019 | 3300006881 | Bacteria | 3115 |
| 97 | Ga0097620_100071311 | 3300006931 | Unclassified | 3510 |
| 98 | Ga0097620_100134350 | 3300006931 | Bacteria | 2546 |
| 99 | Ga0105244_10011767 | 3300009036 | Bacteria | 5220 |
| 100 | Ga0105240_10000063 | 3300009093 | Bacteria | 215936 |
| 101 | Ga0105240_10000071 | 3300009093 | Bacteria | 204197 |
| 102 | Ga0111539_10011987 | 3300009094 | Bacteria | 10872 |
| 103 | Ga0105241_10036766 | 3300009174 | Bacteria | 3686 |
| 104 | Ga0105242_10047546 | 3300009176 | Bacteria | 3484 |
| 105 | Ga0105249_10157898 | 3300009553 | Bacteria | 2189 |
| 106 | Ga0105249_10215910 | 3300009553 | Bacteria | 1885 |
| 107 | Ga0105239_10000079 | 3300010375 | Bacteria | 135513 |
| 108 | Ga0105239_10002585 | 3300010375 | Bacteria | 22929 |
| 109 | Ga0105239_10014535 | 3300010375 | Bacteria | 8734 |
| 110 | Ga0105246_10086121 | 3300011119 | Bacteria | 2252 |
| 111 | Ga0157373_10023916 | 3300013100 | Bacteria | 4427 |
| 112 | Ga0157371_10000494 | 3300013102 | Bacteria | 47840 |
| 113 | Ga0157371_10016138 | 3300013102 | Bacteria | 5583 |
| 114 | Ga0157371_10025020 | 3300013102 | Bacteria | 4356 |
| 115 | Ga0157370_10015111 | 3300013104 | Bacteria | 7865 |
| 116 | Ga0157369_10128118 | 3300013105 | Bacteria | 2690 |
| 117 | Ga0157369_10308399 | 3300013105 | Unclassified | 1646 |
| 118 | Ga0157374_10000003 | 3300013296 | Bacteria | 854471 |
| 119 | Ga0157374_10012676 | 3300013296 | Bacteria | 7341 |
| 120 | Ga0157374_10019255 | 3300013296 | Bacteria | 6038 |
| 121 | Ga0157374_10023675 | 3300013296 | Bacteria | 5496 |
| 122 | Ga0157374_10050381 | 3300013296 | Bacteria | 3870 |
| 123 | Ga0157374_10077315 | 3300013296 | Bacteria | 3149 |
| 124 | Ga0157374_10113390 | 3300013296 | Bacteria | 2609 |
| 125 | Ga0157378_10003948 | 3300013297 | Bacteria | 13102 |
| 126 | Ga0163162_10014163 | 3300013306 | Bacteria | 7792 |
| 127 | Ga0163162_10021128 | 3300013306 | Bacteria | 6403 |
| 128 | Ga0163162_10022082 | 3300013306 | Bacteria | 6271 |
| 129 | Ga0163162_10204514 | 3300013306 | Bacteria | 2104 |
| 130 | Ga0157372_10000813 | 3300013307 | Bacteria | 33849 |
| 131 | Ga0157372_10014011 | 3300013307 | Bacteria | 8566 |
| 132 | Ga0157372_10254539 | 3300013307 | Bacteria | 2038 |
| 133 | Ga0163163_10002119 | 3300014325 | Bacteria | 16744 |
| 134 | Ga0163163_10068552 | 3300014325 | Bacteria | 3530 |
| 135 | Ga0157377_10041368 | 3300014745 | Bacteria | 2557 |
| 136 | Ga0157376_10003534 | 3300014969 | Bacteria | 10778 |
| 137 | Ga0157376_10035449 | 3300014969 | Bacteria | 4036 |
| 138 | Ga0182006_1000017 | 3300015261 | Bacteria | 299454 |
| 139 | Ga0182005_1000051 | 3300015265 | Bacteria | 114808 |
| 140 | Ga0163161_10018156 | 3300017792 | Bacteria | 4931 |
| 141 | Ga0213876_10021694 | 3300021384 | Bacteria | 3397 |
| 142 | Ga0207425_1000211 | 3300025245 | Bacteria | 46314 |
| 143 | Ga0209455_1000037 | 3300025272 | Bacteria | 464097 |
| 144 | Ga0209673_1000016 | 3300025273 | Bacteria | 506202 |
| 145 | Ga0209673_1000111 | 3300025273 | Bacteria | 180094 |
| 146 | Ga0209673_1023425 | 3300025273 | Unclassified | 2103 |
| 147 | Ga0209025_1001605 | 3300025294 | Bacteria | 28394 |
| 148 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 149 | Ga0209564_1000068 | 3300025295 | Bacteria | 311171 |
| 150 | Ga0209564_1001661 | 3300025295 | Bacteria | 21364 |
| 151 | Ga0209564_1001737 | 3300025295 | Bacteria | 20427 |
| 152 | Ga0209758_1001186 | 3300025297 | Bacteria | 32950 |
| 153 | Ga0209758_1001215 | 3300025297 | Bacteria | 32372 |
| 154 | Ga0209758_1002513 | 3300025297 | Bacteria | 18609 |
| 155 | Ga0209050_1002034 | 3300025298 | Bacteria | 18714 |
| 156 | Ga0207426_1000002 | 3300025302 | Bacteria | 1249660 |
| 157 | Ga0207426_1003728 | 3300025302 | Bacteria | 7960 |
| 158 | Ga0209257_1002577 | 3300025304 | Bacteria | 17636 |
| 159 | Ga0207656_10027317 | 3300025321 | Bacteria | 2334 |
| 160 | Ga0207688_10029475 | 3300025901 | Bacteria | 3022 |
| 161 | Ga0207645_10046883 | 3300025907 | Bacteria | 2760 |
| 162 | Ga0207705_10000587 | 3300025909 | Bacteria | 30561 |
| 163 | Ga0207684_10025510 | 3300025910 | Bacteria | 5037 |
| 164 | Ga0207707_10011799 | 3300025912 | Bacteria | 7602 |
| 165 | Ga0207695_10000068 | 3300025913 | Bacteria | 324859 |
| 166 | Ga0207695_10000133 | 3300025913 | Bacteria | 222573 |
| 167 | Ga0207695_10043676 | 3300025913 | Bacteria | 4776 |
| 168 | Ga0207662_10041746 | 3300025918 | Unclassified | 2702 |
| 169 | Ga0207657_10018767 | 3300025919 | Bacteria | 6588 |
| 170 | Ga0207649_10002021 | 3300025920 | Bacteria | 11533 |
| 171 | Ga0207646_10000236 | 3300025922 | Bacteria | 76096 |
| 172 | Ga0207646_10002883 | 3300025922 | Bacteria | 19953 |
| 173 | Ga0207646_10005925 | 3300025922 | Bacteria | 12752 |
| 174 | Ga0207659_10038203 | 3300025926 | Bacteria | 3337 |
| 175 | Ga0207664_10011556 | 3300025929 | Bacteria | 6284 |
| 176 | Ga0207644_10034280 | 3300025931 | Unclassified | 3551 |
| 177 | Ga0207644_10035825 | 3300025931 | Unclassified | 3480 |
| 178 | Ga0207690_10019573 | 3300025932 | Bacteria | 4171 |
| 179 | Ga0207706_10006646 | 3300025933 | Bacteria | 10694 |
| 180 | Ga0207706_10008847 | 3300025933 | Bacteria | 9267 |
| 181 | Ga0207706_10048996 | 3300025933 | Unclassified | 3734 |
| 182 | Ga0207691_10003797 | 3300025940 | Bacteria | 14662 |
| 183 | Ga0207691_10041834 | 3300025940 | Bacteria | 4227 |
| 184 | Ga0207691_10070927 | 3300025940 | Unclassified | 3146 |
| 185 | Ga0207711_10141328 | 3300025941 | Bacteria | 2166 |
| 186 | Ga0207689_10005900 | 3300025942 | Bacteria | 10850 |
| 187 | Ga0207689_10013446 | 3300025942 | Bacteria | 6989 |
| 188 | Ga0207689_10021414 | 3300025942 | Bacteria | 5436 |
| 189 | Ga0207661_10060786 | 3300025944 | Bacteria | 3050 |
| 190 | Ga0207661_10084554 | 3300025944 | Bacteria | 2628 |
| 191 | Ga0207679_10000575 | 3300025945 | Bacteria | 24610 |
| 192 | Ga0207679_10010610 | 3300025945 | Bacteria | 5936 |
| 193 | Ga0207679_10027386 | 3300025945 | Bacteria | 3941 |
| 194 | Ga0207679_10155558 | 3300025945 | Bacteria | 1866 |
| 195 | Ga0207667_10026274 | 3300025949 | Bacteria | 6363 |
| 196 | Ga0207667_10082545 | 3300025949 | Bacteria | 3329 |
| 197 | Ga0207668_10045217 | 3300025972 | Bacteria | 3001 |
| 198 | Ga0207658_10078656 | 3300025986 | Bacteria | 2521 |
| 199 | Ga0207658_10162251 | 3300025986 | Bacteria | 1833 |
| 200 | Ga0207677_10011712 | 3300026023 | Bacteria | 5009 |
| 201 | Ga0207703_10030917 | 3300026035 | Bacteria | 4233 |
| 202 | Ga0207639_10004446 | 3300026041 | Bacteria | 9460 |
| 203 | Ga0207702_10104818 | 3300026078 | Unclassified | 2503 |
| 204 | Ga0207702_10181152 | 3300026078 | Bacteria | 1940 |
| 205 | Ga0207648_10019561 | 3300026089 | Bacteria | 6111 |
| 206 | Ga0207676_10032739 | 3300026095 | Bacteria | 3921 |
| 207 | Ga0207674_10001817 | 3300026116 | Bacteria | 27232 |
| 208 | Ga0207683_10015716 | 3300026121 | Bacteria | 6441 |
| 209 | Ga0207698_10011192 | 3300026142 | Bacteria | 5805 |
| 210 | Ga0207428_10006847 | 3300027907 | Bacteria | 10451 |
| 211 | Ga0268264_10076562 | 3300028381 | Bacteria | 2847 |
| 212 | Ga0307515_10000057 | 3300028794 | Bacteria | 261695 |
| 213 | Ga0316177_1161913 | 3300030731 | Bacteria | 4431 |
| 214 | Ga0316183_1004801 | 3300030742 | Bacteria | 53681 |
| 215 | Ga0316181_1138860 | 3300030744 | Bacteria | 58548 |
| 216 | Ga0316181_1293286 | 3300030744 | Unclassified | 1977 |
| 217 | Ga0373955_0070096 | 3300035172 | Bacteria | 1958 |
| 218 | Ga0316584_0041441 | 3300036712 | Bacteria | 3432 |
| 219 | Ga0395899_0000145 | 3300037312 | Bacteria | 107297 |
| 220 | Ga0395899_0000264 | 3300037312 | Bacteria | 68569 |
| 221 | Ga0395905_0011974 | 3300037471 | Bacteria | 8363 |
| 222 | Ga0436365_0109276 | 3300039437 | Bacteria | 2070 |
| 223 | Ga0436365_0342852 | 3300039437 | Bacteria | 4062 |
| 224 | Ga0436365_1533409 | 3300039437 | Bacteria | 3883 |
| 225 | Ga0436363_0161216 | 3300039450 | Bacteria | 7738 |
| 226 | Ga0451577_0212610 | 3300042876 | Bacteria | 1747 |
| 227 | Ga0466972_0000004 | 3300044658 | Bacteria | 314413 |
| 228 | Ga0466961_0037754 | 3300044693 | Bacteria | 3099 |
| 229 | Ga0453684_0065346 | 3300044712 | Bacteria | 4640 |
| 230 | Ga0466970_0000038 | 3300044765 | Bacteria | 47830 |
| 231 | Ga0466959_0005499 | 3300045049 | Bacteria | 8687 |
| 232 | Ga0451576_0045795 | 3300045051 | Bacteria | 4605 |
| 233 | Ga0495617_000003 | 3300046452 | Bacteria | 541914 |
| 234 | Ga0495638_0013474 | 3300046460 | Bacteria | 5566 |
| 235 | Ga0495653_0000002 | 3300046463 | Bacteria | 507262 |
| 236 | Ga0495650_0000072 | 3300046471 | Bacteria | 257886 |
| 237 | Ga0495650_0000267 | 3300046471 | Bacteria | 100234 |
| 238 | Ga0495650_0001047 | 3300046471 | Bacteria | 30813 |
| 239 | Ga0495650_0005469 | 3300046471 | Bacteria | 8238 |
| 240 | Ga0495580_0061062 | 3300046472 | Bacteria | 2647 |
| 241 | Ga0495605_0000068 | 3300046474 | Bacteria | 137743 |
| 242 | Ga0495585_0002789 | 3300046492 | Bacteria | 12177 |
| 243 | Ga0495607_0002200 | 3300046501 | Bacteria | 16172 |
| 244 | Ga0495606_0000001 | 3300046507 | Bacteria | 592123 |
| 245 | Ga0495606_0000030 | 3300046507 | Bacteria | 249484 |
| 246 | Ga0495606_0000220 | 3300046507 | Bacteria | 101211 |
| 247 | Ga0495606_0002860 | 3300046507 | Bacteria | 19101 |
| 248 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 249 | Ga0495610_0004339 | 3300046512 | Bacteria | 10528 |
| 250 | Ga0495610_0008145 | 3300046512 | Bacteria | 6844 |
| 251 | Ga0495628_0090629 | 3300046516 | Bacteria | 2367 |
| 252 | Ga0495637_0000937 | 3300046520 | Bacteria | 18653 |
| 253 | Ga0495643_0000028 | 3300046522 | Bacteria | 262886 |
| 254 | Ga0495648_0016248 | 3300046524 | Bacteria | 5369 |
| 255 | Ga0495648_0039269 | 3300046524 | Bacteria | 3013 |
| 256 | Ga0495648_0045996 | 3300046524 | Bacteria | 2709 |
| 257 | Ga0495654_0000037 | 3300046530 | Bacteria | 188218 |
| 258 | Ga0495654_0014672 | 3300046530 | Bacteria | 4166 |
| 259 | Ga0495609_0027989 | 3300046538 | Bacteria | 2574 |
| 260 | Ga0495597_0000072 | 3300046542 | Bacteria | 87914 |
| 261 | Ga0495597_0008659 | 3300046542 | Bacteria | 5086 |
| 262 | Ga0495622_0000361 | 3300046557 | Bacteria | 32027 |
| 263 | Ga0495633_0002540 | 3300046558 | Bacteria | 12804 |
| 264 | Ga0495633_0020713 | 3300046558 | Bacteria | 3302 |
| 265 | Ga0495668_0000452 | 3300046616 | Bacteria | 52507 |
| 266 | Ga0495668_0000512 | 3300046616 | Bacteria | 48355 |
| 267 | Ga0495668_0002400 | 3300046616 | Bacteria | 15521 |
| 268 | Ga0495625_0000697 | 3300046660 | Bacteria | 47751 |
| 269 | Ga0495625_0062361 | 3300046660 | Bacteria | 2635 |
| 270 | Ga0495623_0028301 | 3300046679 | Bacteria | 3605 |
| 271 | Ga0495671_0000010 | 3300046692 | Bacteria | 368641 |
| 272 | Ga0495649_0008244 | 3300046694 | Bacteria | 6277 |
| 273 | Ga0495600_0159567 | 3300046809 | Bacteria | 1458 |
| 274 | Ga0495660_0003687 | 3300046810 | Bacteria | 9421 |
| 275 | Ga0495672_0000212 | 3300047320 | Bacteria | 83026 |
| 276 | Ga0495679_019713 | 3300047446 | Bacteria | 2362 |
| 277 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 278 | Ga0495673_0000016 | 3300047469 | Bacteria | 580643 |
| 279 | Ga0495686_0017218 | 3300047472 | Bacteria | 4874 |
| 280 | Ga0495602_0177919 | 3300048088 | Bacteria | 1644 |
| 281 | Ga0496109_0000457 | 3300048912 | Bacteria | 35038 |
| 282 | Ga0496109_0004084 | 3300048912 | Bacteria | 12202 |
| 283 | Ga0496109_0093959 | 3300048912 | Bacteria | 2776 |
| 284 | Ga0496110_0031861 | 3300048913 | Bacteria | 4551 |
| 285 | Ga0496112_0224045 | 3300048915 | Bacteria | 1836 |
| 286 | Ga0496113_0100662 | 3300048916 | Bacteria | 2239 |
| 287 | Ga0496122_0043946 | 3300048925 | Bacteria | 3494 |
| 288 | Ga0496122_0086675 | 3300048925 | Bacteria | 2154 |
| 289 | Ga0496123_0005534 | 3300048926 | Bacteria | 12680 |
| 290 | Ga0496124_0037156 | 3300048927 | Bacteria | 4239 |
| 291 | Ga0495678_000029 | 3300049459 | Bacteria | 219803 |
| 292 | Ga0501032_0085910 | 3300049569 | Unclassified | 2091 |
| 293 | Ga0501037_0028748 | 3300049573 | Bacteria | 4107 |
| 294 | Ga0501038_0020879 | 3300049574 | Bacteria | 5886 |
| 295 | Ga0501043_0006481 | 3300049579 | Bacteria | 9399 |
| 296 | Ga0501047_0098968 | 3300049581 | Bacteria | 2795 |
| 297 | nmdc:mga05p37_33458_c1 | 3300050507 | Bacteria | 6295 |
| 298 | nmdc:mga06r32_96326_c1 | 3300050510 | Bacteria | 2898 |
| 299 | nmdc:mga08y16_2563_c1 | 3300050511 | Bacteria | 18689 |
| 300 | nmdc:mga08y16_4054_c1 | 3300050511 | Bacteria | 15288 |
| 301 | nmdc:mga0n895_98218_c1 | 3300050512 | Bacteria | 2935 |
| 302 | nmdc:mga0a205_139939_c1 | 3300050515 | Bacteria | 2320 |
| 303 | Ga0500641_0018378 | 3300053096 | Bacteria | 2629 |
| 304 | Ga0500618_000297 | 3300053125 | Bacteria | 37721 |
| 305 | Ga0500586_000014 | 3300053145 | Bacteria | 37183 |
| 306 | Ga0500586_002900 | 3300053145 | Bacteria | 3965 |
| 307 | Ga0466962_0018189 | 3300061719 | Bacteria | 3381 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046809 | Ga0495600_0159567 | Ga0495600_0159567_111_1445 | 420 |
| 2 | 3300048915 | Ga0496112_0224045 | Ga0496112_0224045_24_1346 | 438 |
| 3 | 3300048088 | Ga0495602_0177919 | Ga0495602_0177919_249_1625 | 451 |
| 4 | 3300046507 | Ga0495606_0000001 | Ga0495606_0000001_210131_211666 | 454 |
| 5 | 3300046512 | Ga0495610_0008145 | Ga0495610_0008145_81_1616 | 454 |
| 6 | 3300046558 | Ga0495633_0020713 | Ga0495633_0020713_1605_3140 | 454 |
| 7 | 3300046616 | Ga0495668_0000452 | Ga0495668_0000452_27997_29532 | 454 |
| 8 | 3300047472 | Ga0495686_0017218 | Ga0495686_0017218_695_2230 | 454 |
| 9 | 3300049581 | Ga0501047_0098968 | Ga0501047_0098968_1398_2768 | 456 |
| 10 | 3300046660 | Ga0495625_0000697 | Ga0495625_0000697_43910_45454 | 457 |
| 11 | 3300013105 | Ga0157369_10308399 | Ga0157369_103083992 | 460 |
| 12 | 3300009094 | Ga0111539_10011987 | Ga0111539_100119875 | 463 |
| 13 | 3300027907 | Ga0207428_10006847 | Ga0207428_100068473 | 463 |
| 14 | 3300046460 | Ga0495638_0013474 | Ga0495638_0013474_3184_4728 | 463 |
| 15 | 3300050511 | nmdc:mga08y16_4054_c1 | nmdc:mga08y16_4054_c1_4068_5624 | 463 |
| 16 | 3300003322 | rootL2_10075322 | rootL2_100753223 | 464 |
| 17 | 3300046471 | Ga0495650_0000072 | Ga0495650_0000072_68441_69973 | 465 |
| 18 | 3300046616 | Ga0495668_0002400 | Ga0495668_0002400_610_2142 | 465 |
| 19 | 3300046512 | Ga0495610_0004339 | Ga0495610_0004339_8345_9886 | 470 |
| 20 | 3300025245 | Ga0207425_1000211 | Ga0207425_100021117 | 472 |
| 21 | 3300025294 | Ga0209025_1001605 | Ga0209025_10016057 | 472 |
| 22 | 3300025297 | Ga0209758_1001186 | Ga0209758_10011865 | 472 |
| 23 | 3300005617 | Ga0068859_100134350 | Ga0068859_1001343501 | 475 |
| 24 | 3300006931 | Ga0097620_100134350 | Ga0097620_1001343501 | 475 |
| 25 | 3300048925 | Ga0496122_0043946 | Ga0496122_0043946_1182_2693 | 478 |
| 26 | 3300048926 | Ga0496123_0005534 | Ga0496123_0005534_572_2083 | 478 |
| 27 | 3300013296 | Ga0157374_10000003 | Ga0157374_10000003667 | 480 |
| 28 | 3300046471 | Ga0495650_0001047 | Ga0495650_0001047_27809_29353 | 480 |
| 29 | 3300003322 | rootL2_10149750 | rootL2_101497502 | 482 |
| 30 | 3300003763 | Ga0055529_1000341 | Ga0055529_100034128 | 482 |
| 31 | 3300025272 | Ga0209455_1000037 | Ga0209455_1000037421 | 482 |
| 32 | 3300046507 | Ga0495606_0000220 | Ga0495606_0000220_32870_34498 | 482 |
| 33 | 3300046520 | Ga0495637_0000937 | Ga0495637_0000937_13833_15359 | 483 |
| 34 | 3300046530 | Ga0495654_0000037 | Ga0495654_0000037_7841_9367 | 483 |
| 35 | 3300046522 | Ga0495643_0000028 | Ga0495643_0000028_194047_195567 | 484 |
| 36 | 3300046524 | Ga0495648_0016248 | Ga0495648_0016248_2537_4057 | 484 |
| 37 | 3300046542 | Ga0495597_0000072 | Ga0495597_0000072_69579_71096 | 484 |
| 38 | 3300046660 | Ga0495625_0062361 | Ga0495625_0062361_536_2056 | 484 |
| 39 | 3300047320 | Ga0495672_0000212 | Ga0495672_0000212_45429_46949 | 484 |
| 40 | 3300047446 | Ga0495679_019713 | Ga0495679_019713_107_1627 | 484 |
| 41 | 3300049459 | Ga0495678_000029 | Ga0495678_000029_41402_42922 | 484 |
| 42 | 3300005340 | Ga0070689_100082846 | Ga0070689_1000828462 | 485 |
| 43 | 3300005353 | Ga0070669_100002314 | Ga0070669_10000231410 | 485 |
| 44 | 3300005365 | Ga0070688_100009230 | Ga0070688_1000092303 | 485 |
| 45 | 3300005367 | Ga0070667_100041213 | Ga0070667_1000412132 | 485 |
| 46 | 3300005466 | Ga0070685_10036660 | Ga0070685_100366602 | 485 |
| 47 | 3300005466 | Ga0070685_10052206 | Ga0070685_100522061 | 485 |
| 48 | 3300011119 | Ga0105246_10086121 | Ga0105246_100861212 | 485 |
| 49 | 3300025940 | Ga0207691_10041834 | Ga0207691_100418342 | 485 |
| 50 | 3300046524 | Ga0495648_0045996 | Ga0495648_0045996_212_1723 | 485 |
| 51 | 3300046557 | Ga0495622_0000361 | Ga0495622_0000361_14788_16377 | 485 |
| 52 | 3300053125 | Ga0500618_000297 | Ga0500618_000297_20834_22363 | 485 |
| 53 | 3300003771 | Ga0055526_1000018 | Ga0055526_100001886 | 486 |
| 54 | 3300025295 | Ga0209564_1000068 | Ga0209564_1000068192 | 486 |
| 55 | 3300046507 | Ga0495606_0000030 | Ga0495606_0000030_142033_143544 | 486 |
| 56 | 3300046692 | Ga0495671_0000010 | Ga0495671_0000010_119833_121353 | 487 |
| 57 | 3300010375 | Ga0105239_10014535 | Ga0105239_100145353 | 488 |
| 58 | 3300025907 | Ga0207645_10046883 | Ga0207645_100468832 | 489 |
| 59 | 3300046512 | Ga0495610_0000003 | Ga0495610_0000003_863703_865223 | 489 |
| 60 | 3300046558 | Ga0495633_0002540 | Ga0495633_0002540_7231_8754 | 489 |
| 61 | 3300053145 | Ga0500586_000014 | Ga0500586_000014_11440_12963 | 489 |
| 62 | 3300046471 | Ga0495650_0005469 | Ga0495650_0005469_4629_6155 | 490 |
| 63 | 3300005434 | Ga0070709_10005617 | Ga0070709_100056173 | 491 |
| 64 | 3300005439 | Ga0070711_100012818 | Ga0070711_1000128182 | 491 |
| 65 | 3300003320 | rootH2_10027304 | rootH2_100273044 | 492 |
| 66 | 3300005435 | Ga0070714_100084609 | Ga0070714_1000846092 | 492 |
| 67 | 3300005563 | Ga0068855_100232961 | Ga0068855_1002329612 | 492 |
| 68 | 3300005614 | Ga0068856_100154296 | Ga0068856_1001542962 | 492 |
| 69 | 3300015261 | Ga0182006_1000017 | Ga0182006_100001740 | 492 |
| 70 | 3300025929 | Ga0207664_10011556 | Ga0207664_100115563 | 492 |
| 71 | 3300025949 | Ga0207667_10082545 | Ga0207667_100825452 | 492 |
| 72 | 3300026078 | Ga0207702_10181152 | Ga0207702_101811522 | 492 |
| 73 | 3300021384 | Ga0213876_10021694 | Ga0213876_100216942 | 498 |
| 74 | 3300039437 | Ga0436365_0342852 | Ga0436365_0342852_995_2632 | 498 |
| 75 | iso_pu_bacteria | 2857564685 | 2857567011 | 498 |
| 76 | 3300046452 | Ga0495617_000003 | Ga0495617_000003_177277_178788 | 499 |
| 77 | 3300046463 | Ga0495653_0000002 | Ga0495653_0000002_361099_362610 | 499 |
| 78 | 3300046471 | Ga0495650_0000267 | Ga0495650_0000267_91722_93233 | 499 |
| 79 | 3300046492 | Ga0495585_0002789 | Ga0495585_0002789_10129_11640 | 499 |
| 80 | 3300046524 | Ga0495648_0039269 | Ga0495648_0039269_212_1723 | 499 |
| 81 | 3300046530 | Ga0495654_0014672 | Ga0495654_0014672_473_1984 | 499 |
| 82 | 3300046616 | Ga0495668_0000512 | Ga0495668_0000512_12667_14178 | 499 |
| 83 | 3300046810 | Ga0495660_0003687 | Ga0495660_0003687_2802_4313 | 499 |
| 84 | 3300047469 | Ga0495673_0000003 | Ga0495673_0000003_1040382_1041893 | 499 |
| 85 | 3300047469 | Ga0495673_0000016 | Ga0495673_0000016_330226_331737 | 499 |
| 86 | 3300048925 | Ga0496122_0086675 | Ga0496122_0086675_308_1819 | 499 |
| 87 | 3300048927 | Ga0496124_0037156 | Ga0496124_0037156_177_1694 | 499 |
| 88 | 3300053145 | Ga0500586_002900 | Ga0500586_002900_174_1685 | 499 |
| 89 | iso_pu_bacteria | 2738541297 | 2738829811 | 499 |
| 90 | iso_pu_bacteria | 2738541357 | 2739153607 | 499 |
| 91 | iso_pu_bacteria | 2738543003 | 2739195527 | 499 |
| 92 | iso_pu_bacteria | 2738543026 | 2739322003 | 499 |
| 93 | iso_pu_bacteria | 2738543029 | 2739340244 | 499 |
| 94 | iso_pu_bacteria | 2821131069 | 2821131770 | 499 |
| 95 | 3300002738 | JGI25154J39366_1001504 | JGI25154J39366_10015042 | 500 |
| 96 | 3300037312 | Ga0395899_0000145 | Ga0395899_0000145_45199_46770 | 500 |
| 97 | 3300046474 | Ga0495605_0000068 | Ga0495605_0000068_30421_31935 | 500 |
| 98 | 3300005356 | Ga0070674_100024364 | Ga0070674_1000243643 | 501 |
| 99 | 3300037312 | Ga0395899_0000264 | Ga0395899_0000264_65493_67013 | 501 |
| 100 | 3300003771 | Ga0055526_1000029 | Ga0055526_1000029114 | 502 |
| 101 | 3300009036 | Ga0105244_10011767 | Ga0105244_100117672 | 502 |
| 102 | 3300025295 | Ga0209564_1000009 | Ga0209564_100000919 | 502 |
| 103 | 3300046507 | Ga0495606_0002860 | Ga0495606_0002860_1914_3437 | 503 |
| 104 | 3300046694 | Ga0495649_0008244 | Ga0495649_0008244_4317_5846 | 503 |
| 105 | iso_pu_bacteria | 2842711865 | 2842715433 | 503 |
| 106 | iso_pu_bacteria | 2857558681 | 2857559208 | 503 |
| 107 | 3300046538 | Ga0495609_0027989 | Ga0495609_0027989_725_2284 | 504 |
| 108 | 3300046542 | Ga0495597_0008659 | Ga0495597_0008659_907_2466 | 504 |
| 109 | 3300013104 | Ga0157370_10015111 | Ga0157370_100151115 | 506 |
| 110 | 3300046501 | Ga0495607_0002200 | Ga0495607_0002200_3960_5588 | 506 |
| 111 | 3300005353 | Ga0070669_100002875 | Ga0070669_1000028753 | 507 |
| 112 | 3300005327 | Ga0070658_10000141 | Ga0070658_1000014112 | 508 |
| 113 | 3300025909 | Ga0207705_10000587 | Ga0207705_1000058723 | 508 |
| 114 | 3300025913 | Ga0207695_10043676 | Ga0207695_100436765 | 508 |
| 115 | 3300005563 | Ga0068855_100100253 | Ga0068855_1001002532 | 510 |
| 116 | 3300010375 | Ga0105239_10000079 | Ga0105239_100000797 | 510 |
| 117 | 3300013307 | Ga0157372_10000813 | Ga0157372_1000081315 | 510 |
| 118 | 3300025949 | Ga0207667_10026274 | Ga0207667_100262745 | 510 |
| 119 | 3300044693 | Ga0466961_0037754 | Ga0466961_0037754_345_2009 | 510 |
| 120 | 3300045049 | Ga0466959_0005499 | Ga0466959_0005499_3027_4691 | 510 |
| 121 | 3300048912 | Ga0496109_0093959 | Ga0496109_0093959_723_2276 | 510 |
| 122 | 3300061719 | Ga0466962_0018189 | Ga0466962_0018189_1220_2884 | 510 |
| 123 | 3300009093 | Ga0105240_10000063 | Ga0105240_1000006377 | 511 |
| 124 | 3300009093 | Ga0105240_10000071 | Ga0105240_1000007182 | 511 |
| 125 | 3300010375 | Ga0105239_10002585 | Ga0105239_1000258513 | 511 |
| 126 | 3300015265 | Ga0182005_1000051 | Ga0182005_100005174 | 511 |
| 127 | 3300025913 | Ga0207695_10000068 | Ga0207695_1000006865 | 511 |
| 128 | 3300025913 | Ga0207695_10000133 | Ga0207695_1000013381 | 511 |
| 129 | 3300036712 | Ga0316584_0041441 | Ga0316584_0041441_1029_2594 | 511 |
| 130 | 3300045051 | Ga0451576_0045795 | Ga0451576_0045795_1393_2964 | 511 |
| 131 | 3300046472 | Ga0495580_0061062 | Ga0495580_0061062_534_2117 | 511 |
| 132 | iso_pu_bacteria | 2919476304 | 2919478297 | 511 |
| 133 | 3300009553 | Ga0105249_10157898 | Ga0105249_101578982 | 512 |
| 134 | 3300039437 | Ga0436365_0109276 | Ga0436365_0109276_254_1852 | 513 |
| 135 | 3300039450 | Ga0436363_0161216 | Ga0436363_0161216_1429_3027 | 513 |
| 136 | 3300005337 | Ga0070682_100086110 | Ga0070682_1000861102 | 514 |
| 137 | 3300005530 | Ga0070679_100052552 | Ga0070679_1000525527 | 514 |
| 138 | 3300005563 | Ga0068855_100138913 | Ga0068855_1001389132 | 514 |
| 139 | 3300025912 | Ga0207707_10011799 | Ga0207707_100117997 | 514 |
| 140 | 3300005353 | Ga0070669_100048901 | Ga0070669_1000489011 | 517 |
| 141 | 3300005616 | Ga0068852_100016477 | Ga0068852_1000164773 | 517 |
| 142 | 3300025918 | Ga0207662_10041746 | Ga0207662_100417461 | 517 |
| 143 | 3300025940 | Ga0207691_10003797 | Ga0207691_100037972 | 517 |
| 144 | 3300025942 | Ga0207689_10005900 | Ga0207689_100059003 | 517 |
| 145 | 3300026142 | Ga0207698_10011192 | Ga0207698_100111923 | 517 |
| 146 | 3300037471 | Ga0395905_0011974 | Ga0395905_0011974_4143_5885 | 517 |
| 147 | 3300005327 | Ga0070658_10040376 | Ga0070658_100403761 | 518 |
| 148 | 3300005468 | Ga0070707_100046786 | Ga0070707_1000467863 | 518 |
| 149 | 3300005518 | Ga0070699_100011793 | Ga0070699_1000117937 | 518 |
| 150 | 3300005535 | Ga0070684_100026830 | Ga0070684_1000268303 | 518 |
| 151 | 3300005564 | Ga0070664_100044452 | Ga0070664_1000444522 | 518 |
| 152 | 3300005577 | Ga0068857_100034671 | Ga0068857_1000346712 | 518 |
| 153 | 3300005618 | Ga0068864_100059330 | Ga0068864_1000593302 | 518 |
| 154 | 3300006028 | Ga0070717_10007552 | Ga0070717_1000755210 | 518 |
| 155 | 3300014325 | Ga0163163_10068552 | Ga0163163_100685522 | 518 |
| 156 | 3300025910 | Ga0207684_10025510 | Ga0207684_100255103 | 518 |
| 157 | 3300025922 | Ga0207646_10002883 | Ga0207646_1000288312 | 518 |
| 158 | 3300025922 | Ga0207646_10005925 | Ga0207646_1000592510 | 518 |
| 159 | 3300025945 | Ga0207679_10027386 | Ga0207679_100273862 | 518 |
| 160 | 3300026095 | Ga0207676_10032739 | Ga0207676_100327392 | 518 |
| 161 | 3300048916 | Ga0496113_0100662 | Ga0496113_0100662_179_1792 | 518 |
| 162 | 3300048912 | Ga0496109_0004084 | Ga0496109_0004084_7684_9312 | 520 |
| 163 | 3300044765 | Ga0466970_0000038 | Ga0466970_0000038_40669_42294 | 522 |
| 164 | 3300006844 | Ga0075428_100112125 | Ga0075428_1001121252 | 523 |
| 165 | 3300050507 | nmdc:mga05p37_33458_c1 | nmdc:mga05p37_33458_c1_2714_4300 | 523 |
| 166 | 3300005367 | Ga0070667_100042279 | Ga0070667_1000422793 | 524 |
| 167 | 3300017792 | Ga0163161_10018156 | Ga0163161_100181564 | 524 |
| 168 | 3300026121 | Ga0207683_10015716 | Ga0207683_100157164 | 524 |
| 169 | 3300013102 | Ga0157371_10025020 | Ga0157371_100250204 | 525 |
| 170 | 3300013307 | Ga0157372_10014011 | Ga0157372_100140116 | 525 |
| 171 | 3300050511 | nmdc:mga08y16_2563_c1 | nmdc:mga08y16_2563_c1_9898_11493 | 526 |
| 172 | 3300050515 | nmdc:mga0a205_139939_c1 | nmdc:mga0a205_139939_c1_494_2089 | 526 |
| 173 | 3300013102 | Ga0157371_10000494 | Ga0157371_1000049425 | 527 |
| 174 | 3300005329 | Ga0070683_100008516 | Ga0070683_1000085167 | 528 |
| 175 | 3300005343 | Ga0070687_100022800 | Ga0070687_1000228002 | 528 |
| 176 | 3300005355 | Ga0070671_100067848 | Ga0070671_1000678482 | 528 |
| 177 | 3300005364 | Ga0070673_100019982 | Ga0070673_1000199823 | 528 |
| 178 | 3300005615 | Ga0070702_100034378 | Ga0070702_1000343782 | 528 |
| 179 | 3300005985 | Ga0081539_10000402 | Ga0081539_1000040244 | 528 |
| 180 | 3300006881 | Ga0068865_100042019 | Ga0068865_1000420192 | 528 |
| 181 | 3300025931 | Ga0207644_10034280 | Ga0207644_100342801 | 528 |
| 182 | 3300025941 | Ga0207711_10141328 | Ga0207711_101413282 | 528 |
| 183 | 3300025944 | Ga0207661_10060786 | Ga0207661_100607862 | 528 |
| 184 | 3300025972 | Ga0207668_10045217 | Ga0207668_100452171 | 528 |
| 185 | 3300025986 | Ga0207658_10078656 | Ga0207658_100786562 | 528 |
| 186 | 3300026089 | Ga0207648_10019561 | Ga0207648_100195614 | 528 |
| 187 | 3300003203 | JGI25406J46586_10007419 | JGI25406J46586_100074192 | 529 |
| 188 | 3300005339 | Ga0070660_100017541 | Ga0070660_1000175413 | 530 |
| 189 | 3300005354 | Ga0070675_100023993 | Ga0070675_1000239934 | 530 |
| 190 | 3300005366 | Ga0070659_100079802 | Ga0070659_1000798021 | 530 |
| 191 | iso_pu_bacteria | 2818991444 | 2819589353 | 531 |
| 192 | 3300046679 | Ga0495623_0028301 | Ga0495623_0028301_1733_3364 | 532 |
| 193 | 3300005327 | Ga0070658_10028955 | Ga0070658_100289553 | 533 |
| 194 | 3300005535 | Ga0070684_100033154 | Ga0070684_1000331542 | 533 |
| 195 | 3300005564 | Ga0070664_100013638 | Ga0070664_1000136382 | 533 |
| 196 | 3300025321 | Ga0207656_10027317 | Ga0207656_100273171 | 533 |
| 197 | 3300025945 | Ga0207679_10010610 | Ga0207679_100106102 | 533 |
| 198 | 3300005937 | Ga0081455_10065435 | Ga0081455_100654352 | 534 |
| 199 | 3300006237 | Ga0097621_100023199 | Ga0097621_1000231995 | 534 |
| 200 | 3300006358 | Ga0068871_100037784 | Ga0068871_1000377845 | 534 |
| 201 | 3300013306 | Ga0163162_10014163 | Ga0163162_100141635 | 534 |
| 202 | 3300014969 | Ga0157376_10003534 | Ga0157376_100035344 | 534 |
| 203 | 3300025297 | Ga0209758_1002513 | Ga0209758_100251311 | 534 |
| 204 | 3300049569 | Ga0501032_0085910 | Ga0501032_0085910_249_1865 | 534 |
| 205 | 3300049573 | Ga0501037_0028748 | Ga0501037_0028748_1654_3270 | 534 |
| 206 | 3300049574 | Ga0501038_0020879 | Ga0501038_0020879_3162_4778 | 534 |
| 207 | 3300049579 | Ga0501043_0006481 | Ga0501043_0006481_5541_7157 | 534 |
| 208 | 3300005338 | Ga0068868_100019468 | Ga0068868_1000194682 | 535 |
| 209 | 3300005468 | Ga0070707_100000707 | Ga0070707_10000070713 | 535 |
| 210 | 3300005518 | Ga0070699_100040637 | Ga0070699_1000406372 | 535 |
| 211 | 3300005937 | Ga0081455_10003135 | Ga0081455_1000313516 | 535 |
| 212 | 3300005985 | Ga0081539_10003510 | Ga0081539_100035103 | 535 |
| 213 | 3300006847 | Ga0075431_100073912 | Ga0075431_1000739122 | 535 |
| 214 | 3300006847 | Ga0075431_100081436 | Ga0075431_1000814362 | 535 |
| 215 | 3300013297 | Ga0157378_10003948 | Ga0157378_100039482 | 535 |
| 216 | 3300014745 | Ga0157377_10041368 | Ga0157377_100413682 | 535 |
| 217 | 3300025901 | Ga0207688_10029475 | Ga0207688_100294752 | 535 |
| 218 | 3300025922 | Ga0207646_10000236 | Ga0207646_1000023650 | 535 |
| 219 | 3300026035 | Ga0207703_10030917 | Ga0207703_100309172 | 535 |
| 220 | 3300044712 | Ga0453684_0065346 | Ga0453684_0065346_1557_3197 | 535 |
| 221 | 3300048912 | Ga0496109_0000457 | Ga0496109_0000457_23411_25036 | 535 |
| 222 | 3300050510 | nmdc:mga06r32_96326_c1 | nmdc:mga06r32_96326_c1_367_2004 | 535 |
| 223 | 3300050512 | nmdc:mga0n895_98218_c1 | nmdc:mga0n895_98218_c1_653_2290 | 535 |
| 224 | 3300053096 | Ga0500641_0018378 | Ga0500641_0018378_27_1652 | 535 |
| 225 | 3300025302 | Ga0207426_1000002 | Ga0207426_1000002768 | 536 |
| 226 | 3300028794 | Ga0307515_10000057 | Ga0307515_1000005762 | 536 |
| 227 | 3300042876 | Ga0451577_0212610 | Ga0451577_0212610_96_1718 | 536 |
| 228 | iso_pu_bacteria | 2842903701 | 2842907872 | 536 |
| 229 | 3300005563 | Ga0068855_100254880 | Ga0068855_1002548802 | 537 |
| 230 | 3300005564 | Ga0070664_100043242 | Ga0070664_1000432424 | 537 |
| 231 | 3300005578 | Ga0068854_100068328 | Ga0068854_1000683282 | 537 |
| 232 | 3300005614 | Ga0068856_100034937 | Ga0068856_1000349372 | 537 |
| 233 | 3300005985 | Ga0081539_10006618 | Ga0081539_100066188 | 537 |
| 234 | 3300009174 | Ga0105241_10036766 | Ga0105241_100367662 | 537 |
| 235 | 3300013100 | Ga0157373_10023916 | Ga0157373_100239162 | 537 |
| 236 | 3300013102 | Ga0157371_10016138 | Ga0157371_100161382 | 537 |
| 237 | 3300013105 | Ga0157369_10128118 | Ga0157369_101281182 | 537 |
| 238 | 3300013296 | Ga0157374_10012676 | Ga0157374_100126762 | 537 |
| 239 | 3300013307 | Ga0157372_10254539 | Ga0157372_102545392 | 537 |
| 240 | 3300025919 | Ga0207657_10018767 | Ga0207657_100187674 | 537 |
| 241 | 3300025933 | Ga0207706_10008847 | Ga0207706_100088472 | 537 |
| 242 | 3300026078 | Ga0207702_10104818 | Ga0207702_101048181 | 537 |
| 243 | 3300039437 | Ga0436365_1533409 | Ga0436365_1533409_158_1810 | 537 |
| 244 | 3300044658 | Ga0466972_0000004 | Ga0466972_0000004_88540_90174 | 537 |
| 245 | 3300005329 | Ga0070683_100004444 | Ga0070683_1000044444 | 538 |
| 246 | 3300005329 | Ga0070683_100025263 | Ga0070683_1000252633 | 538 |
| 247 | 3300005330 | Ga0070690_100006555 | Ga0070690_1000065551 | 538 |
| 248 | 3300005331 | Ga0070670_100136812 | Ga0070670_1001368121 | 538 |
| 249 | 3300005334 | Ga0068869_100062532 | Ga0068869_1000625322 | 538 |
| 250 | 3300005338 | Ga0068868_100030524 | Ga0068868_1000305242 | 538 |
| 251 | 3300005344 | Ga0070661_100001488 | Ga0070661_1000014885 | 538 |
| 252 | 3300005354 | Ga0070675_100106036 | Ga0070675_1001060362 | 538 |
| 253 | 3300005365 | Ga0070688_100001493 | Ga0070688_1000014935 | 538 |
| 254 | 3300005366 | Ga0070659_100016040 | Ga0070659_1000160402 | 538 |
| 255 | 3300005367 | Ga0070667_100046547 | Ga0070667_1000465473 | 538 |
| 256 | 3300005455 | Ga0070663_100116346 | Ga0070663_1001163462 | 538 |
| 257 | 3300005456 | Ga0070678_100023069 | Ga0070678_1000230693 | 538 |
| 258 | 3300005457 | Ga0070662_100031643 | Ga0070662_1000316433 | 538 |
| 259 | 3300005466 | Ga0070685_10022188 | Ga0070685_100221882 | 538 |
| 260 | 3300005535 | Ga0070684_100006173 | Ga0070684_1000061735 | 538 |
| 261 | 3300005535 | Ga0070684_100024079 | Ga0070684_1000240793 | 538 |
| 262 | 3300005539 | Ga0068853_100001327 | Ga0068853_10000132711 | 538 |
| 263 | 3300005564 | Ga0070664_100000360 | Ga0070664_1000003605 | 538 |
| 264 | 3300005577 | Ga0068857_100000323 | Ga0068857_10000032322 | 538 |
| 265 | 3300005617 | Ga0068859_100071304 | Ga0068859_1000713042 | 538 |
| 266 | 3300005842 | Ga0068858_100024468 | Ga0068858_1000244683 | 538 |
| 267 | 3300006358 | Ga0068871_100097392 | Ga0068871_1000973921 | 538 |
| 268 | 3300006931 | Ga0097620_100071311 | Ga0097620_1000713112 | 538 |
| 269 | 3300009176 | Ga0105242_10047546 | Ga0105242_100475462 | 538 |
| 270 | 3300009553 | Ga0105249_10215910 | Ga0105249_102159101 | 538 |
| 271 | 3300013296 | Ga0157374_10019255 | Ga0157374_100192552 | 538 |
| 272 | 3300013296 | Ga0157374_10023675 | Ga0157374_100236753 | 538 |
| 273 | 3300013296 | Ga0157374_10050381 | Ga0157374_100503813 | 538 |
| 274 | 3300013296 | Ga0157374_10077315 | Ga0157374_100773152 | 538 |
| 275 | 3300013296 | Ga0157374_10113390 | Ga0157374_101133901 | 538 |
| 276 | 3300013306 | Ga0163162_10021128 | Ga0163162_100211285 | 538 |
| 277 | 3300013306 | Ga0163162_10022082 | Ga0163162_100220823 | 538 |
| 278 | 3300013306 | Ga0163162_10204514 | Ga0163162_102045141 | 538 |
| 279 | 3300014325 | Ga0163163_10002119 | Ga0163163_100021193 | 538 |
| 280 | 3300014969 | Ga0157376_10035449 | Ga0157376_100354492 | 538 |
| 281 | 3300025920 | Ga0207649_10002021 | Ga0207649_100020217 | 538 |
| 282 | 3300025926 | Ga0207659_10038203 | Ga0207659_100382033 | 538 |
| 283 | 3300025931 | Ga0207644_10035825 | Ga0207644_100358251 | 538 |
| 284 | 3300025932 | Ga0207690_10019573 | Ga0207690_100195732 | 538 |
| 285 | 3300025933 | Ga0207706_10006646 | Ga0207706_100066468 | 538 |
| 286 | 3300025933 | Ga0207706_10048996 | Ga0207706_100489965 | 538 |
| 287 | 3300025940 | Ga0207691_10070927 | Ga0207691_100709271 | 538 |
| 288 | 3300025942 | Ga0207689_10013446 | Ga0207689_100134465 | 538 |
| 289 | 3300025942 | Ga0207689_10021414 | Ga0207689_100214145 | 538 |
| 290 | 3300025944 | Ga0207661_10084554 | Ga0207661_100845542 | 538 |
| 291 | 3300025945 | Ga0207679_10000575 | Ga0207679_100005757 | 538 |
| 292 | 3300025945 | Ga0207679_10155558 | Ga0207679_101555581 | 538 |
| 293 | 3300025986 | Ga0207658_10162251 | Ga0207658_101622511 | 538 |
| 294 | 3300026023 | Ga0207677_10011712 | Ga0207677_100117122 | 538 |
| 295 | 3300026041 | Ga0207639_10004446 | Ga0207639_100044462 | 538 |
| 296 | 3300026116 | Ga0207674_10001817 | Ga0207674_1000181722 | 538 |
| 297 | 3300028381 | Ga0268264_10076562 | Ga0268264_100765621 | 538 |
| 298 | 3300030731 | Ga0316177_1161913 | Ga0316177_11619132 | 538 |
| 299 | 3300030742 | Ga0316183_1004801 | Ga0316183_100480117 | 538 |
| 300 | 3300030744 | Ga0316181_1138860 | Ga0316181_113886027 | 538 |
| 301 | 3300030744 | Ga0316181_1293286 | Ga0316181_12932861 | 538 |
| 302 | 3300035172 | Ga0373955_0070096 | Ga0373955_0070096_171_1799 | 538 |
| 303 | 3300046516 | Ga0495628_0090629 | Ga0495628_0090629_317_1945 | 538 |
| 304 | 3300048913 | Ga0496110_0031861 | Ga0496110_0031861_2467_4095 | 538 |
| 305 | 3300001989 | JGI24739J22299_10000178 | JGI24739J22299_100001788 | 544 |
| 306 | 3300003215 | JGI25153J46596_10021137 | JGI25153J46596_100211372 | 544 |
| 307 | 3300003771 | Ga0055526_1013471 | Ga0055526_10134712 | 544 |
| 308 | 3300003790 | Ga0055528_1000120 | Ga0055528_10001202 | 544 |
| 309 | 3300003791 | Ga0055530_10005694 | Ga0055530_100056943 | 544 |
| 310 | 3300005262 | Ga0065165_1000012 | Ga0065165_1000012253 | 544 |
| 311 | 3300025273 | Ga0209673_1000016 | Ga0209673_1000016317 | 544 |
| 312 | 3300025273 | Ga0209673_1000111 | Ga0209673_1000111127 | 544 |
| 313 | 3300025273 | Ga0209673_1023425 | Ga0209673_10234252 | 544 |
| 314 | 3300025295 | Ga0209564_1001661 | Ga0209564_10016619 | 544 |
| 315 | 3300025295 | Ga0209564_1001737 | Ga0209564_10017374 | 544 |
| 316 | 3300025297 | Ga0209758_1001215 | Ga0209758_100121515 | 544 |
| 317 | 3300025298 | Ga0209050_1002034 | Ga0209050_10020343 | 544 |
| 318 | 3300025302 | Ga0207426_1003728 | Ga0207426_10037284 | 544 |
| 319 | 3300025304 | Ga0209257_1002577 | Ga0209257_10025778 | 544 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p1p-assembly1.cif.gz_bb | crystal structure of human acetylcholinesterase in complex with (e)-3-hydroxy-6-(3-(4-(4-(((2r,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2h-pyran-2-yl)oxy)butyl)-1h-1,2,3-triazol-1-yl)propyl)picolinaldehyde oxime | 0.8975 | 26 | 267 |
| 2ogs-assembly1.cif.gz_A | crystal structure of the geobacillus stearothermophilus carboxylesterase est55 at ph 6.2 | 0.8634 | 28 | 537 |
| 3k9b-assembly4.cif.gz_C | crystal structure of human liver carboxylesterase 1 (hce1) in covalent complex with the nerve agent cyclosarin (gf) | 0.8625 | 29 | 538 |
| 3k9b-assembly4.cif.gz_C | crystal structure of human liver carboxylesterase 1 (hce1) in covalent complex with the nerve agent cyclosarin (gf) | 0.8571 | 29 | 538 |
| 2ogs-assembly1.cif.gz_A | crystal structure of the geobacillus stearothermophilus carboxylesterase est55 at ph 6.2 | 0.8565 | 28 | 537 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ogsA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8634 | 28 | 537 | 3.40.50.1820 |
| 3k9bC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8625 | 29 | 538 | 3.40.50.1820 |
| 3k9bC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8571 | 29 | 538 | 3.40.50.1820 |
| 2ogsA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8565 | 28 | 537 | 3.40.50.1820 |
| af_Q54RL3_36_542_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8521 | 27 | 541 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A646FSZ5-F1-model_v4 | deleted | 0.97 | 28 | 267 |
|
| AF-A0A5B9G0A8-F1-model_v4 | Carboxylic ester hydrolase (EC 3.1.1.-) | 0.9677 | 27 | 542 |
GO:0016787
|
| AF-A0A3D2NCN8-F1-model_v4 | deleted | 0.9654 | 29 | 247 |
|
| AF-A0A4Q3NYV3-F1-model_v4 | deleted | 0.9649 | 103 | 413 |
|
| AF-A0A2M9CRS4-F1-model_v4 | Carboxylic ester hydrolase (EC 3.1.1.-) | 0.9569 | 29 | 543 |
GO:0052689
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar