F404958

General Info

Members Datasets Scaffolds Average Seq Length
319 163 638 394

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100010826|Ga0070714_1000108266
Length 428
Sequence LPIRECGDGTDPGAVVWPLRDNGRVARLLVLGAGPAQLGVLAAARAAGLAIVAADRDPSAPGFRYADRRAIVSIEDEPAIERLARAEDVDGVIAPGTDHAVAIAARIAERLALPHPLSAETAQIAVSRQKQRERLTEAGIPQPRSIVCRSLEEVTRAAEELGYPVVIEAPNRAGERGVGLAPDRDALAAAAAEALAESRGDFCLVEELVGDRVVTVNGFSARGRFVPLTVTDREQAPPPAFGVPLAHLWPAALEPAEVGAAIETAAAAARAVGVELGPTTAQIFLGDDGPLLAKLSARVGGSHDAELCRVALGVDLNALAVTVALGGTVHAQSLSPASGVEAACVRFLVAPAGELRDVKGLDEAYELDGVRGIRVYRKPGHVFGALRRASDRAGAVLATGDTPADALARADRAAARIHFVTGPVEAVA

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
126 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 14.42
Rhizosphere 84.95
Stem 0
Stem Tuber 0
Unclassified 4.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100010826 3300005435 Bacteria 7223
2 Ga0070658_10008100 3300005327 Bacteria 8453
3 Ga0070658_10010979 3300005327 Bacteria 7259
4 Ga0070658_10011474 3300005327 Bacteria 7105
5 Ga0070658_10050155 3300005327 Bacteria 3383
6 Ga0070683_100004239 3300005329 Bacteria 11759
7 Ga0070683_100011095 3300005329 Bacteria 7769
8 Ga0070683_100091646 3300005329 Bacteria 2854
9 Ga0070683_100100900 3300005329 Bacteria 2717
10 Ga0070683_100123602 3300005329 Bacteria 2445
11 Ga0070690_100029114 3300005330 Bacteria 3423
12 Ga0070680_100067077 3300005336 Bacteria 2943
13 Ga0070680_100110707 3300005336 Bacteria 2286
14 Ga0070682_100002467 3300005337 Bacteria 10219
15 Ga0070682_100022304 3300005337 Bacteria 3749
16 Ga0070682_100096947 3300005337 Bacteria 1940
17 Ga0070660_100013350 3300005339 Bacteria 5889
18 Ga0070660_100040065 3300005339 Bacteria 3563
19 Ga0070660_100047040 3300005339 Bacteria 3309
20 Ga0070689_100017667 3300005340 Bacteria 5244
21 Ga0070692_10008767 3300005345 Bacteria 4523
22 Ga0070675_100108966 3300005354 Bacteria 2340
23 Ga0070674_100011528 3300005356 Bacteria 5387
24 Ga0070674_100282795 3300005356 Bacteria 1315
25 Ga0070673_100152258 3300005364 Bacteria 1960
26 Ga0070659_100020843 3300005366 Bacteria 4985
27 Ga0070659_100050543 3300005366 Bacteria 3268
28 Ga0070714_100024938 3300005435 Bacteria 4930
29 Ga0070714_100026672 3300005435 Bacteria 4778
30 Ga0070705_100015010 3300005440 Bacteria 3996
31 Ga0070705_100063804 3300005440 Bacteria 2198
32 Ga0070700_100000636 3300005441 Bacteria 17444
33 Ga0070694_100075427 3300005444 Bacteria 2333
34 Ga0070678_100003943 3300005456 Bacteria 8340
35 Ga0070662_100088906 3300005457 Bacteria 2316
36 Ga0070681_10004691 3300005458 Bacteria 13075
37 Ga0070681_10048547 3300005458 Bacteria 4241
38 Ga0070681_10057830 3300005458 Bacteria 3858
39 Ga0070681_10132103 3300005458 Bacteria 2429
40 Ga0070685_10007702 3300005466 Bacteria 5511
41 Ga0070706_100057423 3300005467 Bacteria 3592
42 Ga0070706_100195657 3300005467 Bacteria 1889
43 Ga0070707_100075997 3300005468 Bacteria 3240
44 Ga0070698_100012441 3300005471 Bacteria 9006
45 Ga0070698_100015788 3300005471 Bacteria 7976
46 Ga0070698_100040074 3300005471 Bacteria 4816
47 Ga0070699_100010155 3300005518 Bacteria 8149
48 Ga0070699_100054236 3300005518 Bacteria 3470
49 Ga0070679_100019132 3300005530 Bacteria 6654
50 Ga0070679_100030662 3300005530 Bacteria 5311
51 Ga0070679_100134949 3300005530 Bacteria 2449
52 Ga0070679_100196912 3300005530 Bacteria 1982
53 Ga0070679_100261839 3300005530 Unclassified 1685
54 Ga0070679_100296862 3300005530 Unclassified 1567
55 Ga0070684_100001943 3300005535 Bacteria 15167
56 Ga0070684_100028426 3300005535 Bacteria 4730
57 Ga0070684_100099303 3300005535 Bacteria 2598
58 Ga0070684_100113186 3300005535 Bacteria 2435
59 Ga0068853_100369784 3300005539 Bacteria 1337
60 Ga0070686_100112086 3300005544 Bacteria 1860
61 Ga0070695_100030974 3300005545 Bacteria 3333
62 Ga0070695_100075066 3300005545 Bacteria 2223
63 Ga0070696_100020081 3300005546 Bacteria 4530
64 Ga0070696_100035549 3300005546 Bacteria 3431
65 Ga0070693_100024817 3300005547 Bacteria 3220
66 Ga0070665_100006235 3300005548 Bacteria 12200
67 Ga0070704_100012215 3300005549 Bacteria 5300
68 Ga0068856_100248041 3300005614 Bacteria 1796
69 Ga0068856_100296046 3300005614 Bacteria 1635
70 Ga0068856_100409074 3300005614 Unclassified 1376
71 Ga0070702_100029747 3300005615 Bacteria 2973
72 Ga0068866_10046034 3300005718 Bacteria 2191
73 Ga0075365_10075007 3300006038 Unclassified 2282
74 Ga0070715_10028293 3300006163 Bacteria 2247
75 Ga0070712_100008296 3300006175 Bacteria 6528
76 Ga0070712_100029244 3300006175 Bacteria 3693
77 Ga0068871_100005036 3300006358 Bacteria 9227
78 Ga0075433_10001703 3300006852 Bacteria 16411
79 Ga0075436_100007046 3300006914 Bacteria 7696
80 Ga0075435_100002972 3300007076 Bacteria 11397
81 Ga0105240_10075802 3300009093 Bacteria 4148
82 Ga0111539_10247699 3300009094 Bacteria 2075
83 Ga0105245_10009293 3300009098 Bacteria 8571
84 Ga0105245_10054348 3300009098 Bacteria 3596
85 Ga0114129_10001101 3300009147 Bacteria 35510
86 Ga0114129_10053285 3300009147 Bacteria 5675
87 Ga0105243_10010801 3300009148 Bacteria 6912
88 Ga0105242_10014423 3300009176 Bacteria 6122
89 Ga0105248_10047862 3300009177 Bacteria 4795
90 Ga0105239_10004702 3300010375 Bacteria 16217
91 Ga0105239_10123216 3300010375 Bacteria 2880
92 Ga0157370_10028069 3300013104 Bacteria 5541
93 Ga0157370_10032365 3300013104 Bacteria 5106
94 Ga0157369_10028148 3300013105 Bacteria 6220
95 Ga0157369_10292736 3300013105 Bacteria 1695
96 Ga0157369_10375540 3300013105 Bacteria 1476
97 Ga0157374_10002319 3300013296 Bacteria 16049
98 Ga0157378_10009227 3300013297 Bacteria 8592
99 Ga0163162_10034961 3300013306 Bacteria 5003
100 Ga0157375_10004196 3300013308 Bacteria 12510
101 Ga0157375_10012868 3300013308 Bacteria 7433
102 Ga0157375_10066212 3300013308 Bacteria 3605
103 Ga0163163_10125159 3300014325 Bacteria 2608
104 Ga0182008_10001822 3300014497 Bacteria 13892
105 Ga0182008_10046443 3300014497 Bacteria 2159
106 Ga0157376_10002621 3300014969 Bacteria 12231
107 Ga0182006_1017572 3300015261 Bacteria 3036
108 Ga0163161_10227794 3300017792 Unclassified 1445
109 Ga0206353_10366061 3300020082 Bacteria 6883
110 Ga0213871_10000761 3300021441 Bacteria 4772
111 Ga0207642_10006522 3300025899 Bacteria 3888
112 Ga0207688_10123288 3300025901 Bacteria 1514
113 Ga0207699_10004091 3300025906 Bacteria 6982
114 Ga0207705_10036608 3300025909 Bacteria 3511
115 Ga0207684_10010988 3300025910 Bacteria 7937
116 Ga0207684_10218084 3300025910 Bacteria 1646
117 Ga0207707_10011274 3300025912 Bacteria 7781
118 Ga0207707_10054800 3300025912 Bacteria 3471
119 Ga0207707_10082595 3300025912 Bacteria 2805
120 Ga0207707_10141662 3300025912 Bacteria 2102
121 Ga0207695_10044250 3300025913 Bacteria 4736
122 Ga0207693_10015951 3300025915 Bacteria 6014
123 Ga0207663_10039288 3300025916 Bacteria 2866
124 Ga0207660_10007694 3300025917 Bacteria 6977
125 Ga0207660_10156100 3300025917 Bacteria 1757
126 Ga0207660_10194210 3300025917 Bacteria 1582
127 Ga0207657_10011502 3300025919 Bacteria 8788
128 Ga0207657_10018342 3300025919 Bacteria 6683
129 Ga0207657_10071518 3300025919 Bacteria 2937
130 Ga0207652_10001355 3300025921 Bacteria 21772
131 Ga0207652_10011514 3300025921 Bacteria 7131
132 Ga0207652_10037533 3300025921 Bacteria 4101
133 Ga0207652_10142286 3300025921 Unclassified 2146
134 Ga0207652_10189883 3300025921 Bacteria 1848
135 Ga0207652_10201568 3300025921 Unclassified 1791
136 Ga0207646_10061154 3300025922 Bacteria 3362
137 Ga0207646_10127906 3300025922 Bacteria 2285
138 Ga0207687_10004045 3300025927 Bacteria 9825
139 Ga0207687_10035183 3300025927 Bacteria 3406
140 Ga0207664_10036193 3300025929 Bacteria 3814
141 Ga0207664_10149602 3300025929 Bacteria 1982
142 Ga0207690_10069242 3300025932 Bacteria 2427
143 Ga0207669_10022769 3300025937 Bacteria 3334
144 Ga0207691_10003111 3300025940 Bacteria 16199
145 Ga0207711_10091876 3300025941 Bacteria 2670
146 Ga0207661_10009278 3300025944 Bacteria 7052
147 Ga0207661_10013796 3300025944 Bacteria 5905
148 Ga0207661_10064573 3300025944 Bacteria 2968
149 Ga0207661_10167318 3300025944 Bacteria 1911
150 Ga0207661_10265505 3300025944 Bacteria 1530
151 Ga0207667_10088631 3300025949 Bacteria 3199
152 Ga0207651_10086373 3300025960 Unclassified 2280
153 Ga0207651_10138491 3300025960 Unclassified 1876
154 Ga0207640_10070518 3300025981 Bacteria 2351
155 Ga0207677_10102389 3300026023 Bacteria 2111
156 Ga0207708_10010274 3300026075 Bacteria 6949
157 Ga0207702_10012153 3300026078 Bacteria 7163
158 Ga0207702_10037419 3300026078 Bacteria 4062
159 Ga0207702_10126150 3300026078 Bacteria 2298
160 Ga0207702_10335366 3300026078 Bacteria 1443
161 Ga0207648_10001368 3300026089 Bacteria 26927
162 Ga0207674_10000430 3300026116 Bacteria 54816
163 Ga0207675_100026451 3300026118 Bacteria 5401
164 Ga0207683_10002144 3300026121 Bacteria 17336
165 Ga0207698_10071292 3300026142 Bacteria 2757
166 Ga0265318_10003962 3300028577 Bacteria 7297
167 Ga0265318_10021239 3300028577 Bacteria 2609
168 Ga0265338_10018021 3300028800 Bacteria 7580
169 Ga0265338_10071663 3300028800 Bacteria 2963
170 Ga0265330_10050175 3300031235 Bacteria 1830
171 Ga0265320_10054723 3300031240 Bacteria 1924
172 Ga0265325_10030732 3300031241 Bacteria 2879
173 Ga0265325_10049189 3300031241 Bacteria 2176
174 Ga0265325_10051889 3300031241 Bacteria 2107
175 Ga0265325_10052244 3300031241 Bacteria 2099
176 Ga0265340_10051675 3300031247 Bacteria 1989
177 Ga0265340_10062932 3300031247 Bacteria 1771
178 Ga0265327_10072086 3300031251 Bacteria 1726
179 Ga0265316_10076146 3300031344 Bacteria 2578
180 Ga0265313_10073148 3300031595 Bacteria 1574
181 Ga0265314_10028693 3300031711 Bacteria 4145
182 Ga0265342_10031647 3300031712 Bacteria 3269
183 Ga0265342_10060620 3300031712 Bacteria 2230
184 Ga0265342_10077593 3300031712 Bacteria 1923
185 Ga0373943_0079244 3300035170 Bacteria 1681
186 Ga0373955_0108346 3300035172 Bacteria 1604
187 Ga0395899_0004488 3300037312 Bacteria 10877
188 Ga0395899_0016241 3300037312 Bacteria 5675
189 Ga0395899_0043952 3300037312 Bacteria 3329
190 Ga0395899_0076019 3300037312 Bacteria 2452
191 Ga0395900_0005025 3300037418 Bacteria 13875
192 Ga0395900_0005579 3300037418 Bacteria 13171
193 Ga0395900_0014970 3300037418 Bacteria 7905
194 Ga0395900_0017220 3300037418 Bacteria 7375
195 Ga0395900_0019406 3300037418 Bacteria 6932
196 Ga0395900_0042110 3300037418 Bacteria 4704
197 Ga0395900_0064930 3300037418 Bacteria 3749
198 Ga0395900_0086550 3300037418 Bacteria 3220
199 Ga0395900_0113506 3300037418 Bacteria 2781
200 Ga0395900_0169025 3300037418 Bacteria 2227
201 Ga0395900_0243256 3300037418 Bacteria 1804
202 Ga0395900_0256127 3300037418 Bacteria 1749
203 Ga0395898_0008723 3300037466 Bacteria 10697
204 Ga0395898_0012223 3300037466 Bacteria 8876
205 Ga0395898_0022769 3300037466 Bacteria 6340
206 Ga0395898_0037309 3300037466 Bacteria 4822
207 Ga0395898_0063704 3300037466 Bacteria 3577
208 Ga0395898_0195298 3300037466 Unclassified 1933
209 Ga0395898_0261734 3300037466 Bacteria 1650
210 Ga0395898_0312892 3300037466 Bacteria 1498
211 Ga0395898_0389368 3300037466 Bacteria 1329
212 Ga0395905_0002703 3300037471 Bacteria 19433
213 Ga0395905_0018791 3300037471 Bacteria 6556
214 Ga0395905_0024147 3300037471 Bacteria 5738
215 Ga0395905_0050492 3300037471 Bacteria 3897
216 Ga0395905_0089365 3300037471 Bacteria 2887
217 Ga0395901_0004668 3300038443 Bacteria 13811
218 Ga0395901_0009826 3300038443 Bacteria 9701
219 Ga0395901_0025194 3300038443 Bacteria 6107
220 Ga0395901_0036109 3300038443 Bacteria 5105
221 Ga0395901_0065459 3300038443 Bacteria 3784
222 Ga0395901_0104084 3300038443 Bacteria 2978
223 Ga0395901_0187800 3300038443 Bacteria 2167
224 Ga0395901_0291974 3300038443 Bacteria 1692
225 Ga0436360_1276265 3300039438 Bacteria 7663
226 Ga0466966_0056684 3300044684 Bacteria 2478
227 Ga0466963_0005943 3300044694 Bacteria 7188
228 Ga0466963_0006841 3300044694 Bacteria 6785
229 Ga0466964_0103538 3300044706 Bacteria 1258
230 Ga0466957_0016420 3300044842 Bacteria 4332
231 Ga0466959_0009487 3300045049 Bacteria 6924
232 Ga0466959_0015937 3300045049 Bacteria 5483
233 Ga0466967_0000091 3300045976 Bacteria 32078
234 Ga0466967_0033238 3300045976 Bacteria 4364
235 Ga0466967_0033342 3300045976 Bacteria 4358
236 Ga0466967_0033803 3300045976 Bacteria 4333
237 Ga0466967_0053400 3300045976 Bacteria 3551
238 Ga0466967_0060144 3300045976 Bacteria 3365
239 Ga0466967_0076371 3300045976 Bacteria 3013
240 Ga0495592_0095596 3300046454 Bacteria 2125
241 Ga0495603_0016766 3300046455 Bacteria 4431
242 Ga0495641_0027622 3300046461 Bacteria 2757
243 Ga0495582_0014116 3300046473 Bacteria 4396
244 Ga0495596_0066468 3300046500 Bacteria 1402
245 Ga0495663_0006574 3300046525 Bacteria 3209
246 Ga0495665_0022450 3300046531 Bacteria 3393
247 Ga0495661_0100789 3300046665 Bacteria 1626
248 Ga0495657_0035103 3300046675 Bacteria 3478
249 Ga0495658_0062485 3300046683 Bacteria 2141
250 Ga0495613_0126698 3300046689 Unclassified 1831
251 Ga0495581_0000691 3300047315 Bacteria 17722
252 Ga0495581_0022909 3300047315 Bacteria 3618
253 Ga0495676_0108644 3300047321 Bacteria 2040
254 Ga0495680_0101742 3300047322 Bacteria 2140
255 Ga0496100_0001380 3300048903 Bacteria 11895
256 Ga0496100_0108687 3300048903 Bacteria 1923
257 Ga0496101_0003371 3300048904 Bacteria 9960
258 Ga0496101_0036380 3300048904 Bacteria 3487
259 Ga0496101_0081835 3300048904 Bacteria 2389
260 Ga0496102_0010280 3300048905 Bacteria 8046
261 Ga0496102_0014819 3300048905 Bacteria 6780
262 Ga0496102_0066873 3300048905 Bacteria 3295
263 Ga0496102_0138454 3300048905 Bacteria 2281
264 Ga0496102_0149429 3300048905 Bacteria 2194
265 Ga0496103_0001017 3300048906 Bacteria 19613
266 Ga0496103_0157449 3300048906 Bacteria 1456
267 Ga0496104_0053996 3300048907 Bacteria 3797
268 Ga0496104_0098068 3300048907 Bacteria 2805
269 Ga0496104_0146829 3300048907 Unclassified 2265
270 Ga0496104_0233905 3300048907 Bacteria 1749
271 Ga0496105_0000268 3300048908 Bacteria 34544
272 Ga0496105_0034119 3300048908 Bacteria 4184
273 Ga0496105_0113283 3300048908 Bacteria 2238
274 Ga0496106_0002095 3300048909 Bacteria 14956
275 Ga0496106_0225894 3300048909 Unclassified 1494
276 Ga0496107_0001188 3300048910 Bacteria 15843
277 Ga0496107_0030330 3300048910 Bacteria 3854
278 Ga0496107_0089733 3300048910 Bacteria 2245
279 Ga0496108_0001860 3300048911 Bacteria 16877
280 Ga0496108_0018916 3300048911 Bacteria 5649
281 Ga0496108_0037651 3300048911 Bacteria 4030
282 Ga0496108_0234679 3300048911 Unclassified 1595
283 Ga0496109_0000482 3300048912 Bacteria 33977
284 Ga0496109_0010099 3300048912 Bacteria 8054
285 Ga0496109_0010236 3300048912 Bacteria 8010
286 Ga0496109_0017937 3300048912 Bacteria 6214
287 Ga0496109_0054903 3300048912 Bacteria 3633
288 Ga0496109_0105040 3300048912 Bacteria 2623
289 Ga0496109_0118975 3300048912 Bacteria 2459
290 Ga0496110_0000385 3300048913 Bacteria 29685
291 Ga0496110_0015260 3300048913 Bacteria 6389
292 Ga0496110_0056160 3300048913 Bacteria 3465
293 Ga0496111_0000568 3300048914 Bacteria 19257
294 Ga0496111_0001335 3300048914 Bacteria 13905
295 Ga0496112_0010263 3300048915 Bacteria 8489
296 Ga0496112_0023616 3300048915 Bacteria 5878
297 Ga0496112_0025794 3300048915 Bacteria 5646
298 Ga0496112_0075477 3300048915 Bacteria 3334
299 Ga0496113_0032834 3300048916 Bacteria 3774
300 Ga0496114_0025906 3300048917 Bacteria 4797
301 Ga0501067_0014001 3300049583 Bacteria 4444
302 Ga0501067_0051453 3300049583 Bacteria 2283
303 Ga0501067_0106249 3300049583 Bacteria 1560
304 Ga0501070_0048631 3300049586 Bacteria 3522
305 Ga0501070_0071105 3300049586 Bacteria 2881
306 Ga0501072_0000778 3300049588 Bacteria 23330
307 Ga0501073_0096909 3300049589 Bacteria 2048
308 Ga0501080_0062229 3300049742 Bacteria 3473
309 Ga0501080_0117665 3300049742 Bacteria 2463
310 Ga0501083_0000582 3300049744 Bacteria 23454
311 nmdc:mga0yw44_20719_c1 3300050492 Bacteria 3655
312 nmdc:mga05p37_226065_c1 3300050507 Bacteria 2256
313 nmdc:mga05p37_28625_c1 3300050507 Bacteria 6796
314 nmdc:mga08y16_295140_c1 3300050511 Bacteria 1671
315 nmdc:mga0rr50_2406_c1 3300050513 Bacteria 10534
316 Ga0495619_0019832 3300053085 Bacteria 4279
317 Ga0501082_0174458 3300060353 Bacteria 1869
318 Ga0466962_0002782 3300061719 Bacteria 8310
319 Ga0530510_0195599 3300061734 Bacteria 1501
320 Ga0070714_100010826
321 Ga0070658_10008100
322 Ga0070658_10010979
323 Ga0070658_10011474
324 Ga0070658_10050155
325 Ga0070683_100004239
326 Ga0070683_100011095
327 Ga0070683_100091646
328 Ga0070683_100100900
329 Ga0070683_100123602
330 Ga0070690_100029114
331 Ga0070680_100067077
332 Ga0070680_100110707
333 Ga0070682_100002467
334 Ga0070682_100022304
335 Ga0070682_100096947
336 Ga0070660_100013350
337 Ga0070660_100040065
338 Ga0070660_100047040
339 Ga0070689_100017667
340 Ga0070692_10008767
341 Ga0070675_100108966
342 Ga0070674_100011528
343 Ga0070674_100282795
344 Ga0070673_100152258
345 Ga0070659_100020843
346 Ga0070659_100050543
347 Ga0070714_100024938
348 Ga0070714_100026672
349 Ga0070705_100015010
350 Ga0070705_100063804
351 Ga0070700_100000636
352 Ga0070694_100075427
353 Ga0070678_100003943
354 Ga0070662_100088906
355 Ga0070681_10004691
356 Ga0070681_10048547
357 Ga0070681_10057830
358 Ga0070681_10132103
359 Ga0070685_10007702
360 Ga0070706_100057423
361 Ga0070706_100195657
362 Ga0070707_100075997
363 Ga0070698_100012441
364 Ga0070698_100015788
365 Ga0070698_100040074
366 Ga0070699_100010155
367 Ga0070699_100054236
368 Ga0070679_100019132
369 Ga0070679_100030662
370 Ga0070679_100134949
371 Ga0070679_100196912
372 Ga0070679_100261839
373 Ga0070679_100296862
374 Ga0070684_100001943
375 Ga0070684_100028426
376 Ga0070684_100099303
377 Ga0070684_100113186
378 Ga0068853_100369784
379 Ga0070686_100112086
380 Ga0070695_100030974
381 Ga0070695_100075066
382 Ga0070696_100020081
383 Ga0070696_100035549
384 Ga0070693_100024817
385 Ga0070665_100006235
386 Ga0070704_100012215
387 Ga0068856_100248041
388 Ga0068856_100296046
389 Ga0068856_100409074
390 Ga0070702_100029747
391 Ga0068866_10046034
392 Ga0075365_10075007
393 Ga0070715_10028293
394 Ga0070712_100008296
395 Ga0070712_100029244
396 Ga0068871_100005036
397 Ga0075433_10001703
398 Ga0075436_100007046
399 Ga0075435_100002972
400 Ga0105240_10075802
401 Ga0111539_10247699
402 Ga0105245_10009293
403 Ga0105245_10054348
404 Ga0114129_10001101
405 Ga0114129_10053285
406 Ga0105243_10010801
407 Ga0105242_10014423
408 Ga0105248_10047862
409 Ga0105239_10004702
410 Ga0105239_10123216
411 Ga0157370_10028069
412 Ga0157370_10032365
413 Ga0157369_10028148
414 Ga0157369_10292736
415 Ga0157369_10375540
416 Ga0157374_10002319
417 Ga0157378_10009227
418 Ga0163162_10034961
419 Ga0157375_10004196
420 Ga0157375_10012868
421 Ga0157375_10066212
422 Ga0163163_10125159
423 Ga0182008_10001822
424 Ga0182008_10046443
425 Ga0157376_10002621
426 Ga0182006_1017572
427 Ga0163161_10227794
428 Ga0206353_10366061
429 Ga0213871_10000761
430 Ga0207642_10006522
431 Ga0207688_10123288
432 Ga0207699_10004091
433 Ga0207705_10036608
434 Ga0207684_10010988
435 Ga0207684_10218084
436 Ga0207707_10011274
437 Ga0207707_10054800
438 Ga0207707_10082595
439 Ga0207707_10141662
440 Ga0207695_10044250
441 Ga0207693_10015951
442 Ga0207663_10039288
443 Ga0207660_10007694
444 Ga0207660_10156100
445 Ga0207660_10194210
446 Ga0207657_10011502
447 Ga0207657_10018342
448 Ga0207657_10071518
449 Ga0207652_10001355
450 Ga0207652_10011514
451 Ga0207652_10037533
452 Ga0207652_10142286
453 Ga0207652_10189883
454 Ga0207652_10201568
455 Ga0207646_10061154
456 Ga0207646_10127906
457 Ga0207687_10004045
458 Ga0207687_10035183
459 Ga0207664_10036193
460 Ga0207664_10149602
461 Ga0207690_10069242
462 Ga0207669_10022769
463 Ga0207691_10003111
464 Ga0207711_10091876
465 Ga0207661_10009278
466 Ga0207661_10013796
467 Ga0207661_10064573
468 Ga0207661_10167318
469 Ga0207661_10265505
470 Ga0207667_10088631
471 Ga0207651_10086373
472 Ga0207651_10138491
473 Ga0207640_10070518
474 Ga0207677_10102389
475 Ga0207708_10010274
476 Ga0207702_10012153
477 Ga0207702_10037419
478 Ga0207702_10126150
479 Ga0207702_10335366
480 Ga0207648_10001368
481 Ga0207674_10000430
482 Ga0207675_100026451
483 Ga0207683_10002144
484 Ga0207698_10071292
485 Ga0265318_10003962
486 Ga0265318_10021239
487 Ga0265338_10018021
488 Ga0265338_10071663
489 Ga0265330_10050175
490 Ga0265320_10054723
491 Ga0265325_10030732
492 Ga0265325_10049189
493 Ga0265325_10051889
494 Ga0265325_10052244
495 Ga0265340_10051675
496 Ga0265340_10062932
497 Ga0265327_10072086
498 Ga0265316_10076146
499 Ga0265313_10073148
500 Ga0265314_10028693
501 Ga0265342_10031647
502 Ga0265342_10060620
503 Ga0265342_10077593
504 Ga0373943_0079244
505 Ga0373955_0108346
506 Ga0395899_0004488
507 Ga0395899_0016241
508 Ga0395899_0043952
509 Ga0395899_0076019
510 Ga0395900_0005025
511 Ga0395900_0005579
512 Ga0395900_0014970
513 Ga0395900_0017220
514 Ga0395900_0019406
515 Ga0395900_0042110
516 Ga0395900_0064930
517 Ga0395900_0086550
518 Ga0395900_0113506
519 Ga0395900_0169025
520 Ga0395900_0243256
521 Ga0395900_0256127
522 Ga0395898_0008723
523 Ga0395898_0012223
524 Ga0395898_0022769
525 Ga0395898_0037309
526 Ga0395898_0063704
527 Ga0395898_0195298
528 Ga0395898_0261734
529 Ga0395898_0312892
530 Ga0395898_0389368
531 Ga0395905_0002703
532 Ga0395905_0018791
533 Ga0395905_0024147
534 Ga0395905_0050492
535 Ga0395905_0089365
536 Ga0395901_0004668
537 Ga0395901_0009826
538 Ga0395901_0025194
539 Ga0395901_0036109
540 Ga0395901_0065459
541 Ga0395901_0104084
542 Ga0395901_0187800
543 Ga0395901_0291974
544 Ga0436360_1276265
545 Ga0466966_0056684
546 Ga0466963_0005943
547 Ga0466963_0006841
548 Ga0466964_0103538
549 Ga0466957_0016420
550 Ga0466959_0009487
551 Ga0466959_0015937
552 Ga0466967_0000091
553 Ga0466967_0033238
554 Ga0466967_0033342
555 Ga0466967_0033803
556 Ga0466967_0053400
557 Ga0466967_0060144
558 Ga0466967_0076371
559 Ga0495592_0095596
560 Ga0495603_0016766
561 Ga0495641_0027622
562 Ga0495582_0014116
563 Ga0495596_0066468
564 Ga0495663_0006574
565 Ga0495665_0022450
566 Ga0495661_0100789
567 Ga0495657_0035103
568 Ga0495658_0062485
569 Ga0495613_0126698
570 Ga0495581_0000691
571 Ga0495581_0022909
572 Ga0495676_0108644
573 Ga0495680_0101742
574 Ga0496100_0001380
575 Ga0496100_0108687
576 Ga0496101_0003371
577 Ga0496101_0036380
578 Ga0496101_0081835
579 Ga0496102_0010280
580 Ga0496102_0014819
581 Ga0496102_0066873
582 Ga0496102_0138454
583 Ga0496102_0149429
584 Ga0496103_0001017
585 Ga0496103_0157449
586 Ga0496104_0053996
587 Ga0496104_0098068
588 Ga0496104_0146829
589 Ga0496104_0233905
590 Ga0496105_0000268
591 Ga0496105_0034119
592 Ga0496105_0113283
593 Ga0496106_0002095
594 Ga0496106_0225894
595 Ga0496107_0001188
596 Ga0496107_0030330
597 Ga0496107_0089733
598 Ga0496108_0001860
599 Ga0496108_0018916
600 Ga0496108_0037651
601 Ga0496108_0234679
602 Ga0496109_0000482
603 Ga0496109_0010099
604 Ga0496109_0010236
605 Ga0496109_0017937
606 Ga0496109_0054903
607 Ga0496109_0105040
608 Ga0496109_0118975
609 Ga0496110_0000385
610 Ga0496110_0015260
611 Ga0496110_0056160
612 Ga0496111_0000568
613 Ga0496111_0001335
614 Ga0496112_0010263
615 Ga0496112_0023616
616 Ga0496112_0025794
617 Ga0496112_0075477
618 Ga0496113_0032834
619 Ga0496114_0025906
620 Ga0501067_0014001
621 Ga0501067_0051453
622 Ga0501067_0106249
623 Ga0501070_0048631
624 Ga0501070_0071105
625 Ga0501072_0000778
626 Ga0501073_0096909
627 Ga0501080_0062229
628 Ga0501080_0117665
629 Ga0501083_0000582
630 nmdc:mga0yw44_20719_c1
631 nmdc:mga05p37_226065_c1
632 nmdc:mga05p37_28625_c1
633 nmdc:mga08y16_295140_c1
634 nmdc:mga0rr50_2406_c1
635 Ga0495619_0019832
636 Ga0501082_0174458
637 Ga0466962_0002782
638 Ga0530510_0195599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18603

LAL_C2

L-amino acid ligase C-terminal domain 2

346

422

0.99

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

127

332

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lkd-assembly1.cif.gz_A in meso full-length rat kmo in complex with a pyrazoyl benzoic acid inhibitor 0.8612 2 32
6lke-assembly1.cif.gz_A in meso full-length rat kmo in complex with an inhibitor identified via dna-encoded chemical library screening 0.8599 2 32
5nmw-assembly1.cif.gz_A-2 crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.8513 1 35
1sez-assembly1.cif.gz_A crystal structure of protoporphyrinogen ix oxidase 0.8509 1 33
2zbw-assembly1.cif.gz_A crystal structure of thioredoxin reductase-like protein from thermus thermophilus hb8 0.8481 2 34
ID Description Score Start End Superfamily
2vqdA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8781 2 68 3.40.50.20
af_Q58347_1_95_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8764 2 89 3.40.50.20
4dimA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8724 2 113 3.40.50.20
3wo0A03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.871 163 279 3.30.470.20
af_A0A1D8PH67_164_295_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8697 1 47 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7X9ADZ3-F1-model_v4 Carboxylate--amine ligase 0.9662 2 95
AF-A0A1Q6XCA6-F1-model_v4 ATP-grasp domain-containing protein 0.9502 2 295 GO:0005524
GO:0046872
AF-A0A7C6FF71-F1-model_v4 ATPase 0.9461 1 113
AF-A0A1X7MDY3-F1-model_v4 deleted 0.9453 2 126
AF-A0A7X9ADZ3-F1-model_v4 Carboxylate--amine ligase 0.9372 2 95

Map