F404820

General Info

Members Datasets Scaffolds Average Seq Length
318 203 636 297

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0487556|Ga0501080_0487556_28_1035
Length 335
Sequence LPLVSFPLAWGAYSPLNGRMSKKETPREKVYEEAARDPKAFIKLSRRFARPYRVSNGKKFRLKHFNPADTGDLVHEDKPSAKQALAEGVLALAELQERLYAQDQWAVLLIFQAPDAAGKDSAVKHVMSGVNPQGCEVHSFKAPSNEELEHDFLWRSVRTLPRRGNIGIFNRSYYEEVLVVRVHPQYLAAEKLPPQLVTKHIWKDRFKSIRNFEKYLAQNGVLVRKFFLNVSKKEQKKRFLERLNKPSKHWKFNPEDLAERNHWDEYQKAYEEMIRETATEESPWYIVPADNKWYTRVVVASAVVEALDSLDLKYPKVTRKMTKQLAASRRKLEKE

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
102 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
110 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
111 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
112 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
187 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.63
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.92
Nodule 0
Rhizoplane 2.83
Rhizosphere 88.05
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0487556 3300049742 Bacteria 1102
2 JGI25404J52841_10014988 3300003659 Bacteria 1683
3 Ga0070670_100039687 3300005331 Bacteria 4048
4 Ga0068869_100054377 3300005334 Bacteria 2914
5 Ga0070680_100049732 3300005336 Bacteria 3418
6 Ga0070689_100252627 3300005340 Bacteria 1455
7 Ga0070689_100310296 3300005340 Bacteria 1315
8 Ga0070691_10071860 3300005341 Bacteria 1680
9 Ga0070668_100044508 3300005347 Bacteria 3405
10 Ga0070669_100439214 3300005353 Bacteria 1074
11 Ga0070671_100061414 3300005355 Bacteria 3130
12 Ga0070671_100074846 3300005355 Bacteria 2829
13 Ga0070674_100011503 3300005356 Bacteria 5391
14 Ga0070659_100367629 3300005366 Bacteria 1209
15 Ga0070703_10003304 3300005406 Bacteria 4598
16 Ga0070709_10213000 3300005434 Bacteria 1374
17 Ga0070713_100015948 3300005436 Bacteria 5636
18 Ga0070713_100027186 3300005436 Bacteria 4502
19 Ga0070710_10147148 3300005437 Bacteria 1450
20 Ga0070705_100006726 3300005440 Bacteria 5652
21 Ga0070705_100190235 3300005440 Bacteria 1398
22 Ga0070694_100011639 3300005444 Bacteria 5447
23 Ga0070708_100002107 3300005445 Bacteria 15348
24 Ga0070663_100103341 3300005455 Bacteria 2130
25 Ga0070663_100154908 3300005455 Bacteria 1760
26 Ga0070662_100024572 3300005457 Bacteria 4152
27 Ga0070662_100216946 3300005457 Bacteria 1525
28 Ga0070681_10026776 3300005458 Bacteria 5797
29 Ga0070706_100001996 3300005467 Bacteria 21048
30 Ga0070699_100021700 3300005518 Bacteria 5537
31 Ga0070699_100111777 3300005518 Bacteria 2399
32 Ga0070684_100035320 3300005535 Bacteria 4278
33 Ga0070697_100007984 3300005536 Bacteria 8253
34 Ga0070695_100027381 3300005545 Bacteria 3530
35 Ga0070695_100125807 3300005545 Bacteria 1760
36 Ga0070696_100000491 3300005546 Bacteria 24846
37 Ga0070696_100011493 3300005546 Bacteria 5930
38 Ga0070693_100000512 3300005547 Bacteria 17362
39 Ga0070665_100741007 3300005548 Bacteria 996
40 Ga0070704_100025260 3300005549 Bacteria 3909
41 Ga0070704_100078153 3300005549 Bacteria 2426
42 Ga0070704_100266426 3300005549 Bacteria 1413
43 Ga0068855_100024205 3300005563 Bacteria 7268
44 Ga0068855_100040944 3300005563 Bacteria 5494
45 Ga0068857_100141320 3300005577 Bacteria 2176
46 Ga0068856_100148087 3300005614 Bacteria 2355
47 Ga0068856_100226714 3300005614 Bacteria 1884
48 Ga0070702_100016310 3300005615 Bacteria 3808
49 Ga0068859_100001907 3300005617 Bacteria 21260
50 Ga0068859_100352061 3300005617 Bacteria 1567
51 Ga0068864_100002679 3300005618 Bacteria 14689
52 Ga0068866_10173499 3300005718 Bacteria 1268
53 Ga0068861_100015333 3300005719 Bacteria 5398
54 Ga0068861_100171663 3300005719 Bacteria 1798
55 Ga0068858_100195004 3300005842 Bacteria 1914
56 Ga0068862_100126384 3300005844 Bacteria 2258
57 Ga0068862_100132001 3300005844 Bacteria 2210
58 Ga0081455_10048176 3300005937 Bacteria 3684
59 Ga0081538_10015032 3300005981 Bacteria 6020
60 Ga0081540_1000844 3300005983 Bacteria 27897
61 Ga0070717_10305635 3300006028 Bacteria 1414
62 Ga0075368_10073218 3300006042 Bacteria 1386
63 Ga0075362_10047734 3300006177 Bacteria 1908
64 Ga0075366_10002531 3300006195 Bacteria 9396
65 Ga0075366_10050957 3300006195 Bacteria 2459
66 Ga0075366_10074881 3300006195 Bacteria 2019
67 Ga0075366_10155229 3300006195 Bacteria 1386
68 Ga0075370_10009184 3300006353 Bacteria 5120
69 Ga0075370_10132154 3300006353 Bacteria 1457
70 Ga0075370_10181648 3300006353 Bacteria 1238
71 Ga0075431_100026949 3300006847 Bacteria 5895
72 Ga0075433_10004160 3300006852 Bacteria 11232
73 Ga0075433_10251374 3300006852 Bacteria 1568
74 Ga0075434_100244461 3300006871 Bacteria 1814
75 Ga0075429_100071071 3300006880 Bacteria 3030
76 Ga0068865_100031800 3300006881 Bacteria 3521
77 Ga0075436_100003032 3300006914 Bacteria 11506
78 Ga0075436_100271574 3300006914 Bacteria 1211
79 Ga0097620_100001907 3300006931 Bacteria 21260
80 Ga0097620_100352076 3300006931 Bacteria 1567
81 Ga0075435_100021492 3300007076 Bacteria 4964
82 Ga0075435_100058896 3300007076 Bacteria 3112
83 Ga0099794_10003851 3300007265 Bacteria 5805
84 Ga0099794_10005537 3300007265 Bacteria 5070
85 Ga0099794_10046427 3300007265 Bacteria 2080
86 Ga0099794_10052144 3300007265 Bacteria 1971
87 Ga0111539_10040296 3300009094 Bacteria 5625
88 Ga0105238_10380010 3300009551 Bacteria 1404
89 Ga0105249_10010957 3300009553 Bacteria 7969
90 Ga0099796_10059141 3300010159 Bacteria 1353
91 Ga0157369_10198769 3300013105 Bacteria 2105
92 Ga0157378_10319455 3300013297 Bacteria 1508
93 Ga0163162_10701122 3300013306 Bacteria 1134
94 Ga0182008_10007908 3300014497 Bacteria 5833
95 Ga0182008_10019085 3300014497 Bacteria 3544
96 Ga0182008_10109582 3300014497 Bacteria 1368
97 Ga0182007_10066678 3300015262 Bacteria 1179
98 Ga0163161_10068586 3300017792 Bacteria 2591
99 Ga0213876_10002022 3300021384 Bacteria 12093
100 Ga0207653_10010600 3300025885 Bacteria 2877
101 Ga0207653_10022058 3300025885 Bacteria 2022
102 Ga0207682_10006871 3300025893 Bacteria 4567
103 Ga0207699_10011434 3300025906 Bacteria 4483
104 Ga0207684_10002051 3300025910 Bacteria 20743
105 Ga0207649_10284971 3300025920 Bacteria 1202
106 Ga0207652_10436128 3300025921 Bacteria 1181
107 Ga0207681_10163122 3300025923 Bacteria 1682
108 Ga0207650_10036808 3300025925 Bacteria 3562
109 Ga0207700_10087554 3300025928 Bacteria 2450
110 Ga0207664_10278359 3300025929 Bacteria 1468
111 Ga0207644_10182211 3300025931 Bacteria 1647
112 Ga0207644_10398689 3300025931 Unclassified 1124
113 Ga0207706_10181395 3300025933 Bacteria 1849
114 Ga0207704_10023146 3300025938 Bacteria 3343
115 Ga0207679_10000896 3300025945 Bacteria 19003
116 Ga0207679_10093657 3300025945 Bacteria 2330
117 Ga0207679_10101904 3300025945 Bacteria 2247
118 Ga0207667_10030003 3300025949 Bacteria 5889
119 Ga0207667_10219374 3300025949 Bacteria 1949
120 Ga0207712_10018425 3300025961 Bacteria 4547
121 Ga0207712_10489782 3300025961 Bacteria 1049
122 Ga0207668_10025550 3300025972 Bacteria 3824
123 Ga0207640_10012215 3300025981 Bacteria 4887
124 Ga0207658_10244216 3300025986 Bacteria 1523
125 Ga0207678_10094895 3300026067 Bacteria 2549
126 Ga0207702_10119364 3300026078 Bacteria 2358
127 Ga0207641_10000805 3300026088 Bacteria 33568
128 Ga0207641_10427143 3300026088 Bacteria 1277
129 Ga0207676_10015740 3300026095 Bacteria 5466
130 Ga0207674_10377545 3300026116 Bacteria 1370
131 Ga0207675_100040156 3300026118 Bacteria 4368
132 Ga0207675_100204257 3300026118 Bacteria 1898
133 Ga0209588_1009090 3300027671 Bacteria 2961
134 Ga0209588_1012875 3300027671 Bacteria 2545
135 Ga0265354_1000047 3300028016 Bacteria 19816
136 Ga0268265_10047220 3300028380 Bacteria 3225
137 Ga0268264_10132134 3300028381 Bacteria 2214
138 Ga0265337_1012515 3300028556 Bacteria 2881
139 Ga0265338_10013719 3300028800 Bacteria 9114
140 Ga0265338_10069931 3300028800 Bacteria 3013
141 Ga0265324_10000017 3300029957 Bacteria 186448
142 Ga0265324_10000134 3300029957 Bacteria 58308
143 Ga0265770_1002510 3300030878 Bacteria 2490
144 Ga0265760_10016916 3300031090 Bacteria 2094
145 Ga0265332_10041211 3300031238 Bacteria 1998
146 Ga0265339_10000010 3300031249 Bacteria 214721
147 Ga0265313_10003430 3300031595 Bacteria 12830
148 Ga0265313_10031996 3300031595 Bacteria 2691
149 Ga0265342_10072982 3300031712 Bacteria 1997
150 Ga0307414_10081613 3300032004 Bacteria 2368
151 Ga0307414_10518789 3300032004 Bacteria 1057
152 Ga0316212_1001660 3300033547 Bacteria 3068
153 Ga0373926_0005277 3300035083 Bacteria 4253
154 Ga0373941_0014063 3300035115 Bacteria 2131
155 Ga0373945_0090912 3300035116 Bacteria 1182
156 Ga0373953_0017787 3300035117 Bacteria 2619
157 Ga0373954_0018715 3300035118 Bacteria 3120
158 Ga0373956_0009328 3300035119 Bacteria 3990
159 Ga0373956_0030797 3300035119 Bacteria 2347
160 Ga0373943_0113237 3300035170 Bacteria 1433
161 Ga0373955_0007391 3300035172 Bacteria 5049
162 Ga0373955_0011936 3300035172 Bacteria 4162
163 Ga0373924_0048327 3300035410 Bacteria 1757
164 Ga0373935_0025166 3300035692 Bacteria 3668
165 Ga0373935_0132180 3300035692 Bacteria 1678
166 Ga0373927_0000203 3300035695 Bacteria 47593
167 Ga0373927_0040832 3300035695 Bacteria 3009
168 Ga0373927_0048862 3300035695 Bacteria 2736
169 Ga0373933_0253296 3300035724 Bacteria 1134
170 Ga0373947_0016280 3300035725 Bacteria 4274
171 Ga0373947_0029728 3300035725 Bacteria 3207
172 Ga0373947_0050377 3300035725 Bacteria 2504
173 Ga0373937_0001726 3300036401 Bacteria 18377
174 Ga0373937_0059527 3300036401 Bacteria 3510
175 Ga0373937_0173022 3300036401 Bacteria 2026
176 Ga0373937_0280017 3300036401 Bacteria 1575
177 Ga0373925_0001061 3300037068 Bacteria 24808
178 Ga0373925_0001313 3300037068 Bacteria 21772
179 Ga0373925_0058858 3300037068 Bacteria 2881
180 Ga0395900_0060523 3300037418 Unclassified 3897
181 Ga0395898_0154255 3300037466 Bacteria 2197
182 Ga0395905_0015597 3300037471 Bacteria 7219
183 Ga0436364_1305695 3300037853 Bacteria 1177
184 Ga0436365_1319250 3300039437 Bacteria 5395
185 Ga0436363_1278342 3300039450 Bacteria 1823
186 Ga0436363_1446655 3300039450 Bacteria 31959
187 Ga0436362_0615862 3300039453 Bacteria 6368
188 Ga0439462_0015186 3300042015 Bacteria 1984
189 Ga0451577_0112690 3300042876 Bacteria 2434
190 Ga0453683_0298796 3300044673 Bacteria 1030
191 Ga0453684_0006447 3300044712 Bacteria 22282
192 Ga0453684_0041712 3300044712 Bacteria 6199
193 Ga0453684_0048900 3300044712 Bacteria 5584
194 Ga0453684_0169074 3300044712 Bacteria 2578
195 Ga0453684_0282229 3300044712 Bacteria 1893
196 Ga0453684_0440818 3300044712 Bacteria 1451
197 Ga0451576_0051632 3300045051 Bacteria 4311
198 Ga0451576_0188901 3300045051 Bacteria 2151
199 Ga0495592_0001829 3300046454 Bacteria 14953
200 Ga0495592_0014078 3300046454 Bacteria 6077
201 Ga0495592_0053033 3300046454 Bacteria 3008
202 Ga0495592_0200478 3300046454 Bacteria 1347
203 Ga0495629_0013074 3300046459 Bacteria 5998
204 Ga0495629_0124678 3300046459 Bacteria 1794
205 Ga0495651_0000715 3300046462 Bacteria 25766
206 Ga0495651_0002669 3300046462 Bacteria 13850
207 Ga0495651_0038542 3300046462 Bacteria 3721
208 Ga0495653_0001746 3300046463 Bacteria 17141
209 Ga0495653_0005967 3300046463 Bacteria 9971
210 Ga0495580_0002983 3300046472 Bacteria 14519
211 Ga0495580_0039637 3300046472 Unclassified 3370
212 Ga0495639_0003035 3300046475 Bacteria 7310
213 Ga0495662_0082865 3300046476 Bacteria 1561
214 Ga0495664_0019338 3300046477 Bacteria 3915
215 Ga0495584_0066840 3300046491 Bacteria 1808
216 Ga0495608_0001123 3300046511 Bacteria 18953
217 Ga0495608_0006751 3300046511 Bacteria 8136
218 Ga0495618_0052401 3300046514 Bacteria 2579
219 Ga0495618_0193879 3300046514 Bacteria 1287
220 Ga0495628_0008003 3300046516 Bacteria 9109
221 Ga0495628_0137580 3300046516 Bacteria 1865
222 Ga0495630_0010423 3300046517 Bacteria 6710
223 Ga0495630_0220256 3300046517 Bacteria 1449
224 Ga0495666_0002104 3300046526 Bacteria 9870
225 Ga0495652_0001460 3300046529 Bacteria 26134
226 Ga0495652_0025816 3300046529 Bacteria 5193
227 Ga0495652_0109206 3300046529 Bacteria 2227
228 Ga0495640_0003324 3300046533 Bacteria 12942
229 Ga0495640_0176570 3300046533 Bacteria 1363
230 Ga0495586_0009725 3300046535 Bacteria 5121
231 Ga0495587_0002168 3300046536 Bacteria 13144
232 Ga0495587_0066656 3300046536 Bacteria 2099
233 Ga0495587_0135754 3300046536 Bacteria 1405
234 Ga0495645_0003346 3300046543 Bacteria 10866
235 Ga0495645_0046277 3300046543 Bacteria 3171
236 Ga0495645_0061356 3300046543 Bacteria 2724
237 Ga0495622_0019025 3300046557 Bacteria 3199
238 Ga0495634_0007057 3300046642 Bacteria 8475
239 Ga0495634_0144939 3300046642 Bacteria 1505
240 Ga0495635_0007532 3300046663 Bacteria 7598
241 Ga0495635_0173280 3300046663 Bacteria 1467
242 Ga0495657_0002140 3300046675 Bacteria 16770
243 Ga0495657_0221326 3300046675 Bacteria 1147
244 Ga0495599_0066568 3300046678 Bacteria 2250
245 Ga0495599_0070698 3300046678 Bacteria 2178
246 Ga0495623_0006161 3300046679 Bacteria 7797
247 Ga0495623_0156618 3300046679 Bacteria 1342
248 Ga0495646_0022636 3300046680 Bacteria 3962
249 Ga0495646_0163384 3300046680 Bacteria 1231
250 Ga0495658_0006931 3300046683 Bacteria 5588
251 Ga0495658_0067969 3300046683 Bacteria 2062
252 Ga0495613_0088044 3300046689 Bacteria 2250
253 Ga0495613_0302951 3300046689 Bacteria 1106
254 Ga0495624_0058131 3300046690 Bacteria 2430
255 Ga0495600_0001620 3300046809 Bacteria 12555
256 Ga0495600_0021602 3300046809 Bacteria 4124
257 Ga0495581_0106647 3300047315 Bacteria 1628
258 Ga0495604_0001080 3300047317 Bacteria 22616
259 Ga0495604_0029620 3300047317 Bacteria 4355
260 Ga0495604_0115538 3300047317 Bacteria 1950
261 Ga0495674_0005261 3300047319 Bacteria 12412
262 Ga0495674_0045418 3300047319 Bacteria 3901
263 Ga0495674_0063712 3300047319 Bacteria 3206
264 Ga0495674_0096281 3300047319 Bacteria 2523
265 Ga0495674_0277622 3300047319 Bacteria 1373
266 Ga0495676_0190584 3300047321 Bacteria 1430
267 Ga0495680_0001734 3300047322 Bacteria 23164
268 Ga0495680_0004094 3300047322 Bacteria 14039
269 Ga0495680_0080216 3300047322 Bacteria 2466
270 Ga0495675_0000121 3300047444 Bacteria 56852
271 Ga0495675_0111751 3300047444 Bacteria 1705
272 Ga0495684_0021984 3300047471 Bacteria 4910
273 Ga0495684_0026222 3300047471 Bacteria 4478
274 Ga0495593_0068387 3300047673 Bacteria 1848
275 Ga0495602_0002431 3300048088 Bacteria 18968
276 Ga0495602_0013155 3300048088 Bacteria 8466
277 Ga0495602_0043626 3300048088 Bacteria 4075
278 Ga0496101_0009503 3300048904 Bacteria 6391
279 Ga0496102_0140518 3300048905 Bacteria 2264
280 Ga0496104_0540301 3300048907 Bacteria 1076
281 Ga0496105_0062305 3300048908 Bacteria 3078
282 Ga0496106_0038736 3300048909 Bacteria 3569
283 Ga0496107_0018320 3300048910 Bacteria 4930
284 Ga0496114_0117077 3300048917 Bacteria 2288
285 Ga0496115_0145278 3300048918 Bacteria 1957
286 Ga0496115_0368598 3300048918 Bacteria 1169
287 Ga0501067_0032878 3300049583 Bacteria 2879
288 Ga0501080_0117978 3300049742 Bacteria 2460
289 Ga0501044_0048114 3300049823 Bacteria 4407
290 nmdc:mga03683_50214_c1 3300050489 Bacteria 1738
291 nmdc:mga03n38_134684_c1 3300050490 Bacteria 1228
292 nmdc:mga00v17_232455_c1 3300050491 Bacteria 1195
293 nmdc:mga00v17_37960_c1 3300050491 Bacteria 2878
294 nmdc:mga0k408_15890_c1 3300050493 Bacteria 4168
295 nmdc:mga0k408_60737_c1 3300050493 Bacteria 2197
296 nmdc:mga0k408_69370_c1 3300050493 Bacteria 2057
297 nmdc:mga06z11_20306_c1 3300050494 Bacteria 3069
298 nmdc:mga06z11_72700_c1 3300050494 Bacteria 1824
299 nmdc:mga07m45_187348_c1 3300050496 Bacteria 1203
300 nmdc:mga07m45_25339_c2 3300050496 Bacteria 2701
301 nmdc:mga07m45_3241_c1 3300050496 Bacteria 7816
302 nmdc:mga07m45_63683_c1 3300050496 Bacteria 2091
303 nmdc:mga06r32_33703_c1 3300050510 Bacteria 4824
304 nmdc:mga08y16_99843_c1 3300050511 Bacteria 3022
305 nmdc:mga0n895_239043_c1 3300050512 Bacteria 1843
306 nmdc:mga0n895_94613_c1 3300050512 Bacteria 2992
307 nmdc:mga0rr50_226775_c1 3300050513 Bacteria 1545
308 nmdc:mga08x19_46597_c1 3300050514 Bacteria 2773
309 nmdc:mga08x19_603_c1 3300050514 Bacteria 23312
310 nmdc:mga0a205_79017_c1 3300050515 Bacteria 3179
311 Ga0495601_0040832 3300053077 Bacteria 2906
312 Ga0495601_0159980 3300053077 Bacteria 1471
313 Ga0495612_0012516 3300053078 Bacteria 3420
314 Ga0495595_0008731 3300053084 Bacteria 4170
315 Ga0495595_0026021 3300053084 Bacteria 2596
316 Ga0495619_0029943 3300053085 Bacteria 3520
317 Ga0501082_0242778 3300060353 Bacteria 1567
318 3002999402 3002998708 Bacteria 11715108
319 Ga0501080_0487556
320 JGI25404J52841_10014988
321 Ga0070670_100039687
322 Ga0068869_100054377
323 Ga0070680_100049732
324 Ga0070689_100252627
325 Ga0070689_100310296
326 Ga0070691_10071860
327 Ga0070668_100044508
328 Ga0070669_100439214
329 Ga0070671_100061414
330 Ga0070671_100074846
331 Ga0070674_100011503
332 Ga0070659_100367629
333 Ga0070703_10003304
334 Ga0070709_10213000
335 Ga0070713_100015948
336 Ga0070713_100027186
337 Ga0070710_10147148
338 Ga0070705_100006726
339 Ga0070705_100190235
340 Ga0070694_100011639
341 Ga0070708_100002107
342 Ga0070663_100103341
343 Ga0070663_100154908
344 Ga0070662_100024572
345 Ga0070662_100216946
346 Ga0070681_10026776
347 Ga0070706_100001996
348 Ga0070699_100021700
349 Ga0070699_100111777
350 Ga0070684_100035320
351 Ga0070697_100007984
352 Ga0070695_100027381
353 Ga0070695_100125807
354 Ga0070696_100000491
355 Ga0070696_100011493
356 Ga0070693_100000512
357 Ga0070665_100741007
358 Ga0070704_100025260
359 Ga0070704_100078153
360 Ga0070704_100266426
361 Ga0068855_100024205
362 Ga0068855_100040944
363 Ga0068857_100141320
364 Ga0068856_100148087
365 Ga0068856_100226714
366 Ga0070702_100016310
367 Ga0068859_100001907
368 Ga0068859_100352061
369 Ga0068864_100002679
370 Ga0068866_10173499
371 Ga0068861_100015333
372 Ga0068861_100171663
373 Ga0068858_100195004
374 Ga0068862_100126384
375 Ga0068862_100132001
376 Ga0081455_10048176
377 Ga0081538_10015032
378 Ga0081540_1000844
379 Ga0070717_10305635
380 Ga0075368_10073218
381 Ga0075362_10047734
382 Ga0075366_10002531
383 Ga0075366_10050957
384 Ga0075366_10074881
385 Ga0075366_10155229
386 Ga0075370_10009184
387 Ga0075370_10132154
388 Ga0075370_10181648
389 Ga0075431_100026949
390 Ga0075433_10004160
391 Ga0075433_10251374
392 Ga0075434_100244461
393 Ga0075429_100071071
394 Ga0068865_100031800
395 Ga0075436_100003032
396 Ga0075436_100271574
397 Ga0097620_100001907
398 Ga0097620_100352076
399 Ga0075435_100021492
400 Ga0075435_100058896
401 Ga0099794_10003851
402 Ga0099794_10005537
403 Ga0099794_10046427
404 Ga0099794_10052144
405 Ga0111539_10040296
406 Ga0105238_10380010
407 Ga0105249_10010957
408 Ga0099796_10059141
409 Ga0157369_10198769
410 Ga0157378_10319455
411 Ga0163162_10701122
412 Ga0182008_10007908
413 Ga0182008_10019085
414 Ga0182008_10109582
415 Ga0182007_10066678
416 Ga0163161_10068586
417 Ga0213876_10002022
418 Ga0207653_10010600
419 Ga0207653_10022058
420 Ga0207682_10006871
421 Ga0207699_10011434
422 Ga0207684_10002051
423 Ga0207649_10284971
424 Ga0207652_10436128
425 Ga0207681_10163122
426 Ga0207650_10036808
427 Ga0207700_10087554
428 Ga0207664_10278359
429 Ga0207644_10182211
430 Ga0207644_10398689
431 Ga0207706_10181395
432 Ga0207704_10023146
433 Ga0207679_10000896
434 Ga0207679_10093657
435 Ga0207679_10101904
436 Ga0207667_10030003
437 Ga0207667_10219374
438 Ga0207712_10018425
439 Ga0207712_10489782
440 Ga0207668_10025550
441 Ga0207640_10012215
442 Ga0207658_10244216
443 Ga0207678_10094895
444 Ga0207702_10119364
445 Ga0207641_10000805
446 Ga0207641_10427143
447 Ga0207676_10015740
448 Ga0207674_10377545
449 Ga0207675_100040156
450 Ga0207675_100204257
451 Ga0209588_1009090
452 Ga0209588_1012875
453 Ga0265354_1000047
454 Ga0268265_10047220
455 Ga0268264_10132134
456 Ga0265337_1012515
457 Ga0265338_10013719
458 Ga0265338_10069931
459 Ga0265324_10000017
460 Ga0265324_10000134
461 Ga0265770_1002510
462 Ga0265760_10016916
463 Ga0265332_10041211
464 Ga0265339_10000010
465 Ga0265313_10003430
466 Ga0265313_10031996
467 Ga0265342_10072982
468 Ga0307414_10081613
469 Ga0307414_10518789
470 Ga0316212_1001660
471 Ga0373926_0005277
472 Ga0373941_0014063
473 Ga0373945_0090912
474 Ga0373953_0017787
475 Ga0373954_0018715
476 Ga0373956_0009328
477 Ga0373956_0030797
478 Ga0373943_0113237
479 Ga0373955_0007391
480 Ga0373955_0011936
481 Ga0373924_0048327
482 Ga0373935_0025166
483 Ga0373935_0132180
484 Ga0373927_0000203
485 Ga0373927_0040832
486 Ga0373927_0048862
487 Ga0373933_0253296
488 Ga0373947_0016280
489 Ga0373947_0029728
490 Ga0373947_0050377
491 Ga0373937_0001726
492 Ga0373937_0059527
493 Ga0373937_0173022
494 Ga0373937_0280017
495 Ga0373925_0001061
496 Ga0373925_0001313
497 Ga0373925_0058858
498 Ga0395900_0060523
499 Ga0395898_0154255
500 Ga0395905_0015597
501 Ga0436364_1305695
502 Ga0436365_1319250
503 Ga0436363_1278342
504 Ga0436363_1446655
505 Ga0436362_0615862
506 Ga0439462_0015186
507 Ga0451577_0112690
508 Ga0453683_0298796
509 Ga0453684_0006447
510 Ga0453684_0041712
511 Ga0453684_0048900
512 Ga0453684_0169074
513 Ga0453684_0282229
514 Ga0453684_0440818
515 Ga0451576_0051632
516 Ga0451576_0188901
517 Ga0495592_0001829
518 Ga0495592_0014078
519 Ga0495592_0053033
520 Ga0495592_0200478
521 Ga0495629_0013074
522 Ga0495629_0124678
523 Ga0495651_0000715
524 Ga0495651_0002669
525 Ga0495651_0038542
526 Ga0495653_0001746
527 Ga0495653_0005967
528 Ga0495580_0002983
529 Ga0495580_0039637
530 Ga0495639_0003035
531 Ga0495662_0082865
532 Ga0495664_0019338
533 Ga0495584_0066840
534 Ga0495608_0001123
535 Ga0495608_0006751
536 Ga0495618_0052401
537 Ga0495618_0193879
538 Ga0495628_0008003
539 Ga0495628_0137580
540 Ga0495630_0010423
541 Ga0495630_0220256
542 Ga0495666_0002104
543 Ga0495652_0001460
544 Ga0495652_0025816
545 Ga0495652_0109206
546 Ga0495640_0003324
547 Ga0495640_0176570
548 Ga0495586_0009725
549 Ga0495587_0002168
550 Ga0495587_0066656
551 Ga0495587_0135754
552 Ga0495645_0003346
553 Ga0495645_0046277
554 Ga0495645_0061356
555 Ga0495622_0019025
556 Ga0495634_0007057
557 Ga0495634_0144939
558 Ga0495635_0007532
559 Ga0495635_0173280
560 Ga0495657_0002140
561 Ga0495657_0221326
562 Ga0495599_0066568
563 Ga0495599_0070698
564 Ga0495623_0006161
565 Ga0495623_0156618
566 Ga0495646_0022636
567 Ga0495646_0163384
568 Ga0495658_0006931
569 Ga0495658_0067969
570 Ga0495613_0088044
571 Ga0495613_0302951
572 Ga0495624_0058131
573 Ga0495600_0001620
574 Ga0495600_0021602
575 Ga0495581_0106647
576 Ga0495604_0001080
577 Ga0495604_0029620
578 Ga0495604_0115538
579 Ga0495674_0005261
580 Ga0495674_0045418
581 Ga0495674_0063712
582 Ga0495674_0096281
583 Ga0495674_0277622
584 Ga0495676_0190584
585 Ga0495680_0001734
586 Ga0495680_0004094
587 Ga0495680_0080216
588 Ga0495675_0000121
589 Ga0495675_0111751
590 Ga0495684_0021984
591 Ga0495684_0026222
592 Ga0495593_0068387
593 Ga0495602_0002431
594 Ga0495602_0013155
595 Ga0495602_0043626
596 Ga0496101_0009503
597 Ga0496102_0140518
598 Ga0496104_0540301
599 Ga0496105_0062305
600 Ga0496106_0038736
601 Ga0496107_0018320
602 Ga0496114_0117077
603 Ga0496115_0145278
604 Ga0496115_0368598
605 Ga0501067_0032878
606 Ga0501080_0117978
607 Ga0501044_0048114
608 nmdc:mga03683_50214_c1
609 nmdc:mga03n38_134684_c1
610 nmdc:mga00v17_232455_c1
611 nmdc:mga00v17_37960_c1
612 nmdc:mga0k408_15890_c1
613 nmdc:mga0k408_60737_c1
614 nmdc:mga0k408_69370_c1
615 nmdc:mga06z11_20306_c1
616 nmdc:mga06z11_72700_c1
617 nmdc:mga07m45_187348_c1
618 nmdc:mga07m45_25339_c2
619 nmdc:mga07m45_3241_c1
620 nmdc:mga07m45_63683_c1
621 nmdc:mga06r32_33703_c1
622 nmdc:mga08y16_99843_c1
623 nmdc:mga0n895_239043_c1
624 nmdc:mga0n895_94613_c1
625 nmdc:mga0rr50_226775_c1
626 nmdc:mga08x19_46597_c1
627 nmdc:mga08x19_603_c1
628 nmdc:mga0a205_79017_c1
629 Ga0495601_0040832
630 Ga0495601_0159980
631 Ga0495612_0012516
632 Ga0495595_0008731
633 Ga0495595_0026021
634 Ga0495619_0029943
635 Ga0501082_0242778
636 3002999402

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03976

PPK2

Polyphosphate kinase 2 (PPK2)

75

315

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bmm-assembly2.cif.gz_C crystal structure of polyphosphate kinase 2 from deinococcus radiodurans in apo form 0.9711 7 276
5o6m-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9655 9 273
5lcd-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber bound to amp 0.9646 8 273
5o6k-assembly1.cif.gz_C structure of polyphosphate kinase from meiothermus ruber n121d 0.9575 8 273
5lcd-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber bound to amp 0.9572 8 273
ID Description Score Start End Superfamily
6aqeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.971 7 276 3.40.50.300
5ldbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9494 8 278 3.40.50.300
3czpB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9435 20 268 3.40.50.300
5ldbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9423 8 278 3.40.50.300
6angA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9399 2 292 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A5S4TB79-F1-model_v4 Polyphosphate kinase 2 family protein 0.9956 83 220 GO:0016301
AF-A0A2V5T7V4-F1-model_v4 Polyphosphate kinase-2-related domain-containing protein 0.9912 80 178
AF-A0A7V2ZH84-F1-model_v4 Polyphosphate kinase 2 family protein 0.9901 7 292 GO:0006797
GO:0008976
AF-A0A6J4IQ59-F1-model_v4 Polyphosphate kinase 2 0.9899 2 292 GO:0006797
GO:0008976
AF-A0A6P0ZQI7-F1-model_v4 deleted 0.9876 35 292

Map