F404789

General Info

Members Datasets Scaffolds Average Seq Length
318 153 636 348

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0000077|Ga0496114_0000077_59159_60277
Length 372
Sequence MSRASTIKNFKKNIHAIFQSTNLIIMKKLLLLFALTILVVQGYAKPRIIILATGGTIAGSGASASRAGYTAGKIPIEDLIGAIPAAKDVADISGEQIASVGSQDMTIDIWKKLAMRANEIAAKGEADGIVVTHGTDTQEETAYFLDLVCGVNIPIVLTGSMRPATAISADGPKNLYDAITCAADPKSKGRGVIVSFNEGLYDGRDVMKMSTTKTNAFGSPNTGAIGQVYDGKVEYYANSIRGVGNKSPFNINTNTTLPRVDIVYMYADASGDMIDYLVSKKVAGIVIAGVGNGNFNKAYTEAVKRAVAAGVIVCRASRAPSGRVVLHDEINDDELGTIVSDDLTPQKARVLLMLALTQTKNKKQLQDYFFKY

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
123 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
142 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
143 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
144 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
145 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
146 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
147 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
148 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
149 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
150 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
151 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
152 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
153 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.23
Metatranscriptomes 0.31
Isolates 3.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.26
Nodule 0.94
Rhizoplane 1.57
Rhizosphere 94.65
Stem 0
Stem Tuber 0
Unclassified 11.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0000077 3300048917 Bacteria 70285
2 Ga0058862_12839656 3300004803 Unclassified 2726
3 Ga0065714_10002588 3300005288 Bacteria 44774
4 Ga0065714_10128316 3300005288 Bacteria 1274
5 Ga0065712_10018465 3300005290 Bacteria 1944
6 Ga0065712_10069502 3300005290 Bacteria 7161
7 Ga0065712_10148619 3300005290 Bacteria 1388
8 Ga0065715_10009130 3300005293 Bacteria 3910
9 Ga0065715_10232013 3300005293 Bacteria 1230
10 Ga0070658_10017340 3300005327 Bacteria 5763
11 Ga0070676_10002371 3300005328 Bacteria 9643
12 Ga0070683_100062488 3300005329 Bacteria 3463
13 Ga0070683_100075601 3300005329 Bacteria 3147
14 Ga0070683_100314690 3300005329 Bacteria 1490
15 Ga0070670_100016918 3300005331 Bacteria 6260
16 Ga0070670_100242637 3300005331 Bacteria 1569
17 Ga0068869_100087785 3300005334 Unclassified 2333
18 Ga0070666_10003631 3300005335 Bacteria 9357
19 Ga0070682_100034529 3300005337 Bacteria 3081
20 Ga0068868_100008344 3300005338 Bacteria 7415
21 Ga0068868_100121404 3300005338 Unclassified 2132
22 Ga0068868_100160432 3300005338 Bacteria 1857
23 Ga0070689_100244883 3300005340 Bacteria 1478
24 Ga0070689_100279253 3300005340 Bacteria 1385
25 Ga0070661_100000796 3300005344 Bacteria 22660
26 Ga0070661_100282092 3300005344 Bacteria 1289
27 Ga0070668_100007431 3300005347 Bacteria 8132
28 Ga0070675_100077701 3300005354 Bacteria 2763
29 Ga0070675_100176125 3300005354 Bacteria 1847
30 Ga0070671_100031808 3300005355 Bacteria 4362
31 Ga0070671_100047173 3300005355 Bacteria 3583
32 Ga0070671_100112655 3300005355 Bacteria 2285
33 Ga0070674_100039619 3300005356 Unclassified 3183
34 Ga0070673_100022659 3300005364 Bacteria 4575
35 Ga0070673_100056277 3300005364 Bacteria 3102
36 Ga0070673_100144818 3300005364 Bacteria 2008
37 Ga0070673_100174912 3300005364 Bacteria 1834
38 Ga0070673_100215515 3300005364 Bacteria 1660
39 Ga0070673_100326909 3300005364 Bacteria 1356
40 Ga0070688_100017749 3300005365 Bacteria 4089
41 Ga0070688_100023499 3300005365 Bacteria 3627
42 Ga0070659_100140445 3300005366 Bacteria 1966
43 Ga0070667_100003221 3300005367 Bacteria 13980
44 Ga0070667_100074401 3300005367 Bacteria 2898
45 Ga0070667_100222981 3300005367 Bacteria 1679
46 Ga0070714_100326890 3300005435 Bacteria 1435
47 Ga0070700_100127196 3300005441 Bacteria 1715
48 Ga0070662_100014835 3300005457 Bacteria 5210
49 Ga0070662_100206174 3300005457 Bacteria 1562
50 Ga0070685_10003810 3300005466 Bacteria 7629
51 Ga0070685_10106616 3300005466 Bacteria 1719
52 Ga0070679_100115905 3300005530 Bacteria 2664
53 Ga0070679_100235260 3300005530 Unclassified 1791
54 Ga0070684_100010766 3300005535 Bacteria 7262
55 Ga0070684_100018128 3300005535 Bacteria 5792
56 Ga0070684_100145931 3300005535 Bacteria 2142
57 Ga0068853_100011339 3300005539 Bacteria 7239
58 Ga0070672_100003913 3300005543 Bacteria 9702
59 Ga0070665_100019113 3300005548 Bacteria 6873
60 Ga0070664_100000744 3300005564 Bacteria 25104
61 Ga0070664_100014895 3300005564 Bacteria 6344
62 Ga0070664_100218309 3300005564 Unclassified 1705
63 Ga0068857_100032248 3300005577 Bacteria 4633
64 Ga0068857_100355085 3300005577 Unclassified 1358
65 Ga0068852_100071782 3300005616 Unclassified 3041
66 Ga0068852_100344477 3300005616 Bacteria 1453
67 Ga0068859_100018920 3300005617 Bacteria 6918
68 Ga0068859_100149955 3300005617 Unclassified 2407
69 Ga0068859_100159702 3300005617 Unclassified 2333
70 Ga0068864_100002018 3300005618 Bacteria 16744
71 Ga0068861_100017609 3300005719 Bacteria 5076
72 Ga0068861_100018041 3300005719 Bacteria 5019
73 Ga0068861_100022434 3300005719 Bacteria 4548
74 Ga0068851_10000071 3300005834 Bacteria 57578
75 Ga0068851_10007284 3300005834 Bacteria 5073
76 Ga0068863_100000546 3300005841 Bacteria 38297
77 Ga0068863_100170596 3300005841 Bacteria 2087
78 Ga0068858_100012490 3300005842 Bacteria 8011
79 Ga0068858_100095185 3300005842 Bacteria 2774
80 Ga0068860_100000650 3300005843 Bacteria 40578
81 Ga0068860_100011007 3300005843 Bacteria 8919
82 Ga0068862_100039803 3300005844 Bacteria 3994
83 Ga0068862_100128513 3300005844 Bacteria 2239
84 Ga0068862_100276102 3300005844 Bacteria 1538
85 Ga0097621_100004280 3300006237 Bacteria 9912
86 Ga0097621_100010632 3300006237 Bacteria 6743
87 Ga0097621_100013452 3300006237 Bacteria 6100
88 Ga0097621_100030417 3300006237 Bacteria 4274
89 Ga0097621_100352786 3300006237 Bacteria 1309
90 Ga0068871_100007121 3300006358 Bacteria 7973
91 Ga0068871_100023835 3300006358 Unclassified 4740
92 Ga0068871_100122819 3300006358 Bacteria 2195
93 Ga0068871_100390345 3300006358 Bacteria 1238
94 Ga0075428_100025299 3300006844 Bacteria 6570
95 Ga0075428_100035086 3300006844 Bacteria 5529
96 Ga0075428_100403121 3300006844 Unclassified 1466
97 Ga0068865_100007558 3300006881 Bacteria 6689
98 Ga0097620_100018922 3300006931 Bacteria 6918
99 Ga0097620_100149969 3300006931 Unclassified 2407
100 Ga0097620_100159703 3300006931 Unclassified 2333
101 Ga0099824_1019851 3300006942 Bacteria 5102
102 Ga0099826_10052977 3300006948 Bacteria 2705
103 Ga0105240_10107607 3300009093 Unclassified 3380
104 Ga0111539_10004821 3300009094 Bacteria 17583
105 Ga0111539_10011263 3300009094 Bacteria 11237
106 Ga0111539_10027751 3300009094 Bacteria 6915
107 Ga0111539_10349609 3300009094 Bacteria 1721
108 Ga0105247_10010817 3300009101 Bacteria 5510
109 Ga0105242_10004177 3300009176 Bacteria 11252
110 Ga0105242_10042218 3300009176 Bacteria 3682
111 Ga0105242_10080883 3300009176 Bacteria 2716
112 Ga0105248_10029679 3300009177 Bacteria 6101
113 Ga0105248_10035227 3300009177 Bacteria 5599
114 Ga0105249_10006716 3300009553 Bacteria 10022
115 Ga0105249_10036265 3300009553 Unclassified 4473
116 Ga0105249_10065884 3300009553 Bacteria 3333
117 Ga0105249_10114654 3300009553 Bacteria 2552
118 Ga0105249_10314012 3300009553 Bacteria 1577
119 Ga0105249_10425188 3300009553 Unclassified 1363
120 Ga0105246_10197273 3300011119 Bacteria 1562
121 Ga0157371_10018172 3300013102 Bacteria 5206
122 Ga0157371_10085119 3300013102 Bacteria 2240
123 Ga0157370_10410090 3300013104 Bacteria 1247
124 Ga0157374_10006607 3300013296 Bacteria 9853
125 Ga0157374_10092284 3300013296 Bacteria 2889
126 Ga0157374_10121139 3300013296 Bacteria 2525
127 Ga0157378_10013201 3300013297 Bacteria 7224
128 Ga0157378_10072156 3300013297 Bacteria 3102
129 Ga0157378_10085796 3300013297 Bacteria 2853
130 Ga0157378_10252377 3300013297 Bacteria 1689
131 Ga0163162_10000157 3300013306 Bacteria 62611
132 Ga0163162_10000715 3300013306 Bacteria 30803
133 Ga0163162_10003946 3300013306 Bacteria 14228
134 Ga0163162_10030872 3300013306 Bacteria 5311
135 Ga0163162_10031211 3300013306 Bacteria 5285
136 Ga0163162_10104489 3300013306 Bacteria 2927
137 Ga0163162_10243247 3300013306 Bacteria 1930
138 Ga0163162_10260461 3300013306 Bacteria 1866
139 Ga0163162_10302837 3300013306 Unclassified 1731
140 Ga0163162_10353288 3300013306 Bacteria 1602
141 Ga0163162_10372913 3300013306 Bacteria 1560
142 Ga0157372_10221845 3300013307 Bacteria 2191
143 Ga0157372_10280366 3300013307 Bacteria 1938
144 Ga0157375_10000462 3300013308 Bacteria 37001
145 Ga0157375_10002492 3300013308 Bacteria 15952
146 Ga0157375_10011455 3300013308 Bacteria 7831
147 Ga0157375_10108032 3300013308 Bacteria 2876
148 Ga0157375_10179586 3300013308 Bacteria 2268
149 Ga0157375_10328263 3300013308 Bacteria 1695
150 Ga0163163_10000495 3300014325 Bacteria 35470
151 Ga0163163_10007299 3300014325 Bacteria 9748
152 Ga0163163_10011747 3300014325 Bacteria 7957
153 Ga0163163_10089737 3300014325 Bacteria 3086
154 Ga0163163_10162100 3300014325 Bacteria 2282
155 Ga0157380_10000008 3300014326 Bacteria 154993
156 Ga0157380_10000248 3300014326 Bacteria 32510
157 Ga0157380_10004239 3300014326 Bacteria 9919
158 Ga0157380_10007880 3300014326 Bacteria 7580
159 Ga0157377_10054948 3300014745 Bacteria 2256
160 Ga0157377_10078918 3300014745 Bacteria 1919
161 Ga0157379_10004827 3300014968 Bacteria 11587
162 Ga0157379_10009301 3300014968 Bacteria 8558
163 Ga0157379_10078437 3300014968 Bacteria 2958
164 Ga0157379_10093876 3300014968 Bacteria 2692
165 Ga0157379_10389135 3300014968 Bacteria 1280
166 Ga0157376_10000068 3300014969 Bacteria 83824
167 Ga0157376_10011965 3300014969 Bacteria 6417
168 Ga0157376_10055465 3300014969 Bacteria 3307
169 Ga0157376_10058149 3300014969 Bacteria 3238
170 Ga0157376_10217834 3300014969 Bacteria 1766
171 Ga0182006_1062100 3300015261 Bacteria 1407
172 Ga0163161_10039839 3300017792 Bacteria 3374
173 Ga0163161_10071051 3300017792 Unclassified 2546
174 Ga0163161_10100961 3300017792 Bacteria 2148
175 Ga0209050_1001521 3300025298 Bacteria 24443
176 Ga0209050_1001762 3300025298 Bacteria 21409
177 Ga0207697_10128470 3300025315 Unclassified 1094
178 Ga0207656_10000891 3300025321 Bacteria 9745
179 Ga0207656_10003284 3300025321 Bacteria 5543
180 Ga0207680_10002930 3300025903 Bacteria 7999
181 Ga0207645_10028042 3300025907 Bacteria 3635
182 Ga0207643_10165570 3300025908 Bacteria 1332
183 Ga0207705_10044792 3300025909 Bacteria 3180
184 Ga0207695_10237591 3300025913 Unclassified 1724
185 Ga0207657_10024723 3300025919 Bacteria 5554
186 Ga0207649_10001731 3300025920 Bacteria 12538
187 Ga0207649_10033510 3300025920 Bacteria 3070
188 Ga0207652_10107948 3300025921 Bacteria 2466
189 Ga0207652_10216597 3300025921 Unclassified 1725
190 Ga0207650_10002302 3300025925 Bacteria 13311
191 Ga0207650_10136591 3300025925 Bacteria 1924
192 Ga0207650_10357782 3300025925 Bacteria 1202
193 Ga0207659_10030438 3300025926 Bacteria 3689
194 Ga0207644_10141819 3300025931 Bacteria 1851
195 Ga0207644_10288661 3300025931 Bacteria 1319
196 Ga0207690_10048598 3300025932 Bacteria 2822
197 Ga0207690_10172970 3300025932 Bacteria 1619
198 Ga0207706_10101131 3300025933 Unclassified 2536
199 Ga0207706_10138401 3300025933 Bacteria 2142
200 Ga0207706_10230413 3300025933 Bacteria 1621
201 Ga0207686_10003174 3300025934 Bacteria 8849
202 Ga0207686_10044727 3300025934 Bacteria 2721
203 Ga0207670_10005786 3300025936 Bacteria 6824
204 Ga0207670_10150040 3300025936 Bacteria 1729
205 Ga0207704_10018784 3300025938 Unclassified 3617
206 Ga0207691_10007144 3300025940 Bacteria 10774
207 Ga0207691_10105390 3300025940 Bacteria 2512
208 Ga0207689_10006265 3300025942 Bacteria 10543
209 Ga0207689_10040978 3300025942 Bacteria 3832
210 Ga0207661_10006953 3300025944 Bacteria 8022
211 Ga0207661_10124126 3300025944 Bacteria 2203
212 Ga0207661_10160322 3300025944 Bacteria 1951
213 Ga0207679_10000182 3300025945 Bacteria 51887
214 Ga0207679_10008176 3300025945 Bacteria 6658
215 Ga0207679_10024132 3300025945 Bacteria 4166
216 Ga0207679_10162971 3300025945 Bacteria 1827
217 Ga0207651_10010521 3300025960 Bacteria 5131
218 Ga0207651_10029328 3300025960 Bacteria 3485
219 Ga0207651_10030406 3300025960 Bacteria 3438
220 Ga0207651_10056446 3300025960 Bacteria 2703
221 Ga0207712_10005733 3300025961 Bacteria 7827
222 Ga0207712_10041334 3300025961 Bacteria 3168
223 Ga0207668_10005254 3300025972 Bacteria 7618
224 Ga0207658_10004407 3300025986 Bacteria 9790
225 Ga0207658_10005373 3300025986 Bacteria 8796
226 Ga0207658_10079133 3300025986 Bacteria 2514
227 Ga0207658_10312058 3300025986 Bacteria 1359
228 Ga0207677_10002812 3300026023 Bacteria 9181
229 Ga0207677_10144528 3300026023 Bacteria 1826
230 Ga0207703_10014942 3300026035 Bacteria 6057
231 Ga0207703_10237689 3300026035 Bacteria 1636
232 Ga0207639_10459415 3300026041 Bacteria 1157
233 Ga0207678_10049431 3300026067 Bacteria 3634
234 Ga0207708_10085386 3300026075 Bacteria 2428
235 Ga0207708_10185403 3300026075 Unclassified 1653
236 Ga0207641_10000539 3300026088 Bacteria 42499
237 Ga0207641_10021203 3300026088 Bacteria 5341
238 Ga0207641_10185106 3300026088 Bacteria 1910
239 Ga0207648_10035648 3300026089 Bacteria 4383
240 Ga0207648_10214841 3300026089 Bacteria 1708
241 Ga0207676_10002997 3300026095 Bacteria 12039
242 Ga0207676_10037491 3300026095 Bacteria 3695
243 Ga0207676_10201762 3300026095 Archaea 1758
244 Ga0207676_10378923 3300026095 Unclassified 1316
245 Ga0207674_10046074 3300026116 Bacteria 4480
246 Ga0207674_10063818 3300026116 Bacteria 3716
247 Ga0207674_10093214 3300026116 Bacteria 3001
248 Ga0207674_10123968 3300026116 Bacteria 2549
249 Ga0207674_10437141 3300026116 Bacteria 1265
250 Ga0207675_100080073 3300026118 Unclassified 3062
251 Ga0207675_100092657 3300026118 Bacteria 2842
252 Ga0207675_100180480 3300026118 Bacteria 2021
253 Ga0207683_10094624 3300026121 Bacteria 2663
254 Ga0207683_10116702 3300026121 Bacteria 2393
255 Ga0207683_10330495 3300026121 Bacteria 1397
256 Ga0207698_10447873 3300026142 Bacteria 1246
257 Ga0209282_1111477 3300027666 Bacteria 1387
258 Ga0207428_10144782 3300027907 Bacteria 1812
259 Ga0268266_10009793 3300028379 Bacteria 8430
260 Ga0268265_10084056 3300028380 Bacteria 2522
261 Ga0268265_10114963 3300028380 Bacteria 2205
262 Ga0268264_10000809 3300028381 Bacteria 33699
263 Ga0268264_10006080 3300028381 Bacteria 10200
264 Ga0268264_10254505 3300028381 Bacteria 1633
265 Ga0265327_10000055 3300031251 Bacteria 247188
266 Ga0307414_10031741 3300032004 Bacteria 3469
267 Ga0307414_10109012 3300032004 Unclassified 2102
268 Ga0307414_10177067 3300032004 Bacteria 1711
269 Ga0307414_10194471 3300032004 Bacteria 1644
270 Ga0373947_0131743 3300035725 Unclassified 1597
271 Ga0373937_0152378 3300036401 Unclassified 2166
272 Ga0373937_0198299 3300036401 Bacteria 1887
273 Ga0395900_0199712 3300037418 Bacteria 2024
274 Ga0395905_0002208 3300037471 Bacteria 21964
275 Ga0439431_0009031 3300041997 Bacteria 2247
276 Ga0439445_0005758 3300042004 Bacteria 2831
277 Ga0451577_0034384 3300042876 Bacteria 4568
278 Ga0453683_0007719 3300044673 Bacteria 7279
279 Ga0453683_0028045 3300044673 Bacteria 3566
280 Ga0453683_0048880 3300044673 Bacteria 2652
281 Ga0453684_0002019 3300044712 Bacteria 51893
282 Ga0453684_0099846 3300044712 Bacteria 3554
283 Ga0453684_0150503 3300044712 Bacteria 2766
284 Ga0453684_0407140 3300044712 Bacteria 1522
285 Ga0453684_0503841 3300044712 Unclassified 1340
286 Ga0466959_0031189 3300045049 Unclassified 3945
287 Ga0451576_0005922 3300045051 Bacteria 15144
288 Ga0451576_0011062 3300045051 Bacteria 10301
289 Ga0451576_0066912 3300045051 Bacteria 3740
290 Ga0495638_0000008 3300046460 Bacteria 565643
291 Ga0495647_0052637 3300046681 Bacteria 1586
292 Ga0495613_0222156 3300046689 Bacteria 1326
293 Ga0495674_0117839 3300047319 Bacteria 2246
294 Ga0495676_0226143 3300047321 Unclassified 1287
295 Ga0495684_0078477 3300047471 Bacteria 2506
296 Ga0496100_0199642 3300048903 Bacteria 1457
297 Ga0496109_0050008 3300048912 Unclassified 3808
298 Ga0496111_0159832 3300048914 Bacteria 1673
299 Ga0496115_0021446 3300048918 Bacteria 4992
300 Ga0496125_0004055 3300048928 Bacteria 17152
301 nmdc:mga08y16_189330_c1 3300050511 Bacteria 2135
302 nmdc:mga08y16_200038_c1 3300050511 Unclassified 2070
303 nmdc:mga08y16_296818_c1 3300050511 Unclassified 1666
304 nmdc:mga08y16_307842_c1 3300050511 Bacteria 1632
305 nmdc:mga08y16_4700_c1 3300050511 Bacteria 14233
306 Ga0500616_0000003 3300053153 Bacteria 1220687
307 Ga0500645_043015 3300053730 Bacteria 1331
308 2520879066 2519899754 Bacteria 5336938
309 2587942129 2585428115 Bacteria 4420269
310 2817416044 2816332280 Bacteria 5109718
311 2884794050 2884791551 Bacteria 8511252
312 2903897195 2903895155 Bacteria 5258610
313 2929179243 2929177148 Bacteria 7883697
314 2929926545 2929921140 Bacteria 8649150
315 2945981648 2945977869 Bacteria 7777518
316 2946018949 2946013367 Bacteria 7766675
317 2958461524 2958458903 Bacteria 5301041
318 8055421773 8055419101 Bacteria 5289643
319 Ga0496114_0000077
320 Ga0058862_12839656
321 Ga0065714_10002588
322 Ga0065714_10128316
323 Ga0065712_10018465
324 Ga0065712_10069502
325 Ga0065712_10148619
326 Ga0065715_10009130
327 Ga0065715_10232013
328 Ga0070658_10017340
329 Ga0070676_10002371
330 Ga0070683_100062488
331 Ga0070683_100075601
332 Ga0070683_100314690
333 Ga0070670_100016918
334 Ga0070670_100242637
335 Ga0068869_100087785
336 Ga0070666_10003631
337 Ga0070682_100034529
338 Ga0068868_100008344
339 Ga0068868_100121404
340 Ga0068868_100160432
341 Ga0070689_100244883
342 Ga0070689_100279253
343 Ga0070661_100000796
344 Ga0070661_100282092
345 Ga0070668_100007431
346 Ga0070675_100077701
347 Ga0070675_100176125
348 Ga0070671_100031808
349 Ga0070671_100047173
350 Ga0070671_100112655
351 Ga0070674_100039619
352 Ga0070673_100022659
353 Ga0070673_100056277
354 Ga0070673_100144818
355 Ga0070673_100174912
356 Ga0070673_100215515
357 Ga0070673_100326909
358 Ga0070688_100017749
359 Ga0070688_100023499
360 Ga0070659_100140445
361 Ga0070667_100003221
362 Ga0070667_100074401
363 Ga0070667_100222981
364 Ga0070714_100326890
365 Ga0070700_100127196
366 Ga0070662_100014835
367 Ga0070662_100206174
368 Ga0070685_10003810
369 Ga0070685_10106616
370 Ga0070679_100115905
371 Ga0070679_100235260
372 Ga0070684_100010766
373 Ga0070684_100018128
374 Ga0070684_100145931
375 Ga0068853_100011339
376 Ga0070672_100003913
377 Ga0070665_100019113
378 Ga0070664_100000744
379 Ga0070664_100014895
380 Ga0070664_100218309
381 Ga0068857_100032248
382 Ga0068857_100355085
383 Ga0068852_100071782
384 Ga0068852_100344477
385 Ga0068859_100018920
386 Ga0068859_100149955
387 Ga0068859_100159702
388 Ga0068864_100002018
389 Ga0068861_100017609
390 Ga0068861_100018041
391 Ga0068861_100022434
392 Ga0068851_10000071
393 Ga0068851_10007284
394 Ga0068863_100000546
395 Ga0068863_100170596
396 Ga0068858_100012490
397 Ga0068858_100095185
398 Ga0068860_100000650
399 Ga0068860_100011007
400 Ga0068862_100039803
401 Ga0068862_100128513
402 Ga0068862_100276102
403 Ga0097621_100004280
404 Ga0097621_100010632
405 Ga0097621_100013452
406 Ga0097621_100030417
407 Ga0097621_100352786
408 Ga0068871_100007121
409 Ga0068871_100023835
410 Ga0068871_100122819
411 Ga0068871_100390345
412 Ga0075428_100025299
413 Ga0075428_100035086
414 Ga0075428_100403121
415 Ga0068865_100007558
416 Ga0097620_100018922
417 Ga0097620_100149969
418 Ga0097620_100159703
419 Ga0099824_1019851
420 Ga0099826_10052977
421 Ga0105240_10107607
422 Ga0111539_10004821
423 Ga0111539_10011263
424 Ga0111539_10027751
425 Ga0111539_10349609
426 Ga0105247_10010817
427 Ga0105242_10004177
428 Ga0105242_10042218
429 Ga0105242_10080883
430 Ga0105248_10029679
431 Ga0105248_10035227
432 Ga0105249_10006716
433 Ga0105249_10036265
434 Ga0105249_10065884
435 Ga0105249_10114654
436 Ga0105249_10314012
437 Ga0105249_10425188
438 Ga0105246_10197273
439 Ga0157371_10018172
440 Ga0157371_10085119
441 Ga0157370_10410090
442 Ga0157374_10006607
443 Ga0157374_10092284
444 Ga0157374_10121139
445 Ga0157378_10013201
446 Ga0157378_10072156
447 Ga0157378_10085796
448 Ga0157378_10252377
449 Ga0163162_10000157
450 Ga0163162_10000715
451 Ga0163162_10003946
452 Ga0163162_10030872
453 Ga0163162_10031211
454 Ga0163162_10104489
455 Ga0163162_10243247
456 Ga0163162_10260461
457 Ga0163162_10302837
458 Ga0163162_10353288
459 Ga0163162_10372913
460 Ga0157372_10221845
461 Ga0157372_10280366
462 Ga0157375_10000462
463 Ga0157375_10002492
464 Ga0157375_10011455
465 Ga0157375_10108032
466 Ga0157375_10179586
467 Ga0157375_10328263
468 Ga0163163_10000495
469 Ga0163163_10007299
470 Ga0163163_10011747
471 Ga0163163_10089737
472 Ga0163163_10162100
473 Ga0157380_10000008
474 Ga0157380_10000248
475 Ga0157380_10004239
476 Ga0157380_10007880
477 Ga0157377_10054948
478 Ga0157377_10078918
479 Ga0157379_10004827
480 Ga0157379_10009301
481 Ga0157379_10078437
482 Ga0157379_10093876
483 Ga0157379_10389135
484 Ga0157376_10000068
485 Ga0157376_10011965
486 Ga0157376_10055465
487 Ga0157376_10058149
488 Ga0157376_10217834
489 Ga0182006_1062100
490 Ga0163161_10039839
491 Ga0163161_10071051
492 Ga0163161_10100961
493 Ga0209050_1001521
494 Ga0209050_1001762
495 Ga0207697_10128470
496 Ga0207656_10000891
497 Ga0207656_10003284
498 Ga0207680_10002930
499 Ga0207645_10028042
500 Ga0207643_10165570
501 Ga0207705_10044792
502 Ga0207695_10237591
503 Ga0207657_10024723
504 Ga0207649_10001731
505 Ga0207649_10033510
506 Ga0207652_10107948
507 Ga0207652_10216597
508 Ga0207650_10002302
509 Ga0207650_10136591
510 Ga0207650_10357782
511 Ga0207659_10030438
512 Ga0207644_10141819
513 Ga0207644_10288661
514 Ga0207690_10048598
515 Ga0207690_10172970
516 Ga0207706_10101131
517 Ga0207706_10138401
518 Ga0207706_10230413
519 Ga0207686_10003174
520 Ga0207686_10044727
521 Ga0207670_10005786
522 Ga0207670_10150040
523 Ga0207704_10018784
524 Ga0207691_10007144
525 Ga0207691_10105390
526 Ga0207689_10006265
527 Ga0207689_10040978
528 Ga0207661_10006953
529 Ga0207661_10124126
530 Ga0207661_10160322
531 Ga0207679_10000182
532 Ga0207679_10008176
533 Ga0207679_10024132
534 Ga0207679_10162971
535 Ga0207651_10010521
536 Ga0207651_10029328
537 Ga0207651_10030406
538 Ga0207651_10056446
539 Ga0207712_10005733
540 Ga0207712_10041334
541 Ga0207668_10005254
542 Ga0207658_10004407
543 Ga0207658_10005373
544 Ga0207658_10079133
545 Ga0207658_10312058
546 Ga0207677_10002812
547 Ga0207677_10144528
548 Ga0207703_10014942
549 Ga0207703_10237689
550 Ga0207639_10459415
551 Ga0207678_10049431
552 Ga0207708_10085386
553 Ga0207708_10185403
554 Ga0207641_10000539
555 Ga0207641_10021203
556 Ga0207641_10185106
557 Ga0207648_10035648
558 Ga0207648_10214841
559 Ga0207676_10002997
560 Ga0207676_10037491
561 Ga0207676_10201762
562 Ga0207676_10378923
563 Ga0207674_10046074
564 Ga0207674_10063818
565 Ga0207674_10093214
566 Ga0207674_10123968
567 Ga0207674_10437141
568 Ga0207675_100080073
569 Ga0207675_100092657
570 Ga0207675_100180480
571 Ga0207683_10094624
572 Ga0207683_10116702
573 Ga0207683_10330495
574 Ga0207698_10447873
575 Ga0209282_1111477
576 Ga0207428_10144782
577 Ga0268266_10009793
578 Ga0268265_10084056
579 Ga0268265_10114963
580 Ga0268264_10000809
581 Ga0268264_10006080
582 Ga0268264_10254505
583 Ga0265327_10000055
584 Ga0307414_10031741
585 Ga0307414_10109012
586 Ga0307414_10177067
587 Ga0307414_10194471
588 Ga0373947_0131743
589 Ga0373937_0152378
590 Ga0373937_0198299
591 Ga0395900_0199712
592 Ga0395905_0002208
593 Ga0439431_0009031
594 Ga0439445_0005758
595 Ga0451577_0034384
596 Ga0453683_0007719
597 Ga0453683_0028045
598 Ga0453683_0048880
599 Ga0453684_0002019
600 Ga0453684_0099846
601 Ga0453684_0150503
602 Ga0453684_0407140
603 Ga0453684_0503841
604 Ga0466959_0031189
605 Ga0451576_0005922
606 Ga0451576_0011062
607 Ga0451576_0066912
608 Ga0495638_0000008
609 Ga0495647_0052637
610 Ga0495613_0222156
611 Ga0495674_0117839
612 Ga0495676_0226143
613 Ga0495684_0078477
614 Ga0496100_0199642
615 Ga0496109_0050008
616 Ga0496111_0159832
617 Ga0496115_0021446
618 Ga0496125_0004055
619 nmdc:mga08y16_189330_c1
620 nmdc:mga08y16_200038_c1
621 nmdc:mga08y16_296818_c1
622 nmdc:mga08y16_307842_c1
623 nmdc:mga08y16_4700_c1
624 Ga0500616_0000003
625 Ga0500645_043015
626 2520879066
627 2587942129
628 2817416044
629 2884794050
630 2903897195
631 2929179243
632 2929926545
633 2945981648
634 2946018949
635 2958461524
636 8055421773

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17763

Asparaginase_C

Glutaminase/Asparaginase C-terminal domain

259

369

0.99

PF00710

Asparaginase

Asparaginase, N-terminal

47

241

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v29-assembly1.cif.gz_B-2 complex of double mutant (t89v,k162t) of e. coli l-asparaginase ii with l-asp 0.9627 21 349
6eok-assembly1.cif.gz_D crystal structure of e. coli l-asparaginase ii 0.9625 22 349
8ece-assembly1.cif.gz_D e. coli l-asparaginase ii mutant (v27t) in complex with l-glu 0.962 22 349
8ece-assembly1.cif.gz_C e. coli l-asparaginase ii mutant (v27t) in complex with l-glu 0.962 22 349
7r5q-assembly1.cif.gz_A escherichia coli type ii asparaginase n24s mutant in complex with glu 0.9617 22 349
ID Description Score Start End Superfamily
2wt4A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9678 236 346 3.40.50.40
1djoB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9632 236 347 3.40.50.40
3ecaB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9631 236 349 3.40.50.40
1zcfG02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9566 236 349 3.40.50.40
3ecaB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.955 236 349 3.40.50.40
ID Description Score Start End GO Terms
AF-K2BSP7-F1-model_v4 L-asparaginase type II (EC 3.5.1.1) 0.9667 151 349 GO:0004067
AF-A0A1I4I3Q2-F1-model_v4 L-asparaginase 0.9665 54 349 GO:0004067
GO:0006528
AF-A0A7U2YIL8-F1-model_v4 deleted 0.9665 231 349
AF-A0A496LDW4-F1-model_v4 Type II asparaginase (EC 3.5.1.1) 0.9652 61 349 GO:0004067
GO:0006528
AF-A0A2M9P8P2-F1-model_v4 L-asparaginase 0.9652 233 349 GO:0004067

Map