F404769

General Info

Members Datasets Scaffolds Average Seq Length
318 214 636 179

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0029031|Ga0495625_0029031_863_1480
Length 205
Sequence MRRRRVGEERIVTRGGQGLARVAVVVRAGAAPLWWLGVISAGVGVLVPGITGRRIGVMAGAALFLITAAVVAVVRHKRYAALVGGAARAGKHDVLQDRAVTVRNWRRGHRWWLLLALAGALGSAFAVPAAGGMLLAGAGAGLRLKAARIGRLERAAESLVWVRVDWLGRGAGVPAGKQVKGYRATGIAAGDAAPGGARRRGGVLV

Samples

Sample ID Description Type Environment
1 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
14 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
15 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
16 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
17 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
18 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
19 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
22 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
23 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
29 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
31 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
32 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
33 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
34 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
35 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
36 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
37 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
38 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
39 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
40 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
41 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
42 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
43 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
44 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
45 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
46 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
47 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
48 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
49 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
50 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
51 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
52 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
53 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
54 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
55 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
56 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
57 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
58 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
59 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
60 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
61 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
62 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
63 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
64 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
65 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
66 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
72 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
73 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
80 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
81 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
82 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
83 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
84 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
89 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
90 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
96 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
97 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
108 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
109 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
128 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
134 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
158 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
159 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
160 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
161 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
162 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
163 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
164 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
165 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
166 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
167 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
168 2643221647 Streptomyces sp. Root369 Isolate Unclassified
169 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
170 2643221714 Streptomyces sp. Root264 Isolate Unclassified
171 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
172 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
173 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
174 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
175 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
176 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
177 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
178 2808606448 Streptomyces sp. 193411 Isolate Unclassified
179 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
180 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
181 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
182 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
183 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
184 2862574272 Streptomyces sp. AcE210 Isolate Nodule
185 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
186 2867428634 Streptomyces sp. RP5T Isolate Unclassified
187 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
188 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
189 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
190 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
191 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
192 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
193 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
194 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
195 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
196 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
197 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
198 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
199 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
200 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
201 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
202 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
203 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
204 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
205 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
206 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
207 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
208 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
209 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
210 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
211 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
212 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
213 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
214 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.33
Metatranscriptomes 0.63
Isolates 16.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.03
Nodule 1.26
Rhizoplane 0.63
Rhizosphere 75.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495625_0029031 3300046660 Bacteria 4141
2 rootH2_10020891 3300003320 Bacteria 2208
3 rootH2_10036641 3300003320 Bacteria 1556
4 rootL2_10018822 3300003322 Bacteria 5258
5 rootH1_10073973 3300003323 Bacteria 5220
6 rootH1_10181559 3300003323 Bacteria 1141
7 Ga0006562J51391_1212693 3300003578 Bacteria 3660
8 Ga0006562J51391_1212694 3300003578 Bacteria 3610
9 Ga0068853_100544470 3300005539 Bacteria 1099
10 Ga0070665_100176605 3300005548 Bacteria 2137
11 Ga0068855_100175030 3300005563 Bacteria 2429
12 Ga0068856_100172832 3300005614 Bacteria 2173
13 Ga0075368_10010896 3300006042 Bacteria 3296
14 Ga0075363_100046835 3300006048 Bacteria 2295
15 Ga0075363_100049037 3300006048 Bacteria 2247
16 Ga0075367_10001107 3300006178 Bacteria 11160
17 Ga0075370_10219453 3300006353 Bacteria 1124
18 Ga0099826_10101710 3300006948 Bacteria 1732
19 Ga0105251_10013646 3300009011 Bacteria 4537
20 Ga0105250_10011971 3300009092 Bacteria 3593
21 Ga0105245_10047797 3300009098 Bacteria 3826
22 Ga0105248_11198593 3300009177 Bacteria 858
23 Ga0105246_10094892 3300011119 Bacteria 2159
24 Ga0182007_10003034 3300015262 Bacteria 8102
25 Ga0183367_1005 3300015688 Bacteria 652063
26 Ga0207426_1007557 3300025302 Bacteria 4530
27 Ga0207647_10169590 3300025904 Bacteria 1271
28 Ga0207709_10358722 3300025935 Bacteria 1103
29 Ga0207711_10716980 3300025941 Bacteria 933
30 Ga0207702_10054401 3300026078 Bacteria 3391
31 Ga0209371_1009317 3300027312 Bacteria 3133
32 Ga0209371_1010033 3300027312 Bacteria 2954
33 Ga0209371_1013697 3300027312 Bacteria 2260
34 Ga0209282_1055574 3300027666 Bacteria 2239
35 Ga0268266_10464399 3300028379 Bacteria 1205
36 Ga0268266_11445656 3300028379 Bacteria 663
37 Ga0307517_10085146 3300028786 Bacteria 2651
38 Ga0307515_10000054 3300028794 Bacteria 265489
39 Ga0268256_1004970 3300030500 Bacteria 5358
40 Ga0268256_1010705 3300030500 Bacteria 2954
41 Ga0307511_10000340 3300030521 Bacteria 49829
42 Ga0307511_10117248 3300030521 Bacteria 1664
43 Ga0307512_10001307 3300030522 Bacteria 35725
44 Ga0307512_10111646 3300030522 Bacteria 1798
45 Ga0307513_10343885 3300031456 Bacteria 1241
46 Ga0307513_10705894 3300031456 Bacteria 714
47 Ga0307509_10072958 3300031507 Bacteria 3575
48 Ga0307509_10099210 3300031507 Bacteria 2955
49 Ga0307509_10183664 3300031507 Bacteria 1952
50 Ga0307508_10010584 3300031616 Bacteria 8437
51 Ga0307508_10011939 3300031616 Bacteria 7945
52 Ga0307508_10131229 3300031616 Bacteria 2109
53 Ga0307514_10046852 3300031649 Bacteria 3376
54 Ga0307514_10059352 3300031649 Bacteria 2923
55 Ga0307514_10067044 3300031649 Bacteria 2710
56 Ga0307514_10147592 3300031649 Bacteria 1585
57 Ga0307514_10174673 3300031649 Bacteria 1396
58 Ga0307516_10005596 3300031730 Bacteria 14961
59 Ga0307516_10051009 3300031730 Bacteria 4057
60 Ga0307516_10213838 3300031730 Bacteria 1641
61 Ga0307516_10610665 3300031730 Bacteria 745
62 Ga0307518_10115630 3300031838 Bacteria 1905
63 Ga0307507_10025972 3300033179 Bacteria 6329
64 Ga0307507_10170019 3300033179 Bacteria 1586
65 Ga0307510_10042412 3300033180 Bacteria 4959
66 Ga0307510_10061146 3300033180 Bacteria 3865
67 Ga0307510_10140018 3300033180 Bacteria 2065
68 Ga0395898_0001909 3300037466 Bacteria 26549
69 Ga0395905_0537736 3300037471 Bacteria 1069
70 Ga0395901_0537235 3300038443 Bacteria 1186
71 Ga0439436_0001426 3300041404 Bacteria 6917
72 Ga0439439_0013307 3300041406 Bacteria 1994
73 Ga0439433_0042922 3300041999 Bacteria 1055
74 Ga0439442_003889 3300042002 Bacteria 2961
75 Ga0439449_0000613 3300042007 Bacteria 13376
76 Ga0439449_0091394 3300042007 Bacteria 1124
77 Ga0439450_005248 3300042008 Bacteria 2269
78 Ga0439455_0039816 3300042012 Bacteria 1200
79 Ga0439457_002091 3300042014 Bacteria 5826
80 Ga0439457_016046 3300042014 Bacteria 1671
81 Ga0439462_0003460 3300042015 Bacteria 3788
82 Ga0450890_043358 3300042127 Bacteria 671
83 Ga0450894_000831 3300042131 Bacteria 4966
84 Ga0450895_002477 3300042132 Bacteria 1376
85 Ga0450896_007215 3300042133 Bacteria 1531
86 Ga0450898_000031 3300042134 Bacteria 11137
87 Ga0450899_001796 3300042135 Bacteria 2383
88 Ga0450902_008697 3300042137 Bacteria 1588
89 Ga0450903_000104 3300042138 Bacteria 17931
90 Ga0450906_012728 3300042145 Bacteria 1557
91 Ga0439458_0001323 3300042157 Bacteria 6259
92 Ga0439458_0026117 3300042157 Bacteria 1372
93 Ga0439458_0052878 3300042157 Bacteria 1004
94 Ga0450909_020282 3300042185 Bacteria 990
95 Ga0466969_0017331 3300044656 Bacteria 3762
96 Ga0466972_0035564 3300044658 Bacteria 2437
97 Ga0466965_0023724 3300044683 Bacteria 2963
98 Ga0466965_0245789 3300044683 Bacteria 959
99 Ga0466966_0011200 3300044684 Bacteria 5951
100 Ga0466961_0006213 3300044693 Bacteria 7587
101 Ga0466971_0009793 3300044719 Bacteria 4183
102 Ga0466971_0035595 3300044719 Bacteria 2233
103 Ga0466968_0096897 3300044735 Bacteria 1313
104 Ga0466970_0011206 3300044765 Bacteria 4567
105 Ga0495592_0002872 3300046454 Bacteria 12254
106 Ga0495592_0025308 3300046454 Bacteria 4506
107 Ga0495603_0006993 3300046455 Bacteria 6771
108 Ga0495603_0007424 3300046455 Bacteria 6592
109 Ga0495603_0018045 3300046455 Bacteria 4268
110 Ga0495603_0029412 3300046455 Bacteria 3312
111 Ga0495629_0004918 3300046459 Bacteria 10030
112 Ga0495629_0023107 3300046459 Bacteria 4431
113 Ga0495629_0024454 3300046459 Bacteria 4301
114 Ga0495629_0067963 3300046459 Bacteria 2486
115 Ga0495638_0196786 3300046460 Bacteria 1140
116 Ga0495651_0009523 3300046462 Bacteria 7461
117 Ga0495651_0175898 3300046462 Bacteria 1519
118 Ga0495582_0261245 3300046473 Bacteria 993
119 Ga0495605_0024356 3300046474 Bacteria 3167
120 Ga0495639_0008051 3300046475 Bacteria 4526
121 Ga0495662_0002157 3300046476 Bacteria 9881
122 Ga0495662_0062984 3300046476 Bacteria 1791
123 Ga0495662_0084680 3300046476 Bacteria 1543
124 Ga0495662_0092728 3300046476 Bacteria 1473
125 Ga0495664_0002565 3300046477 Bacteria 9768
126 Ga0495664_0106770 3300046477 Bacteria 1688
127 Ga0495585_0046814 3300046492 Bacteria 2410
128 Ga0495594_0003128 3300046499 Bacteria 8561
129 Ga0495594_0006301 3300046499 Bacteria 6104
130 Ga0495594_0178040 3300046499 Bacteria 1210
131 Ga0495583_0029530 3300046506 Bacteria 2681
132 Ga0495583_0041970 3300046506 Bacteria 2139
133 Ga0495606_0004326 3300046507 Bacteria 14287
134 Ga0495608_0185252 3300046511 Bacteria 1316
135 Ga0495610_0058819 3300046512 Bacteria 1837
136 Ga0495616_0038318 3300046513 Bacteria 2461
137 Ga0495618_0142039 3300046514 Bacteria 1535
138 Ga0495620_0008312 3300046515 Bacteria 5579
139 Ga0495620_0008623 3300046515 Bacteria 5465
140 Ga0495628_0093449 3300046516 Bacteria 2326
141 Ga0495628_0253653 3300046516 Bacteria 1313
142 Ga0495628_0275186 3300046516 Bacteria 1251
143 Ga0495630_0019243 3300046517 Bacteria 5018
144 Ga0495643_0001651 3300046522 Bacteria 19621
145 Ga0495648_0035559 3300046524 Bacteria 3228
146 Ga0495642_0042066 3300046528 Bacteria 1860
147 Ga0495652_0022667 3300046529 Bacteria 5572
148 Ga0495652_0042155 3300046529 Bacteria 3936
149 Ga0495640_0017348 3300046533 Bacteria 5368
150 Ga0495640_0242983 3300046533 Bacteria 1129
151 Ga0495587_0002435 3300046536 Bacteria 12421
152 Ga0495597_0081012 3300046542 Bacteria 1388
153 Ga0495645_0002875 3300046543 Bacteria 11693
154 Ga0495645_0179619 3300046543 Bacteria 1451
155 Ga0495622_0007925 3300046557 Bacteria 4924
156 Ga0495622_0008363 3300046557 Bacteria 4791
157 Ga0495622_0014493 3300046557 Bacteria 3661
158 Ga0495667_0138487 3300046559 Bacteria 1569
159 Ga0495668_0008301 3300046616 Bacteria 6504
160 Ga0495668_0103642 3300046616 Bacteria 1556
161 Ga0495634_0016149 3300046642 Bacteria 5343
162 Ga0495634_0398797 3300046642 Bacteria 817
163 Ga0495611_0087289 3300046648 Bacteria 1439
164 Ga0495625_0004312 3300046660 Bacteria 13511
165 Ga0495635_0030224 3300046663 Bacteria 3764
166 Ga0495635_0229738 3300046663 Bacteria 1253
167 Ga0495588_0015487 3300046674 Bacteria 3671
168 Ga0495588_0019848 3300046674 Bacteria 3296
169 Ga0495588_0165451 3300046674 Bacteria 1169
170 Ga0495588_0365080 3300046674 Bacteria 758
171 Ga0495657_0009106 3300046675 Bacteria 7543
172 Ga0495599_0431409 3300046678 Bacteria 782
173 Ga0495623_0035743 3300046679 Bacteria 3184
174 Ga0495623_0392551 3300046679 Bacteria 748
175 Ga0495646_0000234 3300046680 Bacteria 27621
176 Ga0495613_0001765 3300046689 Bacteria 16461
177 Ga0495613_0031084 3300046689 Bacteria 3965
178 Ga0495613_0036187 3300046689 Bacteria 3660
179 Ga0495613_0173650 3300046689 Bacteria 1528
180 Ga0495613_0299911 3300046689 Bacteria 1112
181 Ga0495624_0148466 3300046690 Bacteria 1434
182 Ga0495671_0004616 3300046692 Bacteria 8184
183 Ga0495649_0034604 3300046694 Bacteria 2779
184 Ga0495649_0052992 3300046694 Bacteria 2197
185 Ga0495600_0008286 3300046809 Bacteria 6380
186 Ga0495660_0061455 3300046810 Bacteria 2015
187 Ga0495581_0046691 3300047315 Bacteria 2503
188 Ga0495581_0427975 3300047315 Bacteria 771
189 Ga0495604_0001967 3300047317 Bacteria 16593
190 Ga0495604_0158118 3300047317 Bacteria 1603
191 Ga0495636_0002668 3300047318 Bacteria 6887
192 Ga0495674_0105353 3300047319 Bacteria 2396
193 Ga0495676_0030285 3300047321 Bacteria 4596
194 Ga0495676_0054059 3300047321 Bacteria 3194
195 Ga0495676_0145331 3300047321 Bacteria 1694
196 Ga0495676_0187829 3300047321 Bacteria 1443
197 Ga0495687_001670 3300047443 Bacteria 19862
198 Ga0495687_034504 3300047443 Bacteria 2285
199 Ga0495675_0002538 3300047444 Bacteria 10925
200 Ga0495675_0232410 3300047444 Bacteria 1112
201 Ga0495685_021496 3300047447 Bacteria 2219
202 Ga0495681_0001657 3300047470 Bacteria 16507
203 Ga0495681_0029719 3300047470 Bacteria 2793
204 Ga0495684_0216803 3300047471 Bacteria 1405
205 Ga0495686_0052048 3300047472 Bacteria 2568
206 Ga0495686_0245040 3300047472 Bacteria 1009
207 Ga0495593_0004416 3300047673 Bacteria 8357
208 Ga0495593_0041174 3300047673 Bacteria 2484
209 Ga0495593_0116326 3300047673 Bacteria 1362
210 Ga0495602_0027872 3300048088 Bacteria 5418
211 Ga0495602_0160582 3300048088 Bacteria 1755
212 Ga0495614_0020724 3300048089 Bacteria 2841
213 Ga0495614_0031957 3300048089 Bacteria 2265
214 Ga0495614_0055802 3300048089 Bacteria 1694
215 Ga0495614_0063052 3300048089 Bacteria 1593
216 Ga0495614_0159878 3300048089 Bacteria 1007
217 Ga0495626_0005799 3300048091 Bacteria 7123
218 Ga0495626_0079017 3300048091 Bacteria 1464
219 Ga0496108_0742493 3300048911 Bacteria 849
220 Ga0496109_0067974 3300048912 Bacteria 3265
221 Ga0495678_010698 3300049459 Bacteria 4437
222 Ga0501031_0035290 3300049568 Bacteria 3262
223 Ga0501033_0005118 3300049570 Bacteria 10427
224 Ga0501033_0006337 3300049570 Bacteria 9274
225 Ga0501033_0068563 3300049570 Bacteria 2607
226 Ga0501034_0024461 3300049571 Bacteria 6144
227 Ga0501034_0060322 3300049571 Bacteria 3810
228 Ga0501034_0146748 3300049571 Bacteria 2336
229 Ga0501034_0554407 3300049571 Bacteria 1058
230 Ga0501036_0004158 3300049572 Bacteria 11648
231 Ga0501036_0704530 3300049572 Bacteria 834
232 Ga0501037_0011356 3300049573 Bacteria 6557
233 Ga0501038_0007671 3300049574 Bacteria 9950
234 Ga0501038_0053404 3300049574 Bacteria 3479
235 Ga0501039_0421433 3300049575 Bacteria 1048
236 Ga0501039_0606425 3300049575 Bacteria 858
237 Ga0501042_0024342 3300049578 Bacteria 4246
238 Ga0501043_0003162 3300049579 Bacteria 13628
239 Ga0501043_0415678 3300049579 Bacteria 1014
240 Ga0501046_0010072 3300049580 Bacteria 8139
241 Ga0501047_0053427 3300049581 Bacteria 3906
242 Ga0501047_0066862 3300049581 Bacteria 3464
243 Ga0501047_0071023 3300049581 Bacteria 3352
244 Ga0501048_0356092 3300049582 Bacteria 1044
245 Ga0501048_0390263 3300049582 Bacteria 994
246 Ga0501068_0334731 3300049584 Bacteria 972
247 Ga0501070_0007258 3300049586 Bacteria 9408
248 Ga0501070_0264070 3300049586 Bacteria 1407
249 Ga0501074_0011267 3300049590 Bacteria 6500
250 Ga0501074_0351479 3300049590 Bacteria 1046
251 Ga0501035_0001046 3300049822 Bacteria 28949
252 Ga0501035_0099732 3300049822 Bacteria 2549
253 Ga0501035_0228784 3300049822 Bacteria 1585
254 Ga0501035_0258956 3300049822 Bacteria 1475
255 Ga0501044_0024045 3300049823 Bacteria 6472
256 Ga0501044_0090696 3300049823 Bacteria 3083
257 Ga0501044_0307156 3300049823 Bacteria 1513
258 nmdc:mga03n38_109201_c1 3300050490 Bacteria 1345
259 nmdc:mga06z11_9152_c1 3300050494 Bacteria 4162
260 nmdc:mga04h51_2744_c1 3300050495 Bacteria 4196
261 Ga0500647_0161680 3300053091 Bacteria 1039
262 Ga0500640_021065 3300053095 Bacteria 2808
263 Ga0500560_014856 3300053107 Bacteria 2085
264 Ga0500572_006489 3300053111 Bacteria 2681
265 Ga0500573_0059233 3300053140 Bacteria 2195
266 Ga0500600_0145148 3300053149 Bacteria 1189
267 Ga0500600_0234135 3300053149 Bacteria 836
268 2547411730 2547132111 Bacteria 8013147
269 2585310396 2582581313 Bacteria 10042643
270 2585319657 2582581314 Bacteria 11452267
271 2616695408 2616644814 Bacteria 11555299
272 2644265293 2643221647 Bacteria 10741251
273 2644436882 2643221678 Bacteria 9540101
274 2644628622 2643221714 Bacteria 9015452
275 2784588363 2784132148 Bacteria 8627943
276 2785343667 2784746763 Bacteria 9783172
277 2785369173 2784746768 Bacteria 10036182
278 2786670310 2786546132 Bacteria 10419719
279 2804847347 2802429296 Bacteria 7227771
280 2808841777 2808606359 Bacteria 9866990
281 2808920309 2808606375 Bacteria 9466072
282 2809231959 2808606448 Bacteria 8656184
283 2812358471 2811994879 Bacteria 9313447
284 2812480807 2811994917 Bacteria 7761064
285 2852636969 2852635781 Bacteria 8251373
286 2862285209 2862281513 Bacteria 9621493
287 2862513570 2862507626 Bacteria 9425308
288 2862579486 2862574272 Bacteria 10567477
289 2863404999 2863404153 Bacteria 9672205
290 2867436983 2867428634 Bacteria 9590268
291 2877681374 2877676314 Bacteria 9512378
292 2912720361 2912715099 Bacteria 9460473
293 2912724568 2912723979 Bacteria 8557534
294 2919475203 2919468124 Bacteria 9133025
295 2946067407 2946064051 Bacteria 8957905
296 2946075660 2946072368 Bacteria 8999607
297 2947229828 2947224130 Bacteria 9938529
298 2954007817 2954002825 Bacteria 9173742
299 2954386517 2954380949 Bacteria 10050426
300 2954676656 2954673503 Bacteria 9685905
301 2954687511 2954682443 Bacteria 9862841
302 2954697330 2954691527 Bacteria 10720516
303 2954704940 2954701450 Bacteria 10834262
304 2954716498 2954711539 Bacteria 10867210
305 2954726445 2954721474 Bacteria 10456478
306 2954735364 2954731030 Bacteria 10243860
307 2954745368 2954740390 Bacteria 10229294
308 2954754221 2954749733 Bacteria 10366972
309 2954764344 2954759201 Bacteria 9358192
310 2990067270 2990059506 Bacteria 9321252
311 3006396505 3006393351 Bacteria 6615579
312 3006496315 3006493962 Bacteria 8825450
313 8008567922 8008558824 Bacteria 10610750
314 8008579101 8008574985 Bacteria 7815457
315 8023625527 8023623736 Bacteria 8593882
316 8025416785 8025413630 Bacteria 7014048
317 8048408277 8048406513 Bacteria 8936924
318 8056833635 8056829672 Bacteria 9045328
319 Ga0495625_0029031
320 rootH2_10020891
321 rootH2_10036641
322 rootL2_10018822
323 rootH1_10073973
324 rootH1_10181559
325 Ga0006562J51391_1212693
326 Ga0006562J51391_1212694
327 Ga0068853_100544470
328 Ga0070665_100176605
329 Ga0068855_100175030
330 Ga0068856_100172832
331 Ga0075368_10010896
332 Ga0075363_100046835
333 Ga0075363_100049037
334 Ga0075367_10001107
335 Ga0075370_10219453
336 Ga0099826_10101710
337 Ga0105251_10013646
338 Ga0105250_10011971
339 Ga0105245_10047797
340 Ga0105248_11198593
341 Ga0105246_10094892
342 Ga0182007_10003034
343 Ga0183367_1005
344 Ga0207426_1007557
345 Ga0207647_10169590
346 Ga0207709_10358722
347 Ga0207711_10716980
348 Ga0207702_10054401
349 Ga0209371_1009317
350 Ga0209371_1010033
351 Ga0209371_1013697
352 Ga0209282_1055574
353 Ga0268266_10464399
354 Ga0268266_11445656
355 Ga0307517_10085146
356 Ga0307515_10000054
357 Ga0268256_1004970
358 Ga0268256_1010705
359 Ga0307511_10000340
360 Ga0307511_10117248
361 Ga0307512_10001307
362 Ga0307512_10111646
363 Ga0307513_10343885
364 Ga0307513_10705894
365 Ga0307509_10072958
366 Ga0307509_10099210
367 Ga0307509_10183664
368 Ga0307508_10010584
369 Ga0307508_10011939
370 Ga0307508_10131229
371 Ga0307514_10046852
372 Ga0307514_10059352
373 Ga0307514_10067044
374 Ga0307514_10147592
375 Ga0307514_10174673
376 Ga0307516_10005596
377 Ga0307516_10051009
378 Ga0307516_10213838
379 Ga0307516_10610665
380 Ga0307518_10115630
381 Ga0307507_10025972
382 Ga0307507_10170019
383 Ga0307510_10042412
384 Ga0307510_10061146
385 Ga0307510_10140018
386 Ga0395898_0001909
387 Ga0395905_0537736
388 Ga0395901_0537235
389 Ga0439436_0001426
390 Ga0439439_0013307
391 Ga0439433_0042922
392 Ga0439442_003889
393 Ga0439449_0000613
394 Ga0439449_0091394
395 Ga0439450_005248
396 Ga0439455_0039816
397 Ga0439457_002091
398 Ga0439457_016046
399 Ga0439462_0003460
400 Ga0450890_043358
401 Ga0450894_000831
402 Ga0450895_002477
403 Ga0450896_007215
404 Ga0450898_000031
405 Ga0450899_001796
406 Ga0450902_008697
407 Ga0450903_000104
408 Ga0450906_012728
409 Ga0439458_0001323
410 Ga0439458_0026117
411 Ga0439458_0052878
412 Ga0450909_020282
413 Ga0466969_0017331
414 Ga0466972_0035564
415 Ga0466965_0023724
416 Ga0466965_0245789
417 Ga0466966_0011200
418 Ga0466961_0006213
419 Ga0466971_0009793
420 Ga0466971_0035595
421 Ga0466968_0096897
422 Ga0466970_0011206
423 Ga0495592_0002872
424 Ga0495592_0025308
425 Ga0495603_0006993
426 Ga0495603_0007424
427 Ga0495603_0018045
428 Ga0495603_0029412
429 Ga0495629_0004918
430 Ga0495629_0023107
431 Ga0495629_0024454
432 Ga0495629_0067963
433 Ga0495638_0196786
434 Ga0495651_0009523
435 Ga0495651_0175898
436 Ga0495582_0261245
437 Ga0495605_0024356
438 Ga0495639_0008051
439 Ga0495662_0002157
440 Ga0495662_0062984
441 Ga0495662_0084680
442 Ga0495662_0092728
443 Ga0495664_0002565
444 Ga0495664_0106770
445 Ga0495585_0046814
446 Ga0495594_0003128
447 Ga0495594_0006301
448 Ga0495594_0178040
449 Ga0495583_0029530
450 Ga0495583_0041970
451 Ga0495606_0004326
452 Ga0495608_0185252
453 Ga0495610_0058819
454 Ga0495616_0038318
455 Ga0495618_0142039
456 Ga0495620_0008312
457 Ga0495620_0008623
458 Ga0495628_0093449
459 Ga0495628_0253653
460 Ga0495628_0275186
461 Ga0495630_0019243
462 Ga0495643_0001651
463 Ga0495648_0035559
464 Ga0495642_0042066
465 Ga0495652_0022667
466 Ga0495652_0042155
467 Ga0495640_0017348
468 Ga0495640_0242983
469 Ga0495587_0002435
470 Ga0495597_0081012
471 Ga0495645_0002875
472 Ga0495645_0179619
473 Ga0495622_0007925
474 Ga0495622_0008363
475 Ga0495622_0014493
476 Ga0495667_0138487
477 Ga0495668_0008301
478 Ga0495668_0103642
479 Ga0495634_0016149
480 Ga0495634_0398797
481 Ga0495611_0087289
482 Ga0495625_0004312
483 Ga0495635_0030224
484 Ga0495635_0229738
485 Ga0495588_0015487
486 Ga0495588_0019848
487 Ga0495588_0165451
488 Ga0495588_0365080
489 Ga0495657_0009106
490 Ga0495599_0431409
491 Ga0495623_0035743
492 Ga0495623_0392551
493 Ga0495646_0000234
494 Ga0495613_0001765
495 Ga0495613_0031084
496 Ga0495613_0036187
497 Ga0495613_0173650
498 Ga0495613_0299911
499 Ga0495624_0148466
500 Ga0495671_0004616
501 Ga0495649_0034604
502 Ga0495649_0052992
503 Ga0495600_0008286
504 Ga0495660_0061455
505 Ga0495581_0046691
506 Ga0495581_0427975
507 Ga0495604_0001967
508 Ga0495604_0158118
509 Ga0495636_0002668
510 Ga0495674_0105353
511 Ga0495676_0030285
512 Ga0495676_0054059
513 Ga0495676_0145331
514 Ga0495676_0187829
515 Ga0495687_001670
516 Ga0495687_034504
517 Ga0495675_0002538
518 Ga0495675_0232410
519 Ga0495685_021496
520 Ga0495681_0001657
521 Ga0495681_0029719
522 Ga0495684_0216803
523 Ga0495686_0052048
524 Ga0495686_0245040
525 Ga0495593_0004416
526 Ga0495593_0041174
527 Ga0495593_0116326
528 Ga0495602_0027872
529 Ga0495602_0160582
530 Ga0495614_0020724
531 Ga0495614_0031957
532 Ga0495614_0055802
533 Ga0495614_0063052
534 Ga0495614_0159878
535 Ga0495626_0005799
536 Ga0495626_0079017
537 Ga0496108_0742493
538 Ga0496109_0067974
539 Ga0495678_010698
540 Ga0501031_0035290
541 Ga0501033_0005118
542 Ga0501033_0006337
543 Ga0501033_0068563
544 Ga0501034_0024461
545 Ga0501034_0060322
546 Ga0501034_0146748
547 Ga0501034_0554407
548 Ga0501036_0004158
549 Ga0501036_0704530
550 Ga0501037_0011356
551 Ga0501038_0007671
552 Ga0501038_0053404
553 Ga0501039_0421433
554 Ga0501039_0606425
555 Ga0501042_0024342
556 Ga0501043_0003162
557 Ga0501043_0415678
558 Ga0501046_0010072
559 Ga0501047_0053427
560 Ga0501047_0066862
561 Ga0501047_0071023
562 Ga0501048_0356092
563 Ga0501048_0390263
564 Ga0501068_0334731
565 Ga0501070_0007258
566 Ga0501070_0264070
567 Ga0501074_0011267
568 Ga0501074_0351479
569 Ga0501035_0001046
570 Ga0501035_0099732
571 Ga0501035_0228784
572 Ga0501035_0258956
573 Ga0501044_0024045
574 Ga0501044_0090696
575 Ga0501044_0307156
576 nmdc:mga03n38_109201_c1
577 nmdc:mga06z11_9152_c1
578 nmdc:mga04h51_2744_c1
579 Ga0500647_0161680
580 Ga0500640_021065
581 Ga0500560_014856
582 Ga0500572_006489
583 Ga0500573_0059233
584 Ga0500600_0145148
585 Ga0500600_0234135
586 2547411730
587 2585310396
588 2585319657
589 2616695408
590 2644265293
591 2644436882
592 2644628622
593 2784588363
594 2785343667
595 2785369173
596 2786670310
597 2804847347
598 2808841777
599 2808920309
600 2809231959
601 2812358471
602 2812480807
603 2852636969
604 2862285209
605 2862513570
606 2862579486
607 2863404999
608 2867436983
609 2877681374
610 2912720361
611 2912724568
612 2919475203
613 2946067407
614 2946075660
615 2947229828
616 2954007817
617 2954386517
618 2954676656
619 2954687511
620 2954697330
621 2954704940
622 2954716498
623 2954726445
624 2954735364
625 2954745368
626 2954754221
627 2954764344
628 2990067270
629 3006396505
630 3006496315
631 8008567922
632 8008579101
633 8023625527
634 8025416785
635 8048408277
636 8056833635

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map