F404689

General Info

Members Datasets Scaffolds Average Seq Length
318 184 636 158

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0003757|Ga0373926_0003757_2482_3015
Length 177
Sequence MDEVPAQGTPAAEIAIRLRGIAVLVRGRLTTLRPADAGDVDRLVAWHADPDVARYWDDETFTRGEMEDRLARPDVEAWIVEEAAEPVGYLQVHPEGLDMFLIPAARGRGLGPDAARAMARHLIEEHGRERVTVDPYAWNEGAVRAWERAGFVEVSRHEAGGEYTAPWILMEFRGSSS

Samples

Sample ID Description Type Environment
1 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
76 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
79 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
80 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
81 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
83 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
84 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
100 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
101 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
126 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
127 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
181 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
184 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.11
Metatranscriptomes 1.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 8.49
Rhizosphere 91.19
Stem 0
Stem Tuber 0
Unclassified 8.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373926_0003757 3300035083 Bacteria 4944
2 Ga0070658_10038710 3300005327 Bacteria 3845
3 Ga0070683_100018340 3300005329 Bacteria 6196
4 Ga0070683_100639033 3300005329 Bacteria 1019
5 Ga0070680_100012301 3300005336 Bacteria 6646
6 Ga0070660_100002523 3300005339 Bacteria 12541
7 Ga0070661_100114110 3300005344 Bacteria 2019
8 Ga0070661_100497261 3300005344 Unclassified 976
9 Ga0070671_100059165 3300005355 Bacteria 3189
10 Ga0070659_100273554 3300005366 Bacteria 1404
11 Ga0070714_100140878 3300005435 Bacteria 2165
12 Ga0070714_100158704 3300005435 Bacteria 2044
13 Ga0070714_101214107 3300005435 Bacteria 736
14 Ga0070713_100051847 3300005436 Bacteria 3395
15 Ga0070713_100279657 3300005436 Bacteria 1531
16 Ga0070710_10657117 3300005437 Unclassified 735
17 Ga0070711_100012709 3300005439 Bacteria 5268
18 Ga0070711_100482897 3300005439 Bacteria 1019
19 Ga0070705_100224120 3300005440 Bacteria 1304
20 Ga0070681_10048792 3300005458 Bacteria 4229
21 Ga0070681_10206674 3300005458 Bacteria 1880
22 Ga0070707_100268518 3300005468 Bacteria 1659
23 Ga0070698_100485345 3300005471 Bacteria 1173
24 Ga0070679_100415612 3300005530 Bacteria 1291
25 Ga0070684_100151802 3300005535 Bacteria 2099
26 Ga0070684_100440866 3300005535 Bacteria 1203
27 Ga0070686_100552356 3300005544 Unclassified 901
28 Ga0070696_100875582 3300005546 Bacteria 744
29 Ga0070704_100027293 3300005549 Bacteria 3785
30 Ga0068855_101367264 3300005563 Bacteria 731
31 Ga0068856_100045358 3300005614 Bacteria 4328
32 Ga0068856_101257007 3300005614 Bacteria 756
33 Ga0068864_100385022 3300005618 Bacteria 1330
34 Ga0070717_10091619 3300006028 Bacteria 2567
35 Ga0070717_10096418 3300006028 Bacteria 2505
36 Ga0070715_10003096 3300006163 Bacteria 5217
37 Ga0070715_10738496 3300006163 Bacteria 592
38 Ga0070716_100149136 3300006173 Bacteria 1502
39 Ga0070712_100155947 3300006175 Bacteria 1758
40 Ga0070712_100234916 3300006175 Bacteria 1458
41 Ga0068871_100333172 3300006358 Bacteria 1339
42 Ga0075434_100055737 3300006871 Bacteria 3928
43 Ga0105240_11342826 3300009093 Bacteria 753
44 Ga0105245_10302233 3300009098 Bacteria 1570
45 Ga0105245_10488725 3300009098 Bacteria 1245
46 Ga0105247_10326916 3300009101 Bacteria 1072
47 Ga0105243_10425615 3300009148 Bacteria 1240
48 Ga0105242_10451628 3300009176 Bacteria 1212
49 Ga0105248_10376699 3300009177 Bacteria 1598
50 Ga0105248_10612604 3300009177 Unclassified 1228
51 Ga0105248_10633765 3300009177 Bacteria 1206
52 Ga0157369_10589532 3300013105 Bacteria 1148
53 Ga0157369_11327330 3300013105 Unclassified 733
54 Ga0157374_10025723 3300013296 Bacteria 5288
55 Ga0157378_10555946 3300013297 Bacteria 1153
56 Ga0157372_10556343 3300013307 Bacteria 1337
57 Ga0157372_10997080 3300013307 Bacteria 970
58 Ga0157375_10891017 3300013308 Unclassified 1034
59 Ga0182008_10001160 3300014497 Bacteria 18146
60 Ga0182008_10036238 3300014497 Bacteria 2469
61 Ga0182006_1007664 3300015261 Bacteria 4931
62 Ga0182007_10007106 3300015262 Bacteria 4735
63 Ga0206356_10194144 3300020070 Bacteria 727
64 Ga0206356_10369856 3300020070 Bacteria 1930
65 Ga0206354_11283835 3300020081 Bacteria 2280
66 Ga0206353_10565503 3300020082 Bacteria 2989
67 Ga0206353_11581275 3300020082 Bacteria 1233
68 Ga0224712_10026103 3300022467 Bacteria 2061
69 Ga0207692_10418057 3300025898 Unclassified 839
70 Ga0207699_10089123 3300025906 Bacteria 1933
71 Ga0207705_10067101 3300025909 Bacteria 2596
72 Ga0207707_10022659 3300025912 Bacteria 5492
73 Ga0207695_11068000 3300025913 Bacteria 687
74 Ga0207693_10001610 3300025915 Bacteria 19947
75 Ga0207663_10013731 3300025916 Bacteria 4411
76 Ga0207660_10015704 3300025917 Bacteria 5001
77 Ga0207657_10006039 3300025919 Bacteria 12592
78 Ga0207657_10455879 3300025919 Bacteria 1003
79 Ga0207649_10117094 3300025920 Bacteria 1790
80 Ga0207649_10711935 3300025920 Bacteria 779
81 Ga0207652_10125358 3300025921 Bacteria 2287
82 Ga0207652_10289768 3300025921 Bacteria 1477
83 Ga0207646_10004578 3300025922 Bacteria 14961
84 Ga0207646_10184587 3300025922 Bacteria 1884
85 Ga0207687_10418942 3300025927 Unclassified 1105
86 Ga0207700_10031410 3300025928 Bacteria 3773
87 Ga0207700_10053348 3300025928 Bacteria 3029
88 Ga0207664_10011345 3300025929 Bacteria 6326
89 Ga0207664_10021564 3300025929 Bacteria 4794
90 Ga0207664_10035201 3300025929 Bacteria 3862
91 Ga0207664_10650435 3300025929 Unclassified 947
92 Ga0207686_10600304 3300025934 Bacteria 866
93 Ga0207665_10256631 3300025939 Bacteria 1294
94 Ga0207711_10483307 3300025941 Unclassified 1154
95 Ga0207661_10033059 3300025944 Bacteria 4012
96 Ga0207661_10700959 3300025944 Bacteria 931
97 Ga0207640_10906765 3300025981 Bacteria 770
98 Ga0207639_10307190 3300026041 Bacteria 1404
99 Ga0207702_10086773 3300026078 Bacteria 2730
100 Ga0207676_10737285 3300026095 Unclassified 957
101 Ga0265337_1026752 3300028556 Bacteria 1744
102 Ga0265334_10005437 3300028573 Bacteria 5565
103 Ga0265318_10124020 3300028577 Bacteria 950
104 Ga0265322_10067628 3300028654 Unclassified 1013
105 Ga0265336_10041790 3300028666 Bacteria 1400
106 Ga0265338_10002401 3300028800 Bacteria 28171
107 Ga0265324_10045619 3300029957 Bacteria 1509
108 Ga0265313_10011277 3300031595 Bacteria 5568
109 Ga0373944_0032053 3300035089 Bacteria 1585
110 Ga0373936_0138055 3300035113 Bacteria 1051
111 Ga0373945_0022014 3300035116 Bacteria 2193
112 Ga0373957_0240992 3300035120 Bacteria 760
113 Ga0373960_0052737 3300035121 Bacteria 1212
114 Ga0373943_0002222 3300035170 Bacteria 8830
115 Ga0373943_0081518 3300035170 Bacteria 1660
116 Ga0373946_0004761 3300035171 Bacteria 4882
117 Ga0373955_0486119 3300035172 Bacteria 754
118 Ga0373924_0183954 3300035410 Bacteria 920
119 Ga0373931_0722919 3300035691 Unclassified 659
120 Ga0373935_0250025 3300035692 Bacteria 1240
121 Ga0373947_0010222 3300035725 Bacteria 5387
122 Ga0373937_0000828 3300036401 Bacteria 26522
123 Ga0373925_0000642 3300037068 Bacteria 32875
124 Ga0466969_0010666 3300044656 Bacteria 4869
125 Ga0466969_0391640 3300044656 Unclassified 630
126 Ga0466965_0051636 3300044683 Bacteria 2040
127 Ga0466965_0061802 3300044683 Bacteria 1873
128 Ga0466966_0111470 3300044684 Bacteria 1686
129 Ga0466961_0024150 3300044693 Bacteria 3910
130 Ga0466961_0519182 3300044693 Unclassified 718
131 Ga0466963_0000956 3300044694 Bacteria 14836
132 Ga0466963_0007973 3300044694 Bacteria 6339
133 Ga0466963_0009883 3300044694 Bacteria 5760
134 Ga0466963_0038224 3300044694 Bacteria 3137
135 Ga0466963_0050228 3300044694 Bacteria 2760
136 Ga0466963_0132837 3300044694 Bacteria 1720
137 Ga0466964_0008560 3300044706 Bacteria 3845
138 Ga0466964_0041137 3300044706 Bacteria 1868
139 Ga0466964_0070754 3300044706 Unclassified 1474
140 Ga0466964_0076017 3300044706 Bacteria 1431
141 Ga0466964_0086580 3300044706 Bacteria 1355
142 Ga0466964_0214802 3300044706 Unclassified 931
143 Ga0466971_0005306 3300044719 Bacteria 5588
144 Ga0466971_0201885 3300044719 Bacteria 939
145 Ga0466968_0000868 3300044735 Bacteria 10603
146 Ga0466968_0130922 3300044735 Unclassified 1141
147 Ga0466968_0161794 3300044735 Bacteria 1033
148 Ga0466968_0220588 3300044735 Bacteria 893
149 Ga0466970_0014789 3300044765 Bacteria 4011
150 Ga0466970_0057552 3300044765 Bacteria 2079
151 Ga0466970_0068535 3300044765 Bacteria 1906
152 Ga0466957_0002743 3300044842 Bacteria 9530
153 Ga0466957_0003162 3300044842 Bacteria 8981
154 Ga0466957_0005070 3300044842 Bacteria 7371
155 Ga0466957_0108617 3300044842 Bacteria 1757
156 Ga0466957_0192032 3300044842 Bacteria 1338
157 Ga0466960_0020466 3300044901 Bacteria 2931
158 Ga0466960_0093827 3300044901 Unclassified 1534
159 Ga0466959_0034316 3300045049 Bacteria 3752
160 Ga0466958_0000455 3300045836 Bacteria 17042
161 Ga0466958_0004315 3300045836 Bacteria 7488
162 Ga0466958_0014375 3300045836 Bacteria 4521
163 Ga0466958_0073968 3300045836 Bacteria 2087
164 Ga0466958_0118206 3300045836 Bacteria 1658
165 Ga0466967_0007277 3300045976 Bacteria 7966
166 Ga0466967_0035378 3300045976 Bacteria 4251
167 Ga0466967_0064153 3300045976 Bacteria 3266
168 Ga0466967_0064294 3300045976 Bacteria 3263
169 Ga0466967_0096698 3300045976 Bacteria 2694
170 Ga0466967_0124098 3300045976 Bacteria 2390
171 Ga0466967_0132118 3300045976 Bacteria 2318
172 Ga0466967_0235822 3300045976 Bacteria 1743
173 Ga0466967_0375201 3300045976 Bacteria 1380
174 Ga0466967_0672270 3300045976 Bacteria 1025
175 Ga0466967_0709427 3300045976 Bacteria 996
176 Ga0466967_2084194 3300045976 Bacteria 563
177 Ga0495592_0002646 3300046454 Bacteria 12663
178 Ga0495592_0062141 3300046454 Bacteria 2743
179 Ga0495592_0230667 3300046454 Bacteria 1233
180 Ga0495603_0018785 3300046455 Bacteria 4184
181 Ga0495603_0477678 3300046455 Bacteria 714
182 Ga0495629_0022223 3300046459 Bacteria 4523
183 Ga0495629_0503357 3300046459 Bacteria 817
184 Ga0495641_0004505 3300046461 Bacteria 9809
185 Ga0495641_0036925 3300046461 Bacteria 2293
186 Ga0495641_0111730 3300046461 Bacteria 1219
187 Ga0495641_0206260 3300046461 Bacteria 881
188 Ga0495651_0000001 3300046462 Bacteria 210544
189 Ga0495651_0598986 3300046462 Bacteria 695
190 Ga0495653_0013329 3300046463 Bacteria 6700
191 Ga0495653_0038510 3300046463 Bacteria 3753
192 Ga0495653_0154130 3300046463 Bacteria 1602
193 Ga0495582_0001173 3300046473 Bacteria 14756
194 Ga0495582_0027206 3300046473 Bacteria 3134
195 Ga0495582_0028894 3300046473 Bacteria 3044
196 Ga0495639_0005108 3300046475 Bacteria 5635
197 Ga0495662_0005341 3300046476 Bacteria 6435
198 Ga0495662_0187484 3300046476 Bacteria 1020
199 Ga0495664_0124606 3300046477 Bacteria 1558
200 Ga0495664_0163809 3300046477 Bacteria 1349
201 Ga0495664_0257973 3300046477 Bacteria 1054
202 Ga0495584_0339895 3300046491 Archaea 762
203 Ga0495594_0236279 3300046499 Bacteria 1042
204 Ga0495594_0603782 3300046499 Bacteria 622
205 Ga0495607_0051994 3300046501 Bacteria 2375
206 Ga0495608_0047476 3300046511 Bacteria 2855
207 Ga0495618_0088736 3300046514 Bacteria 1977
208 Ga0495618_0092065 3300046514 Bacteria 1938
209 Ga0495618_0092595 3300046514 Bacteria 1932
210 Ga0495628_0000912 3300046516 Bacteria 27120
211 Ga0495628_0144490 3300046516 Bacteria 1814
212 Ga0495628_0436550 3300046516 Bacteria 952
213 Ga0495630_0017457 3300046517 Bacteria 5257
214 Ga0495630_0165549 3300046517 Bacteria 1683
215 Ga0495637_0143214 3300046520 Archaea 906
216 Ga0495644_0004377 3300046523 Bacteria 5548
217 Ga0495666_0042918 3300046526 Bacteria 2185
218 Ga0495652_0000015 3300046529 Bacteria 222624
219 Ga0495652_0290231 3300046529 Bacteria 1194
220 Ga0495665_0000389 3300046531 Bacteria 22271
221 Ga0495640_0144155 3300046533 Bacteria 1533
222 Ga0495586_0008255 3300046535 Bacteria 5543
223 Ga0495586_0197244 3300046535 Bacteria 1141
224 Ga0495586_0331912 3300046535 Bacteria 872
225 Ga0495587_0000051 3300046536 Bacteria 101923
226 Ga0495587_0562404 3300046536 Bacteria 629
227 Ga0495609_0095514 3300046538 Archaea 1290
228 Ga0495645_0190840 3300046543 Bacteria 1396
229 Ga0495645_0193749 3300046543 Bacteria 1383
230 Ga0495667_0056534 3300046559 Bacteria 2580
231 Ga0495667_0072693 3300046559 Bacteria 2241
232 Ga0495656_0002665 3300046615 Bacteria 5959
233 Ga0495668_0156949 3300046616 Archaea 1246
234 Ga0495634_0010897 3300046642 Bacteria 6637
235 Ga0495634_0053056 3300046642 Bacteria 2716
236 Ga0495611_0007235 3300046648 Bacteria 4716
237 Ga0495635_0044712 3300046663 Bacteria 3054
238 Ga0495635_0185033 3300046663 Bacteria 1415
239 Ga0495659_0048941 3300046664 Bacteria 1533
240 Ga0495657_0015338 3300046675 Bacteria 5610
241 Ga0495657_0068957 3300046675 Bacteria 2315
242 Ga0495599_0000049 3300046678 Bacteria 84569
243 Ga0495599_0195497 3300046678 Bacteria 1243
244 Ga0495623_0000011 3300046679 Bacteria 120974
245 Ga0495646_0213175 3300046680 Bacteria 1047
246 Ga0495646_0505314 3300046680 Bacteria 620
247 Ga0495647_0000080 3300046681 Bacteria 23588
248 Ga0495613_0021437 3300046689 Bacteria 4815
249 Ga0495613_0033837 3300046689 Bacteria 3796
250 Ga0495613_0384933 3300046689 Unclassified 959
251 Ga0495613_0390051 3300046689 Bacteria 951
252 Ga0495624_0019508 3300046690 Bacteria 4523
253 Ga0495624_0759922 3300046690 Bacteria 574
254 Ga0495624_0783663 3300046690 Unclassified 564
255 Ga0495589_0164704 3300046794 Bacteria 1055
256 Ga0495600_0123526 3300046809 Bacteria 1683
257 Ga0495581_0002631 3300047315 Bacteria 10218
258 Ga0495581_0460718 3300047315 Bacteria 740
259 Ga0495604_0000004 3300047317 Bacteria 456385
260 Ga0495604_0048312 3300047317 Bacteria 3310
261 Ga0495674_0149828 3300047319 Bacteria 1956
262 Ga0495674_0173947 3300047319 Bacteria 1795
263 Ga0495674_0293118 3300047319 Unclassified 1330
264 Ga0495676_0003942 3300047321 Bacteria 13505
265 Ga0495676_0079679 3300047321 Bacteria 2489
266 Ga0495680_0005011 3300047322 Bacteria 12532
267 Ga0495680_0158159 3300047322 Bacteria 1647
268 Ga0495675_0000018 3300047444 Bacteria 115435
269 Ga0495684_0020456 3300047471 Bacteria 5100
270 Ga0495684_0027182 3300047471 Bacteria 4392
271 Ga0495684_0191436 3300047471 Bacteria 1512
272 Ga0495593_0000271 3300047673 Bacteria 28123
273 Ga0495602_0002551 3300048088 Bacteria 18558
274 Ga0495614_0002415 3300048089 Bacteria 8301
275 Ga0496100_0009659 3300048903 Bacteria 5425
276 Ga0496100_0411581 3300048903 Bacteria 1031
277 Ga0496100_0483360 3300048903 Bacteria 953
278 Ga0496100_0566852 3300048903 Bacteria 880
279 Ga0496101_0083518 3300048904 Bacteria 2364
280 Ga0496102_0637525 3300048905 Bacteria 989
281 Ga0496103_0279759 3300048906 Bacteria 1073
282 Ga0496104_0297461 3300048907 Bacteria 1526
283 Ga0496104_0680734 3300048907 Unclassified 937
284 Ga0496106_0010587 3300048909 Bacteria 6812
285 Ga0496106_1361314 3300048909 Unclassified 549
286 Ga0496107_0013726 3300048910 Bacteria 5665
287 Ga0496107_0383231 3300048910 Unclassified 1046
288 Ga0496108_0015036 3300048911 Bacteria 6318
289 Ga0496108_0133351 3300048911 Bacteria 2135
290 Ga0496108_0304074 3300048911 Bacteria 1389
291 Ga0496109_0287552 3300048912 Bacteria 1550
292 Ga0496110_1071485 3300048913 Unclassified 714
293 Ga0496111_0279472 3300048914 Bacteria 1238
294 Ga0496112_0201230 3300048915 Bacteria 1951
295 Ga0496112_0217177 3300048915 Bacteria 1868
296 Ga0496113_0357028 3300048916 Bacteria 1172
297 Ga0496114_0018514 3300048917 Bacteria 5632
298 Ga0496114_0107791 3300048917 Bacteria 2384
299 Ga0496114_0513316 3300048917 Unclassified 1060
300 Ga0496115_0010071 3300048918 Bacteria 7047
301 Ga0496115_0115975 3300048918 Bacteria 2202
302 Ga0501067_0321933 3300049583 Unclassified 861
303 nmdc:mga0n895_19593_c1 3300050512 Bacteria 6290
304 nmdc:mga0a205_199910_c1 3300050515 Bacteria 1889
305 Ga0495601_0004398 3300053077 Bacteria 8143
306 Ga0495601_0045014 3300053077 Bacteria 2774
307 Ga0495601_0422266 3300053077 Bacteria 863
308 Ga0495612_0003235 3300053078 Bacteria 6755
309 Ga0495612_0041699 3300053078 Bacteria 1872
310 Ga0495595_0077796 3300053084 Bacteria 1576
311 Ga0495619_0001491 3300053085 Bacteria 15423
312 Ga0495619_0110240 3300053085 Bacteria 1880
313 Ga0495619_0159180 3300053085 Bacteria 1559
314 Ga0500566_0053750 3300053094 Bacteria 2298
315 Ga0466962_0001276 3300061719 Bacteria 11623
316 Ga0466962_0055380 3300061719 Bacteria 1895
317 Ga0466962_0116985 3300061719 Bacteria 1285
318 Ga0466962_0209409 3300061719 Bacteria 954
319 Ga0373926_0003757
320 Ga0070658_10038710
321 Ga0070683_100018340
322 Ga0070683_100639033
323 Ga0070680_100012301
324 Ga0070660_100002523
325 Ga0070661_100114110
326 Ga0070661_100497261
327 Ga0070671_100059165
328 Ga0070659_100273554
329 Ga0070714_100140878
330 Ga0070714_100158704
331 Ga0070714_101214107
332 Ga0070713_100051847
333 Ga0070713_100279657
334 Ga0070710_10657117
335 Ga0070711_100012709
336 Ga0070711_100482897
337 Ga0070705_100224120
338 Ga0070681_10048792
339 Ga0070681_10206674
340 Ga0070707_100268518
341 Ga0070698_100485345
342 Ga0070679_100415612
343 Ga0070684_100151802
344 Ga0070684_100440866
345 Ga0070686_100552356
346 Ga0070696_100875582
347 Ga0070704_100027293
348 Ga0068855_101367264
349 Ga0068856_100045358
350 Ga0068856_101257007
351 Ga0068864_100385022
352 Ga0070717_10091619
353 Ga0070717_10096418
354 Ga0070715_10003096
355 Ga0070715_10738496
356 Ga0070716_100149136
357 Ga0070712_100155947
358 Ga0070712_100234916
359 Ga0068871_100333172
360 Ga0075434_100055737
361 Ga0105240_11342826
362 Ga0105245_10302233
363 Ga0105245_10488725
364 Ga0105247_10326916
365 Ga0105243_10425615
366 Ga0105242_10451628
367 Ga0105248_10376699
368 Ga0105248_10612604
369 Ga0105248_10633765
370 Ga0157369_10589532
371 Ga0157369_11327330
372 Ga0157374_10025723
373 Ga0157378_10555946
374 Ga0157372_10556343
375 Ga0157372_10997080
376 Ga0157375_10891017
377 Ga0182008_10001160
378 Ga0182008_10036238
379 Ga0182006_1007664
380 Ga0182007_10007106
381 Ga0206356_10194144
382 Ga0206356_10369856
383 Ga0206354_11283835
384 Ga0206353_10565503
385 Ga0206353_11581275
386 Ga0224712_10026103
387 Ga0207692_10418057
388 Ga0207699_10089123
389 Ga0207705_10067101
390 Ga0207707_10022659
391 Ga0207695_11068000
392 Ga0207693_10001610
393 Ga0207663_10013731
394 Ga0207660_10015704
395 Ga0207657_10006039
396 Ga0207657_10455879
397 Ga0207649_10117094
398 Ga0207649_10711935
399 Ga0207652_10125358
400 Ga0207652_10289768
401 Ga0207646_10004578
402 Ga0207646_10184587
403 Ga0207687_10418942
404 Ga0207700_10031410
405 Ga0207700_10053348
406 Ga0207664_10011345
407 Ga0207664_10021564
408 Ga0207664_10035201
409 Ga0207664_10650435
410 Ga0207686_10600304
411 Ga0207665_10256631
412 Ga0207711_10483307
413 Ga0207661_10033059
414 Ga0207661_10700959
415 Ga0207640_10906765
416 Ga0207639_10307190
417 Ga0207702_10086773
418 Ga0207676_10737285
419 Ga0265337_1026752
420 Ga0265334_10005437
421 Ga0265318_10124020
422 Ga0265322_10067628
423 Ga0265336_10041790
424 Ga0265338_10002401
425 Ga0265324_10045619
426 Ga0265313_10011277
427 Ga0373944_0032053
428 Ga0373936_0138055
429 Ga0373945_0022014
430 Ga0373957_0240992
431 Ga0373960_0052737
432 Ga0373943_0002222
433 Ga0373943_0081518
434 Ga0373946_0004761
435 Ga0373955_0486119
436 Ga0373924_0183954
437 Ga0373931_0722919
438 Ga0373935_0250025
439 Ga0373947_0010222
440 Ga0373937_0000828
441 Ga0373925_0000642
442 Ga0466969_0010666
443 Ga0466969_0391640
444 Ga0466965_0051636
445 Ga0466965_0061802
446 Ga0466966_0111470
447 Ga0466961_0024150
448 Ga0466961_0519182
449 Ga0466963_0000956
450 Ga0466963_0007973
451 Ga0466963_0009883
452 Ga0466963_0038224
453 Ga0466963_0050228
454 Ga0466963_0132837
455 Ga0466964_0008560
456 Ga0466964_0041137
457 Ga0466964_0070754
458 Ga0466964_0076017
459 Ga0466964_0086580
460 Ga0466964_0214802
461 Ga0466971_0005306
462 Ga0466971_0201885
463 Ga0466968_0000868
464 Ga0466968_0130922
465 Ga0466968_0161794
466 Ga0466968_0220588
467 Ga0466970_0014789
468 Ga0466970_0057552
469 Ga0466970_0068535
470 Ga0466957_0002743
471 Ga0466957_0003162
472 Ga0466957_0005070
473 Ga0466957_0108617
474 Ga0466957_0192032
475 Ga0466960_0020466
476 Ga0466960_0093827
477 Ga0466959_0034316
478 Ga0466958_0000455
479 Ga0466958_0004315
480 Ga0466958_0014375
481 Ga0466958_0073968
482 Ga0466958_0118206
483 Ga0466967_0007277
484 Ga0466967_0035378
485 Ga0466967_0064153
486 Ga0466967_0064294
487 Ga0466967_0096698
488 Ga0466967_0124098
489 Ga0466967_0132118
490 Ga0466967_0235822
491 Ga0466967_0375201
492 Ga0466967_0672270
493 Ga0466967_0709427
494 Ga0466967_2084194
495 Ga0495592_0002646
496 Ga0495592_0062141
497 Ga0495592_0230667
498 Ga0495603_0018785
499 Ga0495603_0477678
500 Ga0495629_0022223
501 Ga0495629_0503357
502 Ga0495641_0004505
503 Ga0495641_0036925
504 Ga0495641_0111730
505 Ga0495641_0206260
506 Ga0495651_0000001
507 Ga0495651_0598986
508 Ga0495653_0013329
509 Ga0495653_0038510
510 Ga0495653_0154130
511 Ga0495582_0001173
512 Ga0495582_0027206
513 Ga0495582_0028894
514 Ga0495639_0005108
515 Ga0495662_0005341
516 Ga0495662_0187484
517 Ga0495664_0124606
518 Ga0495664_0163809
519 Ga0495664_0257973
520 Ga0495584_0339895
521 Ga0495594_0236279
522 Ga0495594_0603782
523 Ga0495607_0051994
524 Ga0495608_0047476
525 Ga0495618_0088736
526 Ga0495618_0092065
527 Ga0495618_0092595
528 Ga0495628_0000912
529 Ga0495628_0144490
530 Ga0495628_0436550
531 Ga0495630_0017457
532 Ga0495630_0165549
533 Ga0495637_0143214
534 Ga0495644_0004377
535 Ga0495666_0042918
536 Ga0495652_0000015
537 Ga0495652_0290231
538 Ga0495665_0000389
539 Ga0495640_0144155
540 Ga0495586_0008255
541 Ga0495586_0197244
542 Ga0495586_0331912
543 Ga0495587_0000051
544 Ga0495587_0562404
545 Ga0495609_0095514
546 Ga0495645_0190840
547 Ga0495645_0193749
548 Ga0495667_0056534
549 Ga0495667_0072693
550 Ga0495656_0002665
551 Ga0495668_0156949
552 Ga0495634_0010897
553 Ga0495634_0053056
554 Ga0495611_0007235
555 Ga0495635_0044712
556 Ga0495635_0185033
557 Ga0495659_0048941
558 Ga0495657_0015338
559 Ga0495657_0068957
560 Ga0495599_0000049
561 Ga0495599_0195497
562 Ga0495623_0000011
563 Ga0495646_0213175
564 Ga0495646_0505314
565 Ga0495647_0000080
566 Ga0495613_0021437
567 Ga0495613_0033837
568 Ga0495613_0384933
569 Ga0495613_0390051
570 Ga0495624_0019508
571 Ga0495624_0759922
572 Ga0495624_0783663
573 Ga0495589_0164704
574 Ga0495600_0123526
575 Ga0495581_0002631
576 Ga0495581_0460718
577 Ga0495604_0000004
578 Ga0495604_0048312
579 Ga0495674_0149828
580 Ga0495674_0173947
581 Ga0495674_0293118
582 Ga0495676_0003942
583 Ga0495676_0079679
584 Ga0495680_0005011
585 Ga0495680_0158159
586 Ga0495675_0000018
587 Ga0495684_0020456
588 Ga0495684_0027182
589 Ga0495684_0191436
590 Ga0495593_0000271
591 Ga0495602_0002551
592 Ga0495614_0002415
593 Ga0496100_0009659
594 Ga0496100_0411581
595 Ga0496100_0483360
596 Ga0496100_0566852
597 Ga0496101_0083518
598 Ga0496102_0637525
599 Ga0496103_0279759
600 Ga0496104_0297461
601 Ga0496104_0680734
602 Ga0496106_0010587
603 Ga0496106_1361314
604 Ga0496107_0013726
605 Ga0496107_0383231
606 Ga0496108_0015036
607 Ga0496108_0133351
608 Ga0496108_0304074
609 Ga0496109_0287552
610 Ga0496110_1071485
611 Ga0496111_0279472
612 Ga0496112_0201230
613 Ga0496112_0217177
614 Ga0496113_0357028
615 Ga0496114_0018514
616 Ga0496114_0107791
617 Ga0496114_0513316
618 Ga0496115_0010071
619 Ga0496115_0115975
620 Ga0501067_0321933
621 nmdc:mga0n895_19593_c1
622 nmdc:mga0a205_199910_c1
623 Ga0495601_0004398
624 Ga0495601_0045014
625 Ga0495601_0422266
626 Ga0495612_0003235
627 Ga0495612_0041699
628 Ga0495595_0077796
629 Ga0495619_0001491
630 Ga0495619_0110240
631 Ga0495619_0159180
632 Ga0500566_0053750
633 Ga0466962_0001276
634 Ga0466962_0055380
635 Ga0466962_0116985
636 Ga0466962_0209409

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13523

Acetyltransf_8

Acetyltransferase (GNAT) domain

36

159

0.9

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

28

152

0.88

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

40

151

0.86

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

44

165

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qc6-assembly2.cif.gz_B crystal structure of aminoglycoside 6'-acetyltransferase-ie 0.8653 2 154
6bfh-assembly1.cif.gz_A structure of the kanamycin complex of aminoglycoside acetyltransferase aac(6')-im 0.8572 5 154
2vqy-assembly1.cif.gz_A structure of aac(6')-ib in complex with parmomycin and acetylcoa. 0.8536 7 156
2prb-assembly1.cif.gz_A crystal structure of aminoglycoside acetyltransferase aac(6')-ib in complex whith coenzyme a 0.8523 9 156
2bue-assembly1.cif.gz_A structure of aac(6')-ib in complex with ribostamycin and coenzyme a. 0.8513 7 156
ID Description Score Start End Superfamily
af_Q3UG98_3_169_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8912 2 135 3.40.630.30
af_Q9BKR0_4_172_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8607 2 127 3.40.630.30
6bfhA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8572 5 154 3.40.630.30
af_I1NC58_2_165_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8551 8 152 3.40.630.30
af_Q54VL6_2_179_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8503 1 156 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A537ZTG9-F1-model_v4 Lysine N-acyltransferase MbtK (Mycobactin synthase protein K) 0.9583 1 157 GO:0016410
GO:0019290
GO:0046677
AF-F8UVN4-F1-model_v4 Aminoglycoside 6'-N-acetyltransferase 0.9572 9 154 GO:0016747
GO:0019290
AF-A0A7Y6CEY6-F1-model_v4 GNAT family N-acetyltransferase 0.955 3 157 GO:0016410
GO:0046677
AF-A0A537ZTG9-F1-model_v4 Lysine N-acyltransferase MbtK (Mycobactin synthase protein K) 0.9524 1 157 GO:0016410
GO:0019290
GO:0046677
AF-F8UVN4-F1-model_v4 Aminoglycoside 6'-N-acetyltransferase 0.9382 9 154 GO:0016747
GO:0019290

Map