F404668

General Info

Members Datasets Scaffolds Average Seq Length
318 162 636 328

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10065635|Ga0265338_100656352
Length 376
Sequence MWGQPPSAVRRTEGDDTCPRCYHEAVQPLLDVRKLNIEFPIQQANLAAGQPLRLRSGQAKAAVPTQALTAVRDLSFSLAPGEVLGLVGESGSGKSITSLAIMRLLPPQARVSGEILFTQNGAGPRNLPTLEDDAMRQLRGSRIAMIFQEPMTALNPVMRVGEQIAEAVVAHNAVSKRDAWQRTVDAMNDVAIPDAARRARDYPHQLSGGMRQRIMIAMAIVNRPQLLIADEPTTALDVTIQAQILDLLAELRAKFGLAMLFISHDLAVVSRVADRVAVMYSGSLVELGAKHDIFQAPAHPYTRGLLHAVPNLKTDRARPLQTIEGTVPALHALPPGCNFEPRCEFRIPACARELPALVEISAGHWARCPVVNSPAQ

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
67 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
68 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
112 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
113 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 1.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.52
Rhizosphere 97.17
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10065635 3300028800 Bacteria 3146
2 LJNas_1001264 3300000546 Bacteria 3769
3 Ga0070683_100050792 3300005329 Bacteria 3840
4 Ga0070670_100002239 3300005331 Bacteria 15901
5 Ga0068869_100002389 3300005334 Bacteria 11310
6 Ga0068869_100013565 3300005334 Bacteria 5423
7 Ga0070680_100144862 3300005336 Bacteria 1993
8 Ga0068868_100006886 3300005338 Bacteria 8074
9 Ga0068868_100010204 3300005338 Bacteria 6789
10 Ga0070660_100011236 3300005339 Bacteria 6356
11 Ga0070660_100112734 3300005339 Bacteria 2165
12 Ga0070661_100053058 3300005344 Bacteria 2967
13 Ga0070661_100255213 3300005344 Bacteria 1354
14 Ga0070673_100218036 3300005364 Bacteria 1650
15 Ga0070709_10001321 3300005434 Bacteria 13519
16 Ga0070709_10055996 3300005434 Bacteria 2492
17 Ga0070714_100001259 3300005435 Bacteria 18292
18 Ga0070714_100048040 3300005435 Bacteria 3628
19 Ga0070714_100048860 3300005435 Bacteria 3600
20 Ga0070714_100089137 3300005435 Bacteria 2700
21 Ga0070713_100000207 3300005436 Bacteria 39199
22 Ga0070713_100001384 3300005436 Bacteria 15526
23 Ga0070713_100002684 3300005436 Bacteria 11605
24 Ga0070713_100043646 3300005436 Bacteria 3667
25 Ga0070713_100072715 3300005436 Bacteria 2909
26 Ga0070713_100074813 3300005436 Bacteria 2871
27 Ga0070713_100405473 3300005436 Bacteria 1274
28 Ga0070713_100445063 3300005436 Bacteria 1216
29 Ga0070710_10107630 3300005437 Bacteria 1670
30 Ga0070711_100001041 3300005439 Bacteria 14765
31 Ga0070708_100000719 3300005445 Bacteria 25112
32 Ga0070708_100058897 3300005445 Bacteria 3423
33 Ga0070708_100066154 3300005445 Bacteria 3243
34 Ga0070708_100069615 3300005445 Bacteria 3165
35 Ga0070708_100271858 3300005445 Bacteria 1594
36 Ga0070708_100275441 3300005445 Bacteria 1583
37 Ga0070708_100328262 3300005445 Bacteria 1441
38 Ga0070678_100127027 3300005456 Bacteria 2020
39 Ga0070681_10006674 3300005458 Bacteria 11229
40 Ga0070706_100000556 3300005467 Bacteria 43474
41 Ga0070706_100069611 3300005467 Bacteria 3254
42 Ga0070707_100022129 3300005468 Bacteria 6010
43 Ga0070707_100033345 3300005468 Bacteria 4910
44 Ga0070707_100062769 3300005468 Bacteria 3565
45 Ga0070707_100084635 3300005468 Bacteria 3064
46 Ga0070707_100386272 3300005468 Bacteria 1360
47 Ga0070698_100002213 3300005471 Bacteria 21527
48 Ga0070698_100080405 3300005471 Bacteria 3254
49 Ga0070699_100000177 3300005518 Bacteria 61679
50 Ga0070699_100043256 3300005518 Bacteria 3899
51 Ga0070699_100109128 3300005518 Bacteria 2428
52 Ga0070679_100107323 3300005530 Bacteria 2778
53 Ga0070684_100039535 3300005535 Bacteria 4058
54 Ga0070684_100285488 3300005535 Bacteria 1513
55 Ga0070684_100306325 3300005535 Bacteria 1458
56 Ga0070697_100000324 3300005536 Bacteria 37814
57 Ga0070697_100000670 3300005536 Bacteria 25765
58 Ga0070697_100019021 3300005536 Bacteria 5419
59 Ga0070697_100022677 3300005536 Bacteria 4987
60 Ga0070696_100028416 3300005546 Bacteria 3817
61 Ga0070693_100025767 3300005547 Bacteria 3167
62 Ga0070665_100216683 3300005548 Bacteria 1915
63 Ga0068855_100002998 3300005563 Bacteria 20641
64 Ga0068855_100007501 3300005563 Bacteria 13205
65 Ga0068855_100145430 3300005563 Bacteria 2699
66 Ga0068855_100271010 3300005563 Bacteria 1887
67 Ga0070664_100001009 3300005564 Bacteria 22089
68 Ga0070664_100036248 3300005564 Bacteria 4144
69 Ga0068857_100004121 3300005577 Bacteria 12246
70 Ga0068857_100082065 3300005577 Bacteria 2880
71 Ga0068854_100032931 3300005578 Bacteria 3610
72 Ga0068854_100068231 3300005578 Bacteria 2592
73 Ga0068856_100000220 3300005614 Bacteria 61662
74 Ga0068856_100003966 3300005614 Bacteria 14825
75 Ga0068856_100007794 3300005614 Bacteria 10458
76 Ga0068856_100104509 3300005614 Bacteria 2826
77 Ga0068856_100143793 3300005614 Bacteria 2393
78 Ga0068856_100282285 3300005614 Bacteria 1677
79 Ga0068852_100044228 3300005616 Bacteria 3781
80 Ga0068859_100005461 3300005617 Bacteria 12930
81 Ga0068864_100003688 3300005618 Bacteria 12648
82 Ga0068864_100020541 3300005618 Bacteria 5526
83 Ga0068866_10002814 3300005718 Bacteria 7165
84 Ga0068866_10090218 3300005718 Bacteria 1667
85 Ga0068863_100007048 3300005841 Bacteria 11015
86 Ga0068863_100066666 3300005841 Bacteria 3405
87 Ga0068863_100093057 3300005841 Bacteria 2861
88 Ga0068863_100209695 3300005841 Bacteria 1876
89 Ga0068858_100000985 3300005842 Bacteria 29388
90 Ga0068858_100009993 3300005842 Bacteria 9012
91 Ga0068860_100024388 3300005843 Bacteria 5844
92 Ga0081540_1061097 3300005983 Bacteria 1798
93 Ga0070717_10003527 3300006028 Bacteria 11213
94 Ga0070717_10004670 3300006028 Bacteria 9940
95 Ga0070717_10005386 3300006028 Bacteria 9339
96 Ga0070717_10007237 3300006028 Bacteria 8231
97 Ga0070717_10007416 3300006028 Bacteria 8145
98 Ga0070717_10007569 3300006028 Bacteria 8071
99 Ga0070717_10027665 3300006028 Bacteria 4532
100 Ga0070717_10113784 3300006028 Bacteria 2311
101 Ga0070717_10123253 3300006028 Bacteria 2222
102 Ga0070717_10173748 3300006028 Bacteria 1875
103 Ga0070716_100003788 3300006173 Bacteria 7170
104 Ga0070716_100006101 3300006173 Bacteria 5876
105 Ga0070716_100180213 3300006173 Bacteria 1386
106 Ga0070712_100001176 3300006175 Bacteria 15816
107 Ga0070712_100001429 3300006175 Bacteria 14560
108 Ga0070712_100070451 3300006175 Bacteria 2498
109 Ga0070712_100136725 3300006175 Bacteria 1864
110 Ga0097621_100000073 3300006237 Bacteria 52012
111 Ga0097621_100029505 3300006237 Bacteria 4333
112 Ga0068871_100001411 3300006358 Bacteria 16074
113 Ga0075433_10002035 3300006852 Bacteria 15272
114 Ga0075434_100000473 3300006871 Bacteria 30035
115 Ga0068865_100019767 3300006881 Bacteria 4361
116 Ga0068865_100046954 3300006881 Bacteria 2965
117 Ga0075436_100000264 3300006914 Bacteria 32917
118 Ga0075436_100006503 3300006914 Bacteria 8006
119 Ga0097620_100005461 3300006931 Bacteria 12930
120 Ga0075435_100000225 3300007076 Bacteria 34537
121 Ga0105240_10022691 3300009093 Bacteria 8316
122 Ga0105240_10158609 3300009093 Bacteria 2689
123 Ga0114129_10272251 3300009147 Bacteria 2265
124 Ga0105241_10245294 3300009174 Bacteria 1516
125 Ga0105237_10210436 3300009545 Bacteria 1945
126 Ga0105238_10090184 3300009551 Bacteria 3053
127 Ga0105239_10159653 3300010375 Bacteria 2518
128 Ga0105246_10098896 3300011119 Bacteria 2120
129 Ga0157369_10001413 3300013105 Bacteria 29512
130 Ga0157369_10082278 3300013105 Bacteria 3444
131 Ga0157369_10442900 3300013105 Bacteria 1345
132 Ga0157374_10011824 3300013296 Bacteria 7571
133 Ga0163162_10004993 3300013306 Bacteria 12784
134 Ga0157372_10058103 3300013307 Bacteria 4324
135 Ga0157372_10144534 3300013307 Bacteria 2743
136 Ga0157372_10152293 3300013307 Bacteria 2670
137 Ga0163163_10002455 3300014325 Bacteria 15673
138 Ga0163163_10035792 3300014325 Bacteria 4819
139 Ga0157379_10032014 3300014968 Bacteria 4687
140 Ga0224569_100034 3300022732 Bacteria 8309
141 Ga0224572_1002288 3300024225 Bacteria 3063
142 Ga0228598_1000341 3300024227 Bacteria 9190
143 Ga0228598_1004459 3300024227 Bacteria 2965
144 Ga0228598_1015317 3300024227 Bacteria 1514
145 Ga0207642_10003154 3300025899 Bacteria 5171
146 Ga0207647_10094647 3300025904 Bacteria 1779
147 Ga0207699_10000785 3300025906 Bacteria 15207
148 Ga0207699_10049467 3300025906 Bacteria 2475
149 Ga0207645_10106657 3300025907 Bacteria 1811
150 Ga0207684_10000395 3300025910 Bacteria 58309
151 Ga0207684_10001376 3300025910 Bacteria 26500
152 Ga0207707_10036351 3300025912 Bacteria 4306
153 Ga0207707_10264676 3300025912 Bacteria 1491
154 Ga0207695_10023989 3300025913 Bacteria 6878
155 Ga0207695_10041426 3300025913 Bacteria 4929
156 Ga0207695_10045304 3300025913 Bacteria 4670
157 Ga0207695_10048612 3300025913 Bacteria 4478
158 Ga0207693_10000092 3300025915 Bacteria 80077
159 Ga0207693_10000672 3300025915 Bacteria 30694
160 Ga0207693_10009489 3300025915 Bacteria 7925
161 Ga0207693_10012021 3300025915 Bacteria 6999
162 Ga0207663_10012625 3300025916 Bacteria 4573
163 Ga0207662_10055893 3300025918 Unclassified 2356
164 Ga0207657_10007511 3300025919 Bacteria 11172
165 Ga0207649_10007782 3300025920 Bacteria 5829
166 Ga0207649_10048913 3300025920 Bacteria 2609
167 Ga0207652_10239942 3300025921 Bacteria 1634
168 Ga0207646_10000341 3300025922 Bacteria 63056
169 Ga0207646_10037497 3300025922 Bacteria 4370
170 Ga0207646_10082411 3300025922 Bacteria 2876
171 Ga0207646_10166981 3300025922 Bacteria 1987
172 Ga0207646_10253179 3300025922 Bacteria 1591
173 Ga0207646_10391463 3300025922 Bacteria 1255
174 Ga0207700_10000938 3300025928 Bacteria 16771
175 Ga0207700_10003113 3300025928 Bacteria 9587
176 Ga0207700_10014955 3300025928 Bacteria 5101
177 Ga0207700_10023813 3300025928 Bacteria 4230
178 Ga0207700_10298394 3300025928 Bacteria 1391
179 Ga0207700_10309966 3300025928 Bacteria 1365
180 Ga0207664_10064884 3300025929 Bacteria 2922
181 Ga0207664_10081246 3300025929 Bacteria 2637
182 Ga0207664_10180166 3300025929 Bacteria 1813
183 Ga0207664_10195493 3300025929 Bacteria 1743
184 Ga0207664_10253251 3300025929 Bacteria 1537
185 Ga0207664_10332803 3300025929 Bacteria 1342
186 Ga0207704_10031802 3300025938 Bacteria 2978
187 Ga0207665_10007761 3300025939 Bacteria 7082
188 Ga0207665_10102686 3300025939 Bacteria 1998
189 Ga0207711_10033416 3300025941 Bacteria 4352
190 Ga0207711_10092630 3300025941 Bacteria 2660
191 Ga0207689_10001859 3300025942 Bacteria 19991
192 Ga0207689_10038826 3300025942 Bacteria 3942
193 Ga0207661_10034520 3300025944 Bacteria 3935
194 Ga0207661_10041609 3300025944 Bacteria 3618
195 Ga0207679_10016779 3300025945 Bacteria 4867
196 Ga0207667_10003403 3300025949 Bacteria 19636
197 Ga0207667_10014294 3300025949 Bacteria 9053
198 Ga0207667_10098195 3300025949 Bacteria 3022
199 Ga0207640_10023841 3300025981 Bacteria 3684
200 Ga0207640_10030421 3300025981 Bacteria 3325
201 Ga0207677_10001637 3300026023 Bacteria 11873
202 Ga0207677_10013135 3300026023 Bacteria 4787
203 Ga0207677_10018810 3300026023 Bacteria 4155
204 Ga0207703_10007804 3300026035 Bacteria 8468
205 Ga0207703_10015114 3300026035 Bacteria 6025
206 Ga0207703_10063114 3300026035 Bacteria 3037
207 Ga0207639_10381207 3300026041 Bacteria 1266
208 Ga0207702_10000764 3300026078 Bacteria 34175
209 Ga0207702_10002392 3300026078 Bacteria 17865
210 Ga0207702_10160448 3300026078 Bacteria 2053
211 Ga0207702_10241666 3300026078 Bacteria 1692
212 Ga0207702_10267154 3300026078 Bacteria 1612
213 Ga0207641_10046890 3300026088 Bacteria 3643
214 Ga0207641_10130960 3300026088 Bacteria 2252
215 Ga0207641_10199618 3300026088 Bacteria 1843
216 Ga0207676_10005532 3300026095 Bacteria 8943
217 Ga0207674_10000281 3300026116 Bacteria 64232
218 Ga0207674_10010947 3300026116 Bacteria 10209
219 Ga0207674_10076245 3300026116 Bacteria 3361
220 Ga0207675_100122733 3300026118 Bacteria 2459
221 Ga0207698_10199669 3300026142 Bacteria 1789
222 Ga0207698_10314868 3300026142 Bacteria 1463
223 Ga0265356_1000062 3300028017 Bacteria 17622
224 Ga0268264_10014513 3300028381 Bacteria 6473
225 Ga0268264_10092236 3300028381 Bacteria 2614
226 Ga0265338_10021813 3300028800 Bacteria 6657
227 Ga0265338_10062248 3300028800 Bacteria 3262
228 Ga0265338_10197196 3300028800 Bacteria 1521
229 Ga0265762_1002533 3300030760 Bacteria 3295
230 Ga0265762_1008770 3300030760 Bacteria 1800
231 Ga0265760_10000528 3300031090 Bacteria 10748
232 Ga0265760_10019108 3300031090 Bacteria 1974
233 Ga0265328_10039770 3300031239 Bacteria 1734
234 Ga0265340_10012084 3300031247 Bacteria 4567
235 Ga0265339_10013449 3300031249 Bacteria 4958
236 Ga0265339_10013879 3300031249 Bacteria 4873
237 Ga0265339_10021913 3300031249 Bacteria 3708
238 Ga0265339_10033199 3300031249 Bacteria 2907
239 Ga0265316_10002149 3300031344 Bacteria 20719
240 Ga0265316_10030048 3300031344 Bacteria 4460
241 Ga0265316_10119885 3300031344 Bacteria 1987
242 Ga0265314_10003004 3300031711 Bacteria 16674
243 Ga0316214_1003205 3300033545 Bacteria 2056
244 Ga0373934_0023288 3300035086 Bacteria 2393
245 Ga0373944_0007769 3300035089 Bacteria 2882
246 Ga0373923_0004105 3300035111 Bacteria 4790
247 Ga0373943_0000034 3300035170 Bacteria 45727
248 Ga0373943_0024481 3300035170 Bacteria 2815
249 Ga0373946_0020861 3300035171 Bacteria 2536
250 Ga0373955_0052461 3300035172 Bacteria 2225
251 Ga0373955_0132271 3300035172 Bacteria 1457
252 Ga0373927_0000967 3300035695 Bacteria 21803
253 Ga0373927_0195505 3300035695 Bacteria 1327
254 Ga0373933_0184833 3300035724 Bacteria 1330
255 Ga0373947_0001533 3300035725 Bacteria 14167
256 Ga0373937_0022171 3300036401 Bacteria 5706
257 Ga0373937_0084532 3300036401 Bacteria 2936
258 Ga0373937_0109072 3300036401 Bacteria 2574
259 Ga0373937_0232794 3300036401 Bacteria 1735
260 Ga0373925_0000695 3300037068 Bacteria 31483
261 Ga0373925_0007502 3300037068 Bacteria 7951
262 Ga0373925_0016059 3300037068 Bacteria 5421
263 Ga0373925_0025818 3300037068 Bacteria 4295
264 Ga0373925_0107032 3300037068 Bacteria 2156
265 Ga0436360_0229941 3300039438 Bacteria 1340
266 Ga0451577_0000331 3300042876 Bacteria 88029
267 Ga0453683_0137532 3300044673 Bacteria 1541
268 Ga0466966_0050977 3300044684 Bacteria 2632
269 Ga0466963_0014685 3300044694 Bacteria 4833
270 Ga0453684_0000429 3300044712 Bacteria 171513
271 Ga0466968_0033260 3300044735 Bacteria 2149
272 Ga0451576_0011790 3300045051 Bacteria 9900
273 Ga0451576_0040351 3300045051 Bacteria 4942
274 Ga0451576_0069427 3300045051 Bacteria 3667
275 Ga0466967_0002825 3300045976 Bacteria 11015
276 Ga0466967_0059326 3300045976 Bacteria 3386
277 Ga0495629_0057914 3300046459 Bacteria 2708
278 Ga0495580_0000038 3300046472 Bacteria 71800
279 Ga0495580_0000343 3300046472 Bacteria 37952
280 Ga0495580_0000525 3300046472 Bacteria 32345
281 Ga0495580_0014108 3300046472 Bacteria 6074
282 Ga0495580_0097787 3300046472 Bacteria 2042
283 Ga0495582_0007872 3300046473 Bacteria 5889
284 Ga0495664_0028955 3300046477 Bacteria 3237
285 Ga0495664_0281505 3300046477 Bacteria 1005
286 Ga0495628_0200919 3300046516 Bacteria 1502
287 Ga0495630_0271384 3300046517 Bacteria 1296
288 Ga0495665_0078446 3300046531 Bacteria 1737
289 Ga0495645_0031313 3300046543 Bacteria 3876
290 Ga0495667_0067040 3300046559 Bacteria 2346
291 Ga0495635_0178037 3300046663 Bacteria 1446
292 Ga0495623_0028472 3300046679 Bacteria 3594
293 Ga0495658_0025267 3300046683 Bacteria 3173
294 Ga0495669_0006484 3300046684 Bacteria 4889
295 Ga0495581_0003722 3300047315 Bacteria 8785
296 Ga0495674_0008611 3300047319 Bacteria 9706
297 Ga0495674_0034435 3300047319 Bacteria 4581
298 Ga0495674_0126116 3300047319 Bacteria 2160
299 Ga0495593_0040548 3300047673 Bacteria 2507
300 Ga0495602_0173638 3300048088 Bacteria 1670
301 Ga0496100_0068471 3300048903 Bacteria 2361
302 Ga0496104_0034275 3300048907 Bacteria 4732
303 Ga0496107_0032587 3300048910 Bacteria 3725
304 Ga0496112_0003006 3300048915 Bacteria 13793
305 Ga0496112_0092997 3300048915 Bacteria 2985
306 Ga0496112_0424019 3300048915 Bacteria 1269
307 Ga0496113_0182470 3300048916 Bacteria 1664
308 Ga0496115_0010204 3300048918 Bacteria 7008
309 Ga0501083_0255202 3300049744 Bacteria 1141
310 nmdc:mga05p37_142257_c1 3300050507 Bacteria 2938
311 nmdc:mga0n895_138_c1 3300050512 Bacteria 43911
312 nmdc:mga0rr50_1174_c1 3300050513 Bacteria 14238
313 nmdc:mga08x19_147375_c1 3300050514 Bacteria 1592
314 nmdc:mga08x19_24427_c1 3300050514 Bacteria 3756
315 nmdc:mga08x19_7883_c1 3300050514 Bacteria 6325
316 nmdc:mga0a205_678_c1 3300050515 Bacteria 10078
317 Ga0495601_0151352 3300053077 Bacteria 1515
318 Ga0501084_0060011 3300054114 Bacteria 3185
319 Ga0265338_10065635
320 LJNas_1001264
321 Ga0070683_100050792
322 Ga0070670_100002239
323 Ga0068869_100002389
324 Ga0068869_100013565
325 Ga0070680_100144862
326 Ga0068868_100006886
327 Ga0068868_100010204
328 Ga0070660_100011236
329 Ga0070660_100112734
330 Ga0070661_100053058
331 Ga0070661_100255213
332 Ga0070673_100218036
333 Ga0070709_10001321
334 Ga0070709_10055996
335 Ga0070714_100001259
336 Ga0070714_100048040
337 Ga0070714_100048860
338 Ga0070714_100089137
339 Ga0070713_100000207
340 Ga0070713_100001384
341 Ga0070713_100002684
342 Ga0070713_100043646
343 Ga0070713_100072715
344 Ga0070713_100074813
345 Ga0070713_100405473
346 Ga0070713_100445063
347 Ga0070710_10107630
348 Ga0070711_100001041
349 Ga0070708_100000719
350 Ga0070708_100058897
351 Ga0070708_100066154
352 Ga0070708_100069615
353 Ga0070708_100271858
354 Ga0070708_100275441
355 Ga0070708_100328262
356 Ga0070678_100127027
357 Ga0070681_10006674
358 Ga0070706_100000556
359 Ga0070706_100069611
360 Ga0070707_100022129
361 Ga0070707_100033345
362 Ga0070707_100062769
363 Ga0070707_100084635
364 Ga0070707_100386272
365 Ga0070698_100002213
366 Ga0070698_100080405
367 Ga0070699_100000177
368 Ga0070699_100043256
369 Ga0070699_100109128
370 Ga0070679_100107323
371 Ga0070684_100039535
372 Ga0070684_100285488
373 Ga0070684_100306325
374 Ga0070697_100000324
375 Ga0070697_100000670
376 Ga0070697_100019021
377 Ga0070697_100022677
378 Ga0070696_100028416
379 Ga0070693_100025767
380 Ga0070665_100216683
381 Ga0068855_100002998
382 Ga0068855_100007501
383 Ga0068855_100145430
384 Ga0068855_100271010
385 Ga0070664_100001009
386 Ga0070664_100036248
387 Ga0068857_100004121
388 Ga0068857_100082065
389 Ga0068854_100032931
390 Ga0068854_100068231
391 Ga0068856_100000220
392 Ga0068856_100003966
393 Ga0068856_100007794
394 Ga0068856_100104509
395 Ga0068856_100143793
396 Ga0068856_100282285
397 Ga0068852_100044228
398 Ga0068859_100005461
399 Ga0068864_100003688
400 Ga0068864_100020541
401 Ga0068866_10002814
402 Ga0068866_10090218
403 Ga0068863_100007048
404 Ga0068863_100066666
405 Ga0068863_100093057
406 Ga0068863_100209695
407 Ga0068858_100000985
408 Ga0068858_100009993
409 Ga0068860_100024388
410 Ga0081540_1061097
411 Ga0070717_10003527
412 Ga0070717_10004670
413 Ga0070717_10005386
414 Ga0070717_10007237
415 Ga0070717_10007416
416 Ga0070717_10007569
417 Ga0070717_10027665
418 Ga0070717_10113784
419 Ga0070717_10123253
420 Ga0070717_10173748
421 Ga0070716_100003788
422 Ga0070716_100006101
423 Ga0070716_100180213
424 Ga0070712_100001176
425 Ga0070712_100001429
426 Ga0070712_100070451
427 Ga0070712_100136725
428 Ga0097621_100000073
429 Ga0097621_100029505
430 Ga0068871_100001411
431 Ga0075433_10002035
432 Ga0075434_100000473
433 Ga0068865_100019767
434 Ga0068865_100046954
435 Ga0075436_100000264
436 Ga0075436_100006503
437 Ga0097620_100005461
438 Ga0075435_100000225
439 Ga0105240_10022691
440 Ga0105240_10158609
441 Ga0114129_10272251
442 Ga0105241_10245294
443 Ga0105237_10210436
444 Ga0105238_10090184
445 Ga0105239_10159653
446 Ga0105246_10098896
447 Ga0157369_10001413
448 Ga0157369_10082278
449 Ga0157369_10442900
450 Ga0157374_10011824
451 Ga0163162_10004993
452 Ga0157372_10058103
453 Ga0157372_10144534
454 Ga0157372_10152293
455 Ga0163163_10002455
456 Ga0163163_10035792
457 Ga0157379_10032014
458 Ga0224569_100034
459 Ga0224572_1002288
460 Ga0228598_1000341
461 Ga0228598_1004459
462 Ga0228598_1015317
463 Ga0207642_10003154
464 Ga0207647_10094647
465 Ga0207699_10000785
466 Ga0207699_10049467
467 Ga0207645_10106657
468 Ga0207684_10000395
469 Ga0207684_10001376
470 Ga0207707_10036351
471 Ga0207707_10264676
472 Ga0207695_10023989
473 Ga0207695_10041426
474 Ga0207695_10045304
475 Ga0207695_10048612
476 Ga0207693_10000092
477 Ga0207693_10000672
478 Ga0207693_10009489
479 Ga0207693_10012021
480 Ga0207663_10012625
481 Ga0207662_10055893
482 Ga0207657_10007511
483 Ga0207649_10007782
484 Ga0207649_10048913
485 Ga0207652_10239942
486 Ga0207646_10000341
487 Ga0207646_10037497
488 Ga0207646_10082411
489 Ga0207646_10166981
490 Ga0207646_10253179
491 Ga0207646_10391463
492 Ga0207700_10000938
493 Ga0207700_10003113
494 Ga0207700_10014955
495 Ga0207700_10023813
496 Ga0207700_10298394
497 Ga0207700_10309966
498 Ga0207664_10064884
499 Ga0207664_10081246
500 Ga0207664_10180166
501 Ga0207664_10195493
502 Ga0207664_10253251
503 Ga0207664_10332803
504 Ga0207704_10031802
505 Ga0207665_10007761
506 Ga0207665_10102686
507 Ga0207711_10033416
508 Ga0207711_10092630
509 Ga0207689_10001859
510 Ga0207689_10038826
511 Ga0207661_10034520
512 Ga0207661_10041609
513 Ga0207679_10016779
514 Ga0207667_10003403
515 Ga0207667_10014294
516 Ga0207667_10098195
517 Ga0207640_10023841
518 Ga0207640_10030421
519 Ga0207677_10001637
520 Ga0207677_10013135
521 Ga0207677_10018810
522 Ga0207703_10007804
523 Ga0207703_10015114
524 Ga0207703_10063114
525 Ga0207639_10381207
526 Ga0207702_10000764
527 Ga0207702_10002392
528 Ga0207702_10160448
529 Ga0207702_10241666
530 Ga0207702_10267154
531 Ga0207641_10046890
532 Ga0207641_10130960
533 Ga0207641_10199618
534 Ga0207676_10005532
535 Ga0207674_10000281
536 Ga0207674_10010947
537 Ga0207674_10076245
538 Ga0207675_100122733
539 Ga0207698_10199669
540 Ga0207698_10314868
541 Ga0265356_1000062
542 Ga0268264_10014513
543 Ga0268264_10092236
544 Ga0265338_10021813
545 Ga0265338_10062248
546 Ga0265338_10197196
547 Ga0265762_1002533
548 Ga0265762_1008770
549 Ga0265760_10000528
550 Ga0265760_10019108
551 Ga0265328_10039770
552 Ga0265340_10012084
553 Ga0265339_10013449
554 Ga0265339_10013879
555 Ga0265339_10021913
556 Ga0265339_10033199
557 Ga0265316_10002149
558 Ga0265316_10030048
559 Ga0265316_10119885
560 Ga0265314_10003004
561 Ga0316214_1003205
562 Ga0373934_0023288
563 Ga0373944_0007769
564 Ga0373923_0004105
565 Ga0373943_0000034
566 Ga0373943_0024481
567 Ga0373946_0020861
568 Ga0373955_0052461
569 Ga0373955_0132271
570 Ga0373927_0000967
571 Ga0373927_0195505
572 Ga0373933_0184833
573 Ga0373947_0001533
574 Ga0373937_0022171
575 Ga0373937_0084532
576 Ga0373937_0109072
577 Ga0373937_0232794
578 Ga0373925_0000695
579 Ga0373925_0007502
580 Ga0373925_0016059
581 Ga0373925_0025818
582 Ga0373925_0107032
583 Ga0436360_0229941
584 Ga0451577_0000331
585 Ga0453683_0137532
586 Ga0466966_0050977
587 Ga0466963_0014685
588 Ga0453684_0000429
589 Ga0466968_0033260
590 Ga0451576_0011790
591 Ga0451576_0040351
592 Ga0451576_0069427
593 Ga0466967_0002825
594 Ga0466967_0059326
595 Ga0495629_0057914
596 Ga0495580_0000038
597 Ga0495580_0000343
598 Ga0495580_0000525
599 Ga0495580_0014108
600 Ga0495580_0097787
601 Ga0495582_0007872
602 Ga0495664_0028955
603 Ga0495664_0281505
604 Ga0495628_0200919
605 Ga0495630_0271384
606 Ga0495665_0078446
607 Ga0495645_0031313
608 Ga0495667_0067040
609 Ga0495635_0178037
610 Ga0495623_0028472
611 Ga0495658_0025267
612 Ga0495669_0006484
613 Ga0495581_0003722
614 Ga0495674_0008611
615 Ga0495674_0034435
616 Ga0495674_0126116
617 Ga0495593_0040548
618 Ga0495602_0173638
619 Ga0496100_0068471
620 Ga0496104_0034275
621 Ga0496107_0032587
622 Ga0496112_0003006
623 Ga0496112_0092997
624 Ga0496112_0424019
625 Ga0496113_0182470
626 Ga0496115_0010204
627 Ga0501083_0255202
628 nmdc:mga05p37_142257_c1
629 nmdc:mga0n895_138_c1
630 nmdc:mga0rr50_1174_c1
631 nmdc:mga08x19_147375_c1
632 nmdc:mga08x19_24427_c1
633 nmdc:mga08x19_7883_c1
634 nmdc:mga0a205_678_c1
635 Ga0495601_0151352
636 Ga0501084_0060011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08352

oligo_HPY

Oligopeptide/dipeptide transporter, C-terminal region

285

350

0.98

PF00005

ABC_tran

ABC transporter

71

234

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.931 3 255
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.9299 3 274
5lj9-assembly3.cif.gz_C structure of the e. coli macb abc domain (c2221) 0.928 3 254
7z19-assembly1.cif.gz_I e. coli c-p lyase bound to a single phnk abc domain 0.9263 3 274
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9204 5 249
ID Description Score Start End Superfamily
af_P33916_272_529_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9446 1 272 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9443 3 255 3.40.50.300
af_P75796_10_305_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9432 3 290 3.40.50.300
af_I6Y482_6_279_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9393 3 284 3.40.50.300
af_P0AAH8_2_263_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.939 1 271 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A844W5Y6-F1-model_v4 deleted 0.9794 85 224
AF-A0A352SRK6-F1-model_v4 Peptide ABC transporter ATP-binding protein 0.9644 1 186 GO:0005524
GO:0005886
GO:0016887
AF-A9KJN2-F1-model_v4 ABC transporter related 0.9589 3 254 GO:0005524
GO:0016887
AF-A0A7X9KIM3-F1-model_v4 ABC transporter ATP-binding protein 0.9575 3 181 GO:0005524
GO:0005886
GO:0016887
AF-A0A853I3Z0-F1-model_v4 deleted 0.9572 3 201

Map