F404335

General Info

Members Datasets Scaffolds Average Seq Length
317 211 632 329

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0086678|Ga0501071_0086678_955_2064
Length 369
Sequence VARRSVALIWTLPIPPLYLAVPPGVARRRHQSSAYGHSLMRLQLSLATAANPRSWPILDGTVKPDGIDLIPTVIHPSEMFWRQLKFQDFDVSEMSMSSLMMATAHGNNDWVGIPIFTTRKFFHTEILVRRDRGIDKPADLKGKRAGVPEYQQTAALWTRGVLQHEFGVNQTEIEHWMERVPSHSHGGATAFKPPPGTTIKQIPLEKSIGSMMAAGELDAVVHYLREQNLVDRSTVDLHNHPDVRTLFPDPIAEGVRFYQKTGIFPINHGMVIRREIAEKHPWTVLNLLKAYDQANELANRQRIAHVEYHVWAGLISAEAGKALREPAIRHGIKANRKTLETAAVYSHEQGLTPRLMKLDELFAPSAMEQ

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
98 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
101 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
107 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
143 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
154 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.58
Nodule 0
Rhizoplane 8.83
Rhizosphere 87.38
Stem 0
Stem Tuber 0
Unclassified 6.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0086678 3300049587 Bacteria 2297
2 JGI24744J21845_10015104 3300002077 Bacteria 1545
3 Ga0070676_10067234 3300005328 Bacteria 2143
4 Ga0070670_100157514 3300005331 Bacteria 1967
5 Ga0068869_100133454 3300005334 Bacteria 1911
6 Ga0070682_100306995 3300005337 Bacteria 1166
7 Ga0070689_100228544 3300005340 Bacteria 1528
8 Ga0070692_10070483 3300005345 Unclassified 1861
9 Ga0070692_10077637 3300005345 Bacteria 1782
10 Ga0070669_100041488 3300005353 Bacteria 3347
11 Ga0070671_100166052 3300005355 Bacteria 1866
12 Ga0070688_100012013 3300005365 Bacteria 4837
13 Ga0070713_100047724 3300005436 Bacteria 3521
14 Ga0070705_100093776 3300005440 Bacteria 1878
15 Ga0070663_100119705 3300005455 Bacteria 1987
16 Ga0070699_100474764 3300005518 Bacteria 1135
17 Ga0070679_100011331 3300005530 Bacteria 8501
18 Ga0070684_100198175 3300005535 Unclassified 1829
19 Ga0070686_100096789 3300005544 Bacteria 1985
20 Ga0070696_100368086 3300005546 Bacteria 1117
21 Ga0070665_100129694 3300005548 Bacteria 2523
22 Ga0070704_100010855 3300005549 Bacteria 5557
23 Ga0070704_100011990 3300005549 Bacteria 5340
24 Ga0070664_100085605 3300005564 Bacteria 2722
25 Ga0068857_100382120 3300005577 Bacteria 1308
26 Ga0068859_100308556 3300005617 Bacteria 1676
27 Ga0068864_100027659 3300005618 Bacteria 4792
28 Ga0068861_100137408 3300005719 Bacteria 1990
29 Ga0068858_100398619 3300005842 Bacteria 1322
30 Ga0081455_10012028 3300005937 Bacteria 8660
31 Ga0081455_10012327 3300005937 Bacteria 8530
32 Ga0081455_10099488 3300005937 Bacteria 2339
33 Ga0081455_10155036 3300005937 Unclassified 1762
34 Ga0081455_10160347 3300005937 Bacteria 1725
35 Ga0070717_10100022 3300006028 Bacteria 2461
36 Ga0075365_10055174 3300006038 Bacteria 2637
37 Ga0075365_10264750 3300006038 Bacteria 1209
38 Ga0070715_10105363 3300006163 Unclassified 1322
39 Ga0070716_100128373 3300006173 Bacteria 1599
40 Ga0070712_100012919 3300006175 Bacteria 5320
41 Ga0070712_100038159 3300006175 Bacteria 3281
42 Ga0070712_100243167 3300006175 Bacteria 1434
43 Ga0068871_100092671 3300006358 Bacteria 2520
44 Ga0075428_100061158 3300006844 Bacteria 4124
45 Ga0075430_100000457 3300006846 Bacteria 30492
46 Ga0075433_10007182 3300006852 Bacteria 8820
47 Ga0075434_100024482 3300006871 Bacteria 5901
48 Ga0075429_100023262 3300006880 Bacteria 5374
49 Ga0075436_100016576 3300006914 Bacteria 5044
50 Ga0097620_100308565 3300006931 Bacteria 1676
51 Ga0075435_100052574 3300007076 Bacteria 3283
52 Ga0099795_10002985 3300007788 Bacteria 4112
53 Ga0099795_10035847 3300007788 Bacteria 1737
54 Ga0111539_10001236 3300009094 Bacteria 34016
55 Ga0111539_10152496 3300009094 Bacteria 2705
56 Ga0111539_10327663 3300009094 Bacteria 1783
57 Ga0105247_10073135 3300009101 Bacteria 2147
58 Ga0114129_10006435 3300009147 Bacteria 16654
59 Ga0114129_10011825 3300009147 Bacteria 12415
60 Ga0114129_10183887 3300009147 Bacteria 2842
61 Ga0105249_10332575 3300009553 Bacteria 1533
62 Ga0099796_10005697 3300010159 Bacteria 3126
63 Ga0099796_10012669 3300010159 Bacteria 2388
64 Ga0105239_10203759 3300010375 Bacteria 2217
65 Ga0105246_10020664 3300011119 Bacteria 4226
66 Ga0157370_10029108 3300013104 Bacteria 5426
67 Ga0157370_10135325 3300013104 Bacteria 2297
68 Ga0157374_10080168 3300013296 Bacteria 3095
69 Ga0157378_10006037 3300013297 Bacteria 10608
70 Ga0163162_10089561 3300013306 Bacteria 3158
71 Ga0163162_10250618 3300013306 Bacteria 1903
72 Ga0163163_10134665 3300014325 Bacteria 2511
73 Ga0163163_10231664 3300014325 Bacteria 1896
74 Ga0163163_10372835 3300014325 Unclassified 1484
75 Ga0157380_10072162 3300014326 Bacteria 2795
76 Ga0157379_10122798 3300014968 Bacteria 2337
77 Ga0157376_10253095 3300014969 Bacteria 1646
78 Ga0157376_10369069 3300014969 Unclassified 1379
79 Ga0157376_10517569 3300014969 Bacteria 1175
80 Ga0213876_10047486 3300021384 Bacteria 2269
81 Ga0224572_1000583 3300024225 Bacteria 4512
82 Ga0207647_10101076 3300025904 Bacteria 1711
83 Ga0207645_10058909 3300025907 Bacteria 2452
84 Ga0207707_10162451 3300025912 Bacteria 1953
85 Ga0207693_10015400 3300025915 Bacteria 6135
86 Ga0207693_10086239 3300025915 Bacteria 2460
87 Ga0207662_10029626 3300025918 Bacteria 3173
88 Ga0207652_10207314 3300025921 Bacteria 1765
89 Ga0207650_10011409 3300025925 Bacteria 6116
90 Ga0207700_10078971 3300025928 Bacteria 2562
91 Ga0207690_10337171 3300025932 Bacteria 1189
92 Ga0207706_10067859 3300025933 Bacteria 3139
93 Ga0207670_10001473 3300025936 Bacteria 12353
94 Ga0207670_10243087 3300025936 Bacteria 1387
95 Ga0207669_10006070 3300025937 Bacteria 5483
96 Ga0207669_10125156 3300025937 Bacteria 1754
97 Ga0207665_10002588 3300025939 Bacteria 12160
98 Ga0207691_10033278 3300025940 Bacteria 4799
99 Ga0207691_10235267 3300025940 Bacteria 1585
100 Ga0207711_10090824 3300025941 Bacteria 2685
101 Ga0207689_10077014 3300025942 Bacteria 2742
102 Ga0207651_10089544 3300025960 Bacteria 2247
103 Ga0207651_10123387 3300025960 Bacteria 1969
104 Ga0207668_10097475 3300025972 Bacteria 2176
105 Ga0207639_10117599 3300026041 Bacteria 2178
106 Ga0207708_10042125 3300026075 Bacteria 3481
107 Ga0207702_10409103 3300026078 Bacteria 1310
108 Ga0207648_10036206 3300026089 Bacteria 4347
109 Ga0207676_10022705 3300026095 Bacteria 4617
110 Ga0207676_10082414 3300026095 Bacteria 2616
111 Ga0207675_100074316 3300026118 Bacteria 3180
112 Ga0207675_100196831 3300026118 Bacteria 1934
113 Ga0207683_10134228 3300026121 Bacteria 2228
114 Ga0207698_10533440 3300026142 Bacteria 1147
115 Ga0209179_1003820 3300027512 Bacteria 2211
116 Ga0207428_10001663 3300027907 Bacteria 23040
117 Ga0265338_10008635 3300028800 Bacteria 12323
118 Ga0265338_10172678 3300028800 Bacteria 1656
119 Ga0265763_1000146 3300030763 Bacteria 3547
120 Ga0265760_10006804 3300031090 Bacteria 3275
121 Ga0265760_10023254 3300031090 Bacteria 1800
122 Ga0265325_10033589 3300031241 Bacteria 2734
123 Ga0265325_10071479 3300031241 Bacteria 1741
124 Ga0265339_10001384 3300031249 Bacteria 18073
125 Ga0265313_10002178 3300031595 Bacteria 17376
126 Ga0265313_10035436 3300031595 Bacteria 2513
127 Ga0316579_10080845 3300031691 Bacteria 1547
128 Ga0265314_10004285 3300031711 Bacteria 13328
129 Ga0265314_10092988 3300031711 Bacteria 1959
130 Ga0265314_10140724 3300031711 Unclassified 1492
131 Ga0373928_0003360 3300035084 Bacteria 3054
132 Ga0373952_0004888 3300035092 Bacteria 2438
133 Ga0373923_0006845 3300035111 Bacteria 3967
134 Ga0373932_0036754 3300035112 Bacteria 1392
135 Ga0373936_0006988 3300035113 Bacteria 4246
136 Ga0373945_0035236 3300035116 Bacteria 1788
137 Ga0373953_0012470 3300035117 Bacteria 3011
138 Ga0373954_0000661 3300035118 Bacteria 13196
139 Ga0373954_0022614 3300035118 Bacteria 2853
140 Ga0373954_0069337 3300035118 Unclassified 1674
141 Ga0373956_0007464 3300035119 Bacteria 4404
142 Ga0373957_0002256 3300035120 Bacteria 5462
143 Ga0373960_0011022 3300035121 Bacteria 2219
144 Ga0373943_0047363 3300035170 Bacteria 2101
145 Ga0373955_0069617 3300035172 Bacteria 1964
146 Ga0373962_0037480 3300035242 Bacteria 1354
147 Ga0373924_0002422 3300035410 Bacteria 6280
148 Ga0373931_0009532 3300035691 Bacteria 4642
149 Ga0373931_0075734 3300035691 Bacteria 1846
150 Ga0373935_0079453 3300035692 Bacteria 2129
151 Ga0373927_0015980 3300035695 Bacteria 4954
152 Ga0373947_0054076 3300035725 Bacteria 2422
153 Ga0373947_0121160 3300035725 Unclassified 1662
154 Ga0373937_0127097 3300036401 Bacteria 2379
155 Ga0373937_0228892 3300036401 Bacteria 1750
156 Ga0373925_0042522 3300037068 Bacteria 3370
157 Ga0373925_0102919 3300037068 Bacteria 2197
158 Ga0373925_0105024 3300037068 Bacteria 2176
159 Ga0373925_0268464 3300037068 Bacteria 1372
160 Ga0436364_0731536 3300037853 Bacteria 11040
161 Ga0436364_1094332 3300037853 Bacteria 4981
162 Ga0436365_0053710 3300039437 Bacteria 30077
163 Ga0436365_0233278 3300039437 Bacteria 3940
164 Ga0436365_1040154 3300039437 Unclassified 3027
165 Ga0436363_1234750 3300039450 Unclassified 3170
166 Ga0436362_0332731 3300039453 Bacteria 2096
167 Ga0466966_0030758 3300044684 Bacteria 3483
168 Ga0466963_0043524 3300044694 Bacteria 2953
169 Ga0466963_0107316 3300044694 Bacteria 1915
170 Ga0466963_0229778 3300044694 Bacteria 1300
171 Ga0466957_0037188 3300044842 Bacteria 2930
172 Ga0466960_0006334 3300044901 Bacteria 4745
173 Ga0466960_0019052 3300044901 Bacteria 3017
174 Ga0466960_0174474 3300044901 Unclassified 1162
175 Ga0466959_0158812 3300045049 Bacteria 1590
176 Ga0466958_0027199 3300045836 Bacteria 3385
177 Ga0466958_0269900 3300045836 Bacteria 1089
178 Ga0466967_0150408 3300045976 Bacteria 2175
179 Ga0495592_0025531 3300046454 Bacteria 4484
180 Ga0495641_0011326 3300046461 Bacteria 5091
181 Ga0495641_0045546 3300046461 Bacteria 2019
182 Ga0495651_0004810 3300046462 Bacteria 10338
183 Ga0495653_0008547 3300046463 Bacteria 8396
184 Ga0495580_0011651 3300046472 Bacteria 6799
185 Ga0495582_0009395 3300046473 Bacteria 5387
186 Ga0495582_0027522 3300046473 Bacteria 3117
187 Ga0495639_0003685 3300046475 Bacteria 6596
188 Ga0495662_0060156 3300046476 Bacteria 1835
189 Ga0495664_0063989 3300046477 Bacteria 2192
190 Ga0495584_0054096 3300046491 Bacteria 2020
191 Ga0495618_0012235 3300046514 Bacteria 5208
192 Ga0495628_0004940 3300046516 Bacteria 11726
193 Ga0495628_0019278 3300046516 Bacteria 5642
194 Ga0495628_0029716 3300046516 Bacteria 4429
195 Ga0495630_0017513 3300046517 Bacteria 5249
196 Ga0495630_0171343 3300046517 Bacteria 1654
197 Ga0495637_0039208 3300046520 Bacteria 2046
198 Ga0495666_0008205 3300046526 Bacteria 5233
199 Ga0495666_0046731 3300046526 Bacteria 2086
200 Ga0495666_0060423 3300046526 Bacteria 1811
201 Ga0495652_0005279 3300046529 Bacteria 12184
202 Ga0495652_0062940 3300046529 Bacteria 3126
203 Ga0495665_0021252 3300046531 Bacteria 3486
204 Ga0495640_0005312 3300046533 Bacteria 10234
205 Ga0495640_0101077 3300046533 Unclassified 1893
206 Ga0495645_0000371 3300046543 Bacteria 31266
207 Ga0495656_0083681 3300046615 Unclassified 1445
208 Ga0495634_0010049 3300046642 Bacteria 6944
209 Ga0495659_0027534 3300046664 Bacteria 1962
210 Ga0495657_0023033 3300046675 Bacteria 4455
211 Ga0495657_0052067 3300046675 Bacteria 2746
212 Ga0495599_0010356 3300046678 Bacteria 5702
213 Ga0495646_0044758 3300046680 Unclassified 2705
214 Ga0495647_0003126 3300046681 Bacteria 5295
215 Ga0495647_0030932 3300046681 Bacteria 1989
216 Ga0495658_0006198 3300046683 Bacteria 5871
217 Ga0495658_0025195 3300046683 Bacteria 3177
218 Ga0495658_0028570 3300046683 Bacteria 3012
219 Ga0495613_0033503 3300046689 Bacteria 3817
220 Ga0495613_0148471 3300046689 Bacteria 1673
221 Ga0495613_0243955 3300046689 Bacteria 1255
222 Ga0495624_0017842 3300046690 Bacteria 4756
223 Ga0495604_0063694 3300047317 Bacteria 2811
224 Ga0495674_0007872 3300047319 Bacteria 10177
225 Ga0495674_0089997 3300047319 Bacteria 2623
226 Ga0495674_0198011 3300047319 Bacteria 1668
227 Ga0495674_0223153 3300047319 Unclassified 1557
228 Ga0495676_0158724 3300047321 Bacteria 1602
229 Ga0495680_0008833 3300047322 Bacteria 9118
230 Ga0495675_0023237 3300047444 Bacteria 3951
231 Ga0495684_0039129 3300047471 Bacteria 3635
232 Ga0495593_0000806 3300047673 Bacteria 18126
233 Ga0495614_0035610 3300048089 Bacteria 2138
234 Ga0496101_0073899 3300048904 Bacteria 2505
235 Ga0496102_0004494 3300048905 Bacteria 11774
236 Ga0496103_0238873 3300048906 Unclassified 1169
237 Ga0496104_0011797 3300048907 Bacteria 7842
238 Ga0496104_0028126 3300048907 Bacteria 5209
239 Ga0496104_0031775 3300048907 Bacteria 4911
240 Ga0496104_0037592 3300048907 Bacteria 4527
241 Ga0496104_0335014 3300048907 Bacteria 1426
242 Ga0496105_0075812 3300048908 Bacteria 2777
243 Ga0496105_0141072 3300048908 Bacteria 1983
244 Ga0496106_0176487 3300048909 Bacteria 1695
245 Ga0496108_0000244 3300048911 Bacteria 48432
246 Ga0496108_0097958 3300048911 Bacteria 2499
247 Ga0496109_0001338 3300048912 Bacteria 20353
248 Ga0496109_0014741 3300048912 Bacteria 6800
249 Ga0496109_0017887 3300048912 Bacteria 6220
250 Ga0496109_0052146 3300048912 Bacteria 3728
251 Ga0496110_0007187 3300048913 Bacteria 8863
252 Ga0496111_0006107 3300048914 Bacteria 7794
253 Ga0496112_0010467 3300048915 Bacteria 8412
254 Ga0496113_0000147 3300048916 Bacteria 30579
255 Ga0496113_0017795 3300048916 Bacteria 4940
256 Ga0496114_0109999 3300048917 Bacteria 2360
257 Ga0496114_0214069 3300048917 Bacteria 1690
258 Ga0496114_0497706 3300048917 Bacteria 1078
259 Ga0496115_0024406 3300048918 Bacteria 4698
260 Ga0496115_0119575 3300048918 Bacteria 2167
261 Ga0496115_0251484 3300048918 Bacteria 1455
262 Ga0501034_0029322 3300049571 Bacteria 5592
263 Ga0501034_0067833 3300049571 Bacteria 3579
264 Ga0501034_0137989 3300049571 Bacteria 2419
265 Ga0501036_0271821 3300049572 Bacteria 1419
266 Ga0501041_0089259 3300049577 Bacteria 1903
267 Ga0501043_0022261 3300049579 Bacteria 4972
268 Ga0501047_0075548 3300049581 Bacteria 3242
269 Ga0501070_0377189 3300049586 Bacteria 1149
270 Ga0501072_0265146 3300049588 Bacteria 1367
271 Ga0501072_0356221 3300049588 Unclassified 1162
272 Ga0501076_0131871 3300049592 Bacteria 2027
273 Ga0501077_0264162 3300049593 Unclassified 1095
274 Ga0501077_0282023 3300049593 Bacteria 1058
275 Ga0501079_0135328 3300049741 Bacteria 1918
276 Ga0501080_0068514 3300049742 Bacteria 3301
277 Ga0501080_0156918 3300049742 Bacteria 2102
278 Ga0501080_0193835 3300049742 Bacteria 1867
279 Ga0501081_0211511 3300049743 Bacteria 1408
280 Ga0501044_0100222 3300049823 Bacteria 2915
281 Ga0501044_0231949 3300049823 Bacteria 1793
282 nmdc:mga00v17_212627_c1 3300050491 Bacteria 1251
283 nmdc:mga0yw44_242359_c1 3300050492 Bacteria 1199
284 nmdc:mga06z11_159244_c1 3300050494 Bacteria 1289
285 nmdc:mga05p37_122198_c1 3300050507 Bacteria 3198
286 nmdc:mga05p37_15624_c1 3300050507 Bacteria 9123
287 nmdc:mga05p37_18981_c1 3300050507 Bacteria 8315
288 nmdc:mga09592_135935_c1 3300050508 Bacteria 2117
289 nmdc:mga09592_1646_c1 3300050508 Bacteria 17998
290 nmdc:mga0qj67_150_c1 3300050509 Bacteria 47345
291 nmdc:mga0qj67_19_c1 3300050509 Bacteria 112208
292 nmdc:mga06r32_61332_c1 3300050510 Bacteria 3619
293 nmdc:mga08y16_12578_c1 3300050511 Bacteria 8904
294 nmdc:mga0n895_114297_c1 3300050512 Bacteria 2717
295 nmdc:mga0n895_35602_c1 3300050512 Bacteria 4801
296 nmdc:mga0rr50_126716_c1 3300050513 Bacteria 2040
297 nmdc:mga0rr50_242605_c1 3300050513 Bacteria 1494
298 nmdc:mga08x19_56377_c1 3300050514 Bacteria 2536
299 nmdc:mga0a205_110039_c1 3300050515 Bacteria 2653
300 nmdc:mga0a205_2401_c1 3300050515 Bacteria 16531
301 nmdc:mga0a205_29376_c1 3300050515 Bacteria 5260
302 nmdc:mga0a205_568753_c1 3300050515 Bacteria 988
303 Ga0495601_0000765 3300053077 Bacteria 17303
304 Ga0495601_0055770 3300053077 Bacteria 2502
305 Ga0495601_0073151 3300053077 Unclassified 2191
306 Ga0495601_0114013 3300053077 Bacteria 1752
307 Ga0495655_0001532 3300053083 Bacteria 3552
308 Ga0495595_0002524 3300053084 Bacteria 7183
309 Ga0495619_0015853 3300053085 Bacteria 4770
310 Ga0495619_0018432 3300053085 Bacteria 4429
311 Ga0501084_0279355 3300054114 Bacteria 1410
312 Ga0501082_0079073 3300060353 Bacteria 2837
313 Ga0501082_0100514 3300060353 Unclassified 2502
314 Ga0530510_0015850 3300061734 Bacteria 5329
315 Ga0530510_0087190 3300061734 Unclassified 2275
316 Ga0530510_0312953 3300061734 Bacteria 1176
317 Ga0501071_0086678
318 JGI24744J21845_10015104
319 Ga0070676_10067234
320 Ga0070670_100157514
321 Ga0068869_100133454
322 Ga0070682_100306995
323 Ga0070689_100228544
324 Ga0070692_10070483
325 Ga0070692_10077637
326 Ga0070669_100041488
327 Ga0070671_100166052
328 Ga0070688_100012013
329 Ga0070713_100047724
330 Ga0070705_100093776
331 Ga0070663_100119705
332 Ga0070699_100474764
333 Ga0070679_100011331
334 Ga0070684_100198175
335 Ga0070686_100096789
336 Ga0070696_100368086
337 Ga0070665_100129694
338 Ga0070704_100010855
339 Ga0070704_100011990
340 Ga0070664_100085605
341 Ga0068857_100382120
342 Ga0068859_100308556
343 Ga0068864_100027659
344 Ga0068861_100137408
345 Ga0068858_100398619
346 Ga0081455_10012028
347 Ga0081455_10012327
348 Ga0081455_10099488
349 Ga0081455_10155036
350 Ga0081455_10160347
351 Ga0070717_10100022
352 Ga0075365_10055174
353 Ga0075365_10264750
354 Ga0070715_10105363
355 Ga0070716_100128373
356 Ga0070712_100012919
357 Ga0070712_100038159
358 Ga0070712_100243167
359 Ga0068871_100092671
360 Ga0075428_100061158
361 Ga0075430_100000457
362 Ga0075433_10007182
363 Ga0075434_100024482
364 Ga0075429_100023262
365 Ga0075436_100016576
366 Ga0097620_100308565
367 Ga0075435_100052574
368 Ga0099795_10002985
369 Ga0099795_10035847
370 Ga0111539_10001236
371 Ga0111539_10152496
372 Ga0111539_10327663
373 Ga0105247_10073135
374 Ga0114129_10006435
375 Ga0114129_10011825
376 Ga0114129_10183887
377 Ga0105249_10332575
378 Ga0099796_10005697
379 Ga0099796_10012669
380 Ga0105239_10203759
381 Ga0105246_10020664
382 Ga0157370_10029108
383 Ga0157370_10135325
384 Ga0157374_10080168
385 Ga0157378_10006037
386 Ga0163162_10089561
387 Ga0163162_10250618
388 Ga0163163_10134665
389 Ga0163163_10231664
390 Ga0163163_10372835
391 Ga0157380_10072162
392 Ga0157379_10122798
393 Ga0157376_10253095
394 Ga0157376_10369069
395 Ga0157376_10517569
396 Ga0213876_10047486
397 Ga0224572_1000583
398 Ga0207647_10101076
399 Ga0207645_10058909
400 Ga0207707_10162451
401 Ga0207693_10015400
402 Ga0207693_10086239
403 Ga0207662_10029626
404 Ga0207652_10207314
405 Ga0207650_10011409
406 Ga0207700_10078971
407 Ga0207690_10337171
408 Ga0207706_10067859
409 Ga0207670_10001473
410 Ga0207670_10243087
411 Ga0207669_10006070
412 Ga0207669_10125156
413 Ga0207665_10002588
414 Ga0207691_10033278
415 Ga0207691_10235267
416 Ga0207711_10090824
417 Ga0207689_10077014
418 Ga0207651_10089544
419 Ga0207651_10123387
420 Ga0207668_10097475
421 Ga0207639_10117599
422 Ga0207708_10042125
423 Ga0207702_10409103
424 Ga0207648_10036206
425 Ga0207676_10022705
426 Ga0207676_10082414
427 Ga0207675_100074316
428 Ga0207675_100196831
429 Ga0207683_10134228
430 Ga0207698_10533440
431 Ga0209179_1003820
432 Ga0207428_10001663
433 Ga0265338_10008635
434 Ga0265338_10172678
435 Ga0265763_1000146
436 Ga0265760_10006804
437 Ga0265760_10023254
438 Ga0265325_10033589
439 Ga0265325_10071479
440 Ga0265339_10001384
441 Ga0265313_10002178
442 Ga0265313_10035436
443 Ga0316579_10080845
444 Ga0265314_10004285
445 Ga0265314_10092988
446 Ga0265314_10140724
447 Ga0373928_0003360
448 Ga0373952_0004888
449 Ga0373923_0006845
450 Ga0373932_0036754
451 Ga0373936_0006988
452 Ga0373945_0035236
453 Ga0373953_0012470
454 Ga0373954_0000661
455 Ga0373954_0022614
456 Ga0373954_0069337
457 Ga0373956_0007464
458 Ga0373957_0002256
459 Ga0373960_0011022
460 Ga0373943_0047363
461 Ga0373955_0069617
462 Ga0373962_0037480
463 Ga0373924_0002422
464 Ga0373931_0009532
465 Ga0373931_0075734
466 Ga0373935_0079453
467 Ga0373927_0015980
468 Ga0373947_0054076
469 Ga0373947_0121160
470 Ga0373937_0127097
471 Ga0373937_0228892
472 Ga0373925_0042522
473 Ga0373925_0102919
474 Ga0373925_0105024
475 Ga0373925_0268464
476 Ga0436364_0731536
477 Ga0436364_1094332
478 Ga0436365_0053710
479 Ga0436365_0233278
480 Ga0436365_1040154
481 Ga0436363_1234750
482 Ga0436362_0332731
483 Ga0466966_0030758
484 Ga0466963_0043524
485 Ga0466963_0107316
486 Ga0466963_0229778
487 Ga0466957_0037188
488 Ga0466960_0006334
489 Ga0466960_0019052
490 Ga0466960_0174474
491 Ga0466959_0158812
492 Ga0466958_0027199
493 Ga0466958_0269900
494 Ga0466967_0150408
495 Ga0495592_0025531
496 Ga0495641_0011326
497 Ga0495641_0045546
498 Ga0495651_0004810
499 Ga0495653_0008547
500 Ga0495580_0011651
501 Ga0495582_0009395
502 Ga0495582_0027522
503 Ga0495639_0003685
504 Ga0495662_0060156
505 Ga0495664_0063989
506 Ga0495584_0054096
507 Ga0495618_0012235
508 Ga0495628_0004940
509 Ga0495628_0019278
510 Ga0495628_0029716
511 Ga0495630_0017513
512 Ga0495630_0171343
513 Ga0495637_0039208
514 Ga0495666_0008205
515 Ga0495666_0046731
516 Ga0495666_0060423
517 Ga0495652_0005279
518 Ga0495652_0062940
519 Ga0495665_0021252
520 Ga0495640_0005312
521 Ga0495640_0101077
522 Ga0495645_0000371
523 Ga0495656_0083681
524 Ga0495634_0010049
525 Ga0495659_0027534
526 Ga0495657_0023033
527 Ga0495657_0052067
528 Ga0495599_0010356
529 Ga0495646_0044758
530 Ga0495647_0003126
531 Ga0495647_0030932
532 Ga0495658_0006198
533 Ga0495658_0025195
534 Ga0495658_0028570
535 Ga0495613_0033503
536 Ga0495613_0148471
537 Ga0495613_0243955
538 Ga0495624_0017842
539 Ga0495604_0063694
540 Ga0495674_0007872
541 Ga0495674_0089997
542 Ga0495674_0198011
543 Ga0495674_0223153
544 Ga0495676_0158724
545 Ga0495680_0008833
546 Ga0495675_0023237
547 Ga0495684_0039129
548 Ga0495593_0000806
549 Ga0495614_0035610
550 Ga0496101_0073899
551 Ga0496102_0004494
552 Ga0496103_0238873
553 Ga0496104_0011797
554 Ga0496104_0028126
555 Ga0496104_0031775
556 Ga0496104_0037592
557 Ga0496104_0335014
558 Ga0496105_0075812
559 Ga0496105_0141072
560 Ga0496106_0176487
561 Ga0496108_0000244
562 Ga0496108_0097958
563 Ga0496109_0001338
564 Ga0496109_0014741
565 Ga0496109_0017887
566 Ga0496109_0052146
567 Ga0496110_0007187
568 Ga0496111_0006107
569 Ga0496112_0010467
570 Ga0496113_0000147
571 Ga0496113_0017795
572 Ga0496114_0109999
573 Ga0496114_0214069
574 Ga0496114_0497706
575 Ga0496115_0024406
576 Ga0496115_0119575
577 Ga0496115_0251484
578 Ga0501034_0029322
579 Ga0501034_0067833
580 Ga0501034_0137989
581 Ga0501036_0271821
582 Ga0501041_0089259
583 Ga0501043_0022261
584 Ga0501047_0075548
585 Ga0501070_0377189
586 Ga0501072_0265146
587 Ga0501072_0356221
588 Ga0501076_0131871
589 Ga0501077_0264162
590 Ga0501077_0282023
591 Ga0501079_0135328
592 Ga0501080_0068514
593 Ga0501080_0156918
594 Ga0501080_0193835
595 Ga0501081_0211511
596 Ga0501044_0100222
597 Ga0501044_0231949
598 nmdc:mga00v17_212627_c1
599 nmdc:mga0yw44_242359_c1
600 nmdc:mga06z11_159244_c1
601 nmdc:mga05p37_122198_c1
602 nmdc:mga05p37_15624_c1
603 nmdc:mga05p37_18981_c1
604 nmdc:mga09592_135935_c1
605 nmdc:mga09592_1646_c1
606 nmdc:mga0qj67_150_c1
607 nmdc:mga0qj67_19_c1
608 nmdc:mga06r32_61332_c1
609 nmdc:mga08y16_12578_c1
610 nmdc:mga0n895_114297_c1
611 nmdc:mga0n895_35602_c1
612 nmdc:mga0rr50_126716_c1
613 nmdc:mga0rr50_242605_c1
614 nmdc:mga08x19_56377_c1
615 nmdc:mga0a205_110039_c1
616 nmdc:mga0a205_2401_c1
617 nmdc:mga0a205_29376_c1
618 nmdc:mga0a205_568753_c1
619 Ga0495601_0000765
620 Ga0495601_0055770
621 Ga0495601_0073151
622 Ga0495601_0114013
623 Ga0495655_0001532
624 Ga0495595_0002524
625 Ga0495619_0015853
626 Ga0495619_0018432
627 Ga0501084_0279355
628 Ga0501082_0079073
629 Ga0501082_0100514
630 Ga0530510_0015850
631 Ga0530510_0087190
632 Ga0530510_0312953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7an6-assembly1.cif.gz_B enzyme of biosynthetic pathway 0.6534 1 318
7an8-assembly1.cif.gz_B enzyme of biosynthetic pathway 0.6503 1 322
7an8-assembly1.cif.gz_B enzyme of biosynthetic pathway 0.6368 1 322
2nxo-assembly2.cif.gz_C crystal structure of protein sco4506 from streptomyces coelicolor, pfam duf178 0.6355 2 319
7an7-assembly1.cif.gz_A enzyme of biosynthetic pathway 0.6353 1 317
ID Description Score Start End Superfamily
af_A1ZAC0_106_293_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7231 79 106 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7042 81 208 3.40.190.10
3qslA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6774 2 77 3.40.190.10
6nioA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6656 4 55 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6622 81 208 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6N8YU39-F1-model_v4 Uncharacterized protein 0.9969 1 330
AF-A0A536SP05-F1-model_v4 ABC transporter substrate-binding protein 0.9948 1 330
AF-A0A6N8YU39-F1-model_v4 Uncharacterized protein 0.9939 1 330
AF-A0A2E3ZKY3-F1-model_v4 SsuA/THI5-like domain-containing protein 0.992 1 330
AF-A0A536SP05-F1-model_v4 ABC transporter substrate-binding protein 0.9918 1 330

Map