F404191
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 317 | 203 | 317 | 96 |
Family's Representative Sequence
| Representative Sequence | 3300025936|Ga0207670_10885940|Ga0207670_108859402 |
| Length | 117 |
| Sequence | MVDGHAAGLFPDAETFRIMASVSTSTVERPRTDGPGSDLGGDWRVIVRNDSHNTFDHVAQSLARVLPGVSLERGHELAESIHNNGLAIVWSGPREPAEHYWQQLKAAGLTMAPLERA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 4 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 35 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 37 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 38 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 99 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 101 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 102 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 103 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 104 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 105 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 106 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 107 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 150 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 151 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 152 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 153 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 154 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 155 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 158 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 159 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 160 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 161 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 162 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 163 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 164 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 165 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 166 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 167 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 168 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 169 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 170 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 196 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 200 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 201 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 202 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 203 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.58 |
| Nodule | 0 |
| Rhizoplane | 9.15 |
| Rhizosphere | 83.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000305 | 3300001977 | Bacteria | 7033 |
| 2 | Ga0070670_100054576 | 3300005331 | Bacteria | 3431 |
| 3 | Ga0068868_100000450 | 3300005338 | Bacteria | 27515 |
| 4 | Ga0070660_100531488 | 3300005339 | Bacteria | 980 |
| 5 | Ga0070661_100177024 | 3300005344 | Bacteria | 1622 |
| 6 | Ga0070661_100534251 | 3300005344 | Unclassified | 942 |
| 7 | Ga0070692_10044881 | 3300005345 | Bacteria | 2279 |
| 8 | Ga0070668_100505597 | 3300005347 | Bacteria | 1047 |
| 9 | Ga0070675_100000027 | 3300005354 | Bacteria | 106172 |
| 10 | Ga0070675_100308753 | 3300005354 | Bacteria | 1395 |
| 11 | Ga0070674_100046318 | 3300005356 | Bacteria | 2974 |
| 12 | Ga0070674_100287048 | 3300005356 | Bacteria | 1307 |
| 13 | Ga0070688_100001250 | 3300005365 | Bacteria | 12681 |
| 14 | Ga0070659_101923015 | 3300005366 | Bacteria | 531 |
| 15 | Ga0070667_100413472 | 3300005367 | Bacteria | 1229 |
| 16 | Ga0070714_100089298 | 3300005435 | Bacteria | 2698 |
| 17 | Ga0070714_100090319 | 3300005435 | Bacteria | 2682 |
| 18 | Ga0070713_101366531 | 3300005436 | Bacteria | 687 |
| 19 | Ga0070701_10963698 | 3300005438 | Bacteria | 593 |
| 20 | Ga0070700_100229234 | 3300005441 | Bacteria | 1321 |
| 21 | Ga0070663_102112682 | 3300005455 | Bacteria | 508 |
| 22 | Ga0070662_100000004 | 3300005457 | Bacteria | 195534 |
| 23 | Ga0068867_100481143 | 3300005459 | Bacteria | 1064 |
| 24 | Ga0070685_10001410 | 3300005466 | Bacteria | 12591 |
| 25 | Ga0070685_10878395 | 3300005466 | Bacteria | 666 |
| 26 | Ga0070684_100024292 | 3300005535 | Bacteria | 5082 |
| 27 | Ga0070684_100156085 | 3300005535 | Bacteria | 2069 |
| 28 | Ga0070672_100000293 | 3300005543 | Bacteria | 28247 |
| 29 | Ga0070672_100521094 | 3300005543 | Bacteria | 1030 |
| 30 | Ga0070693_100004573 | 3300005547 | Bacteria | 6563 |
| 31 | Ga0070665_100000106 | 3300005548 | Bacteria | 157315 |
| 32 | Ga0070665_100039235 | 3300005548 | Bacteria | 4762 |
| 33 | Ga0070665_101042695 | 3300005548 | Bacteria | 830 |
| 34 | Ga0070665_101114334 | 3300005548 | Bacteria | 801 |
| 35 | Ga0070665_101678776 | 3300005548 | Unclassified | 643 |
| 36 | Ga0070704_100740429 | 3300005549 | Bacteria | 874 |
| 37 | Ga0070704_102043247 | 3300005549 | Bacteria | 532 |
| 38 | Ga0068857_101572342 | 3300005577 | Bacteria | 642 |
| 39 | Ga0068856_100008468 | 3300005614 | Bacteria | 10010 |
| 40 | Ga0068852_100000006 | 3300005616 | Bacteria | 159569 |
| 41 | Ga0068852_100579402 | 3300005616 | Bacteria | 1125 |
| 42 | Ga0068861_100441558 | 3300005719 | Bacteria | 1164 |
| 43 | Ga0068861_102309234 | 3300005719 | Bacteria | 540 |
| 44 | Ga0068858_100000009 | 3300005842 | Bacteria | 237748 |
| 45 | Ga0068860_100141601 | 3300005843 | Bacteria | 2312 |
| 46 | Ga0068860_100832372 | 3300005843 | Bacteria | 937 |
| 47 | Ga0068862_101501987 | 3300005844 | Bacteria | 679 |
| 48 | Ga0081455_10021219 | 3300005937 | Bacteria | 6097 |
| 49 | Ga0081538_10000467 | 3300005981 | Bacteria | 45342 |
| 50 | Ga0070712_100845309 | 3300006175 | Bacteria | 787 |
| 51 | Ga0075431_100081736 | 3300006847 | Bacteria | 3336 |
| 52 | Ga0068865_100125588 | 3300006881 | Bacteria | 1914 |
| 53 | Ga0105245_10000254 | 3300009098 | Bacteria | 50918 |
| 54 | Ga0105245_10735951 | 3300009098 | Bacteria | 1021 |
| 55 | Ga0105245_11923573 | 3300009098 | Bacteria | 645 |
| 56 | Ga0105247_10000316 | 3300009101 | Bacteria | 43374 |
| 57 | Ga0105247_11493860 | 3300009101 | Bacteria | 551 |
| 58 | Ga0105243_10040421 | 3300009148 | Bacteria | 3642 |
| 59 | Ga0105243_10162820 | 3300009148 | Bacteria | 1925 |
| 60 | Ga0105241_10324889 | 3300009174 | Bacteria | 1328 |
| 61 | Ga0105242_10000454 | 3300009176 | Bacteria | 32662 |
| 62 | Ga0105242_10118343 | 3300009176 | Bacteria | 2269 |
| 63 | Ga0105242_10154085 | 3300009176 | Unclassified | 2006 |
| 64 | Ga0105248_10000008 | 3300009177 | Bacteria | 403910 |
| 65 | Ga0105248_11736334 | 3300009177 | Bacteria | 708 |
| 66 | Ga0105238_10000011 | 3300009551 | Bacteria | 261080 |
| 67 | Ga0105238_10307402 | 3300009551 | Bacteria | 1570 |
| 68 | Ga0105249_10582354 | 3300009553 | Unclassified | 1172 |
| 69 | Ga0105249_10757070 | 3300009553 | Bacteria | 1034 |
| 70 | Ga0105249_10903066 | 3300009553 | Bacteria | 950 |
| 71 | Ga0105239_10610284 | 3300010375 | Bacteria | 1245 |
| 72 | Ga0105246_12425728 | 3300011119 | Bacteria | 515 |
| 73 | Ga0157370_10141010 | 3300013104 | Unclassified | 2246 |
| 74 | Ga0157369_10000020 | 3300013105 | Bacteria | 241679 |
| 75 | Ga0157374_10095265 | 3300013296 | Unclassified | 2846 |
| 76 | Ga0157378_10005986 | 3300013297 | Bacteria | 10663 |
| 77 | Ga0157378_10030467 | 3300013297 | Bacteria | 4768 |
| 78 | Ga0163162_11665096 | 3300013306 | Bacteria | 728 |
| 79 | Ga0157375_10173261 | 3300013308 | Bacteria | 2306 |
| 80 | Ga0157375_10380635 | 3300013308 | Bacteria | 1578 |
| 81 | Ga0157375_10401382 | 3300013308 | Bacteria | 1537 |
| 82 | Ga0157375_10549233 | 3300013308 | Bacteria | 1317 |
| 83 | Ga0157375_12750785 | 3300013308 | Bacteria | 588 |
| 84 | Ga0163163_11562753 | 3300014325 | Unclassified | 721 |
| 85 | Ga0157380_10002003 | 3300014326 | Bacteria | 13578 |
| 86 | Ga0157380_10174238 | 3300014326 | Bacteria | 1883 |
| 87 | Ga0157380_12076472 | 3300014326 | Bacteria | 631 |
| 88 | Ga0157380_12949067 | 3300014326 | Bacteria | 542 |
| 89 | Ga0157377_11508729 | 3300014745 | Bacteria | 535 |
| 90 | Ga0157379_11175426 | 3300014968 | Bacteria | 737 |
| 91 | Ga0157379_11483396 | 3300014968 | Unclassified | 659 |
| 92 | Ga0157376_10197465 | 3300014969 | Bacteria | 1849 |
| 93 | Ga0163161_10287628 | 3300017792 | Unclassified | 1291 |
| 94 | Ga0206356_10048422 | 3300020070 | Bacteria | 1957 |
| 95 | Ga0207710_10000458 | 3300025900 | Bacteria | 26155 |
| 96 | Ga0207680_10159342 | 3300025903 | Bacteria | 1512 |
| 97 | Ga0207647_10565075 | 3300025904 | Bacteria | 630 |
| 98 | Ga0207645_10978167 | 3300025907 | Bacteria | 573 |
| 99 | Ga0207705_10167133 | 3300025909 | Bacteria | 1655 |
| 100 | Ga0207671_10005068 | 3300025914 | Bacteria | 12301 |
| 101 | Ga0207693_10052539 | 3300025915 | Bacteria | 3197 |
| 102 | Ga0207693_10107054 | 3300025915 | Bacteria | 2193 |
| 103 | Ga0207693_10734208 | 3300025915 | Bacteria | 763 |
| 104 | Ga0207693_10824648 | 3300025915 | Unclassified | 714 |
| 105 | Ga0207657_10362895 | 3300025919 | Bacteria | 1142 |
| 106 | Ga0207649_10000009 | 3300025920 | Bacteria | 295544 |
| 107 | Ga0207649_10350271 | 3300025920 | Bacteria | 1093 |
| 108 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 109 | Ga0207659_10000010 | 3300025926 | Bacteria | 286639 |
| 110 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 111 | Ga0207700_10200216 | 3300025928 | Bacteria | 1682 |
| 112 | Ga0207664_10018436 | 3300025929 | Bacteria | 5139 |
| 113 | Ga0207664_10100280 | 3300025929 | Bacteria | 2391 |
| 114 | Ga0207664_10630625 | 3300025929 | Bacteria | 963 |
| 115 | Ga0207664_10733359 | 3300025929 | Bacteria | 889 |
| 116 | Ga0207690_10076663 | 3300025932 | Bacteria | 2322 |
| 117 | Ga0207706_10000012 | 3300025933 | Bacteria | 195475 |
| 118 | Ga0207686_10356998 | 3300025934 | Bacteria | 1102 |
| 119 | Ga0207686_10476060 | 3300025934 | Unclassified | 965 |
| 120 | Ga0207709_10291774 | 3300025935 | Bacteria | 1209 |
| 121 | Ga0207670_10885940 | 3300025936 | Bacteria | 747 |
| 122 | Ga0207669_10229221 | 3300025937 | Bacteria | 1369 |
| 123 | Ga0207669_10294267 | 3300025937 | Bacteria | 1231 |
| 124 | Ga0207704_10166876 | 3300025938 | Bacteria | 1574 |
| 125 | Ga0207691_10000044 | 3300025940 | Bacteria | 100027 |
| 126 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 127 | Ga0207661_10000253 | 3300025944 | Bacteria | 34627 |
| 128 | Ga0207661_10148671 | 3300025944 | Bacteria | 2023 |
| 129 | Ga0207712_10382987 | 3300025961 | Unclassified | 1178 |
| 130 | Ga0207668_10882957 | 3300025972 | Bacteria | 795 |
| 131 | Ga0207677_10000200 | 3300026023 | Bacteria | 48320 |
| 132 | Ga0207703_10000023 | 3300026035 | Bacteria | 222018 |
| 133 | Ga0207703_11429498 | 3300026035 | Bacteria | 665 |
| 134 | Ga0207639_10161229 | 3300026041 | Bacteria | 1890 |
| 135 | Ga0207708_10047844 | 3300026075 | Bacteria | 3255 |
| 136 | Ga0207702_10000158 | 3300026078 | Bacteria | 79984 |
| 137 | Ga0207702_10004391 | 3300026078 | Bacteria | 12560 |
| 138 | Ga0207702_12386462 | 3300026078 | Bacteria | 516 |
| 139 | Ga0207648_10738955 | 3300026089 | Bacteria | 914 |
| 140 | Ga0207675_101210725 | 3300026118 | Bacteria | 775 |
| 141 | Ga0207698_10000013 | 3300026142 | Bacteria | 255414 |
| 142 | Ga0207698_10099362 | 3300026142 | Bacteria | 2407 |
| 143 | Ga0268266_10000047 | 3300028379 | Bacteria | 310996 |
| 144 | Ga0268266_10009710 | 3300028379 | Bacteria | 8457 |
| 145 | Ga0268266_10200557 | 3300028379 | Bacteria | 1826 |
| 146 | Ga0268266_11348234 | 3300028379 | Bacteria | 689 |
| 147 | Ga0268265_11247673 | 3300028380 | Bacteria | 742 |
| 148 | Ga0268264_10095164 | 3300028381 | Bacteria | 2577 |
| 149 | Ga0265334_10105748 | 3300028573 | Unclassified | 1015 |
| 150 | Ga0265338_10395708 | 3300028800 | Bacteria | 986 |
| 151 | Ga0373937_0561247 | 3300036401 | Bacteria | 1084 |
| 152 | Ga0436364_0739833 | 3300037853 | Bacteria | 981 |
| 153 | Ga0451798_1035661 | 3300041458 | Unclassified | 522 |
| 154 | Ga0451853_1685780 | 3300041512 | Bacteria | 2002 |
| 155 | Ga0451853_3297983 | 3300041512 | Bacteria | 5715 |
| 156 | Ga0439440_0016114 | 3300042993 | Bacteria | 1631 |
| 157 | Ga0466957_0029121 | 3300044842 | Bacteria | 3292 |
| 158 | Ga0466957_0287140 | 3300044842 | Bacteria | 1102 |
| 159 | Ga0466967_0342547 | 3300045976 | Bacteria | 1446 |
| 160 | Ga0466967_1220413 | 3300045976 | Bacteria | 749 |
| 161 | Ga0495592_0166584 | 3300046454 | Bacteria | 1512 |
| 162 | Ga0495592_0218115 | 3300046454 | Bacteria | 1277 |
| 163 | Ga0495629_0001726 | 3300046459 | Bacteria | 17147 |
| 164 | Ga0495629_0003604 | 3300046459 | Bacteria | 11704 |
| 165 | Ga0495629_0081270 | 3300046459 | Bacteria | 2262 |
| 166 | Ga0495629_0240331 | 3300046459 | Bacteria | 1247 |
| 167 | Ga0495629_0474019 | 3300046459 | Bacteria | 846 |
| 168 | Ga0495641_0000228 | 3300046461 | Bacteria | 43671 |
| 169 | Ga0495641_0043135 | 3300046461 | Bacteria | 2087 |
| 170 | Ga0495651_0051484 | 3300046462 | Bacteria | 3174 |
| 171 | Ga0495653_0137335 | 3300046463 | Bacteria | 1723 |
| 172 | Ga0495653_0817358 | 3300046463 | Bacteria | 559 |
| 173 | Ga0495662_0004365 | 3300046476 | Bacteria | 7100 |
| 174 | Ga0495664_0243037 | 3300046477 | Bacteria | 1089 |
| 175 | Ga0495594_0000029 | 3300046499 | Bacteria | 66789 |
| 176 | Ga0495606_0000072 | 3300046507 | Bacteria | 173678 |
| 177 | Ga0495618_0251286 | 3300046514 | Bacteria | 1109 |
| 178 | Ga0495628_0023428 | 3300046516 | Bacteria | 5068 |
| 179 | Ga0495628_0129509 | 3300046516 | Bacteria | 1931 |
| 180 | Ga0495628_0318506 | 3300046516 | Bacteria | 1148 |
| 181 | Ga0495630_0325744 | 3300046517 | Bacteria | 1175 |
| 182 | Ga0495630_0871328 | 3300046517 | Bacteria | 686 |
| 183 | Ga0495644_0003786 | 3300046523 | Bacteria | 5953 |
| 184 | Ga0495652_0000407 | 3300046529 | Bacteria | 50232 |
| 185 | Ga0495652_0017869 | 3300046529 | Bacteria | 6330 |
| 186 | Ga0495640_0017874 | 3300046533 | Bacteria | 5271 |
| 187 | Ga0495640_0304088 | 3300046533 | Bacteria | 990 |
| 188 | Ga0495586_0000161 | 3300046535 | Bacteria | 43544 |
| 189 | Ga0495587_0025086 | 3300046536 | Bacteria | 3646 |
| 190 | Ga0495598_0056702 | 3300046537 | Bacteria | 1196 |
| 191 | Ga0495645_0019665 | 3300046543 | Bacteria | 4864 |
| 192 | Ga0495645_0126231 | 3300046543 | Bacteria | 1798 |
| 193 | Ga0495622_0000550 | 3300046557 | Bacteria | 22511 |
| 194 | Ga0495633_0055276 | 3300046558 | Unclassified | 1866 |
| 195 | Ga0495667_0088032 | 3300046559 | Unclassified | 2013 |
| 196 | Ga0495634_0005238 | 3300046642 | Bacteria | 10023 |
| 197 | Ga0495634_0009160 | 3300046642 | Bacteria | 7312 |
| 198 | Ga0495634_0077660 | 3300046642 | Bacteria | 2177 |
| 199 | Ga0495588_0000134 | 3300046674 | Bacteria | 117581 |
| 200 | Ga0495599_0017233 | 3300046678 | Bacteria | 4490 |
| 201 | Ga0495599_0502167 | 3300046678 | Bacteria | 714 |
| 202 | Ga0495646_0354418 | 3300046680 | Bacteria | 768 |
| 203 | Ga0495647_0000018 | 3300046681 | Bacteria | 81701 |
| 204 | Ga0495669_0136000 | 3300046684 | Bacteria | 1158 |
| 205 | Ga0495613_0315370 | 3300046689 | Bacteria | 1080 |
| 206 | Ga0495624_0000097 | 3300046690 | Bacteria | 58715 |
| 207 | Ga0495670_0019972 | 3300046691 | Bacteria | 3301 |
| 208 | Ga0495600_0007876 | 3300046809 | Bacteria | 6525 |
| 209 | Ga0495600_0049137 | 3300046809 | Bacteria | 2752 |
| 210 | Ga0495674_0000064 | 3300047319 | Bacteria | 71275 |
| 211 | Ga0495674_0067608 | 3300047319 | Bacteria | 3095 |
| 212 | Ga0495674_0985485 | 3300047319 | Bacteria | 647 |
| 213 | Ga0495672_0012161 | 3300047320 | Bacteria | 6023 |
| 214 | Ga0495672_0041619 | 3300047320 | Bacteria | 2777 |
| 215 | Ga0495676_0002521 | 3300047321 | Bacteria | 16308 |
| 216 | Ga0495680_0087972 | 3300047322 | Unclassified | 2335 |
| 217 | Ga0495679_033543 | 3300047446 | Bacteria | 1639 |
| 218 | Ga0495684_0332784 | 3300047471 | Bacteria | 1083 |
| 219 | Ga0495593_0180483 | 3300047673 | Bacteria | 1063 |
| 220 | Ga0495602_0040615 | 3300048088 | Bacteria | 4262 |
| 221 | Ga0495602_0807325 | 3300048088 | Bacteria | 630 |
| 222 | Ga0496100_0985900 | 3300048903 | Unclassified | 663 |
| 223 | Ga0496101_0549971 | 3300048904 | Bacteria | 913 |
| 224 | Ga0496102_0244723 | 3300048905 | Bacteria | 1691 |
| 225 | Ga0496102_0429586 | 3300048905 | Bacteria | 1240 |
| 226 | Ga0496102_1655545 | 3300048905 | Unclassified | 558 |
| 227 | Ga0496103_0255744 | 3300048906 | Bacteria | 1127 |
| 228 | Ga0496104_0000004 | 3300048907 | Bacteria | 641830 |
| 229 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 230 | Ga0496106_0000151 | 3300048909 | Bacteria | 51430 |
| 231 | Ga0496106_0459370 | 3300048909 | Bacteria | 1023 |
| 232 | Ga0496107_0142710 | 3300048910 | Bacteria | 1770 |
| 233 | Ga0496107_0183754 | 3300048910 | Bacteria | 1553 |
| 234 | Ga0496107_0536654 | 3300048910 | Bacteria | 867 |
| 235 | Ga0496108_0049450 | 3300048911 | Bacteria | 3517 |
| 236 | Ga0496109_0000249 | 3300048912 | Bacteria | 51718 |
| 237 | Ga0496109_0826775 | 3300048912 | Unclassified | 864 |
| 238 | Ga0496109_0940095 | 3300048912 | Bacteria | 802 |
| 239 | Ga0496110_0011255 | 3300048913 | Bacteria | 7314 |
| 240 | Ga0496110_0030348 | 3300048913 | Bacteria | 4659 |
| 241 | Ga0496110_0270238 | 3300048913 | Bacteria | 1548 |
| 242 | Ga0496110_0276481 | 3300048913 | Bacteria | 1529 |
| 243 | Ga0496111_0131752 | 3300048914 | Bacteria | 1850 |
| 244 | Ga0496111_0229400 | 3300048914 | Bacteria | 1379 |
| 245 | Ga0496111_0443323 | 3300048914 | Bacteria | 958 |
| 246 | Ga0496112_0904978 | 3300048915 | Bacteria | 804 |
| 247 | Ga0496113_0091448 | 3300048916 | Bacteria | 2345 |
| 248 | Ga0496114_0620830 | 3300048917 | Bacteria | 952 |
| 249 | Ga0496115_0000226 | 3300048918 | Bacteria | 51586 |
| 250 | Ga0496116_0000735 | 3300048919 | Bacteria | 41771 |
| 251 | Ga0496117_0004253 | 3300048920 | Bacteria | 15981 |
| 252 | Ga0496117_0412246 | 3300048920 | Bacteria | 678 |
| 253 | Ga0496118_0014032 | 3300048921 | Bacteria | 7524 |
| 254 | Ga0496118_0016560 | 3300048921 | Bacteria | 6759 |
| 255 | Ga0496118_0389615 | 3300048921 | Bacteria | 728 |
| 256 | Ga0496119_0005911 | 3300048922 | Bacteria | 11538 |
| 257 | Ga0496119_0008529 | 3300048922 | Bacteria | 8987 |
| 258 | Ga0496119_0027449 | 3300048922 | Bacteria | 3911 |
| 259 | Ga0496119_0276275 | 3300048922 | Unclassified | 837 |
| 260 | Ga0496120_0010399 | 3300048923 | Bacteria | 6495 |
| 261 | Ga0496121_0025396 | 3300048924 | Bacteria | 5621 |
| 262 | Ga0496121_0061202 | 3300048924 | Bacteria | 3091 |
| 263 | Ga0496126_0400811 | 3300048929 | Bacteria | 1113 |
| 264 | Ga0501031_0807419 | 3300049568 | Unclassified | 601 |
| 265 | Ga0501032_0528344 | 3300049569 | Bacteria | 753 |
| 266 | Ga0501034_0333038 | 3300049571 | Bacteria | 1449 |
| 267 | Ga0501036_1676115 | 3300049572 | Unclassified | 513 |
| 268 | Ga0501040_0261083 | 3300049576 | Bacteria | 1236 |
| 269 | Ga0501042_0024473 | 3300049578 | Bacteria | 4235 |
| 270 | Ga0501042_0357908 | 3300049578 | Unclassified | 1056 |
| 271 | Ga0501043_0645511 | 3300049579 | Bacteria | 778 |
| 272 | Ga0501043_0666048 | 3300049579 | Bacteria | 763 |
| 273 | Ga0501047_0006995 | 3300049581 | Bacteria | 10593 |
| 274 | Ga0501047_0045524 | 3300049581 | Bacteria | 4243 |
| 275 | Ga0501047_0286154 | 3300049581 | Bacteria | 1492 |
| 276 | Ga0501047_0440260 | 3300049581 | Bacteria | 1133 |
| 277 | Ga0501048_1277404 | 3300049582 | Unclassified | 528 |
| 278 | Ga0501068_0133547 | 3300049584 | Bacteria | 1553 |
| 279 | Ga0501068_0495805 | 3300049584 | Unclassified | 792 |
| 280 | Ga0501070_0088369 | 3300049586 | Bacteria | 2565 |
| 281 | Ga0501070_1279419 | 3300049586 | Bacteria | 560 |
| 282 | Ga0501073_1289580 | 3300049589 | Unclassified | 501 |
| 283 | Ga0501074_0053997 | 3300049590 | Bacteria | 2898 |
| 284 | Ga0501075_0009392 | 3300049591 | Bacteria | 6842 |
| 285 | Ga0501075_0546991 | 3300049591 | Bacteria | 884 |
| 286 | Ga0501079_0006415 | 3300049741 | Bacteria | 8831 |
| 287 | Ga0501080_0116518 | 3300049742 | Bacteria | 2476 |
| 288 | Ga0501081_0118602 | 3300049743 | Unclassified | 1883 |
| 289 | Ga0501081_0711205 | 3300049743 | Bacteria | 754 |
| 290 | Ga0501083_0015081 | 3300049744 | Bacteria | 5409 |
| 291 | Ga0501083_0086471 | 3300049744 | Bacteria | 2073 |
| 292 | Ga0501044_0186240 | 3300049823 | Bacteria | 2040 |
| 293 | Ga0501044_0399359 | 3300049823 | Bacteria | 1287 |
| 294 | Ga0501045_0252710 | 3300049824 | Unclassified | 1312 |
| 295 | nmdc:mga05p37_1012111_c1 | 3300050507 | Bacteria | 881 |
| 296 | nmdc:mga06r32_1834163_c1 | 3300050510 | Unclassified | 542 |
| 297 | nmdc:mga06r32_28506_c1 | 3300050510 | Bacteria | 5226 |
| 298 | nmdc:mga0a205_6_c1 | 3300050515 | Bacteria | 129758 |
| 299 | Ga0495601_0000855 | 3300053077 | Bacteria | 16586 |
| 300 | Ga0495601_0164884 | 3300053077 | Bacteria | 1448 |
| 301 | Ga0495601_0359137 | 3300053077 | Bacteria | 947 |
| 302 | Ga0495601_0836812 | 3300053077 | Bacteria | 583 |
| 303 | Ga0495612_0000164 | 3300053078 | Bacteria | 27579 |
| 304 | Ga0495612_0061466 | 3300053078 | Bacteria | 1556 |
| 305 | Ga0495612_0121900 | 3300053078 | Unclassified | 1122 |
| 306 | Ga0495612_0219485 | 3300053078 | Bacteria | 841 |
| 307 | Ga0500635_0244012 | 3300053080 | Bacteria | 704 |
| 308 | Ga0495655_0073697 | 3300053083 | Bacteria | 960 |
| 309 | Ga0495595_0259590 | 3300053084 | Bacteria | 871 |
| 310 | Ga0495619_0000157 | 3300053085 | Bacteria | 49848 |
| 311 | Ga0495619_0167470 | 3300053085 | Bacteria | 1519 |
| 312 | Ga0495619_0652155 | 3300053085 | Bacteria | 718 |
| 313 | Ga0500566_0462400 | 3300053094 | Unclassified | 553 |
| 314 | Ga0500595_046238 | 3300053119 | Bacteria | 1369 |
| 315 | Ga0500614_000451 | 3300053123 | Bacteria | 10624 |
| 316 | Ga0500658_0152208 | 3300053134 | Bacteria | 1043 |
| 317 | Ga0530510_1201249 | 3300061734 | Bacteria | 581 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300011119 | Ga0105246_12425728 | Ga0105246_124257282 | 93 |
| 2 | 3300005843 | Ga0068860_100832372 | Ga0068860_1008323722 | 94 |
| 3 | 3300026078 | Ga0207702_12386462 | Ga0207702_123864621 | 94 |
| 4 | 3300049581 | Ga0501047_0440260 | Ga0501047_0440260_634_921 | 94 |
| 5 | 3300049586 | Ga0501070_1279419 | Ga0501070_1279419_233_520 | 94 |
| 6 | 3300049589 | Ga0501073_1289580 | Ga0501073_1289580_76_363 | 94 |
| 7 | 3300049741 | Ga0501079_0006415 | Ga0501079_0006415_5164_5451 | 94 |
| 8 | 3300049742 | Ga0501080_0116518 | Ga0501080_0116518_747_1034 | 94 |
| 9 | 3300049744 | Ga0501083_0015081 | Ga0501083_0015081_751_1038 | 94 |
| 10 | 3300049823 | Ga0501044_0186240 | Ga0501044_0186240_316_603 | 94 |
| 11 | 3300001977 | JGI24746J21847_1000305 | JGI24746J21847_10003054 | 95 |
| 12 | 3300005331 | Ga0070670_100054576 | Ga0070670_1000545762 | 95 |
| 13 | 3300005338 | Ga0068868_100000450 | Ga0068868_1000004508 | 95 |
| 14 | 3300005339 | Ga0070660_100531488 | Ga0070660_1005314882 | 95 |
| 15 | 3300005344 | Ga0070661_100177024 | Ga0070661_1001770243 | 95 |
| 16 | 3300005344 | Ga0070661_100534251 | Ga0070661_1005342512 | 95 |
| 17 | 3300005345 | Ga0070692_10044881 | Ga0070692_100448812 | 95 |
| 18 | 3300005347 | Ga0070668_100505597 | Ga0070668_1005055972 | 95 |
| 19 | 3300005354 | Ga0070675_100000027 | Ga0070675_10000002733 | 95 |
| 20 | 3300005354 | Ga0070675_100308753 | Ga0070675_1003087532 | 95 |
| 21 | 3300005356 | Ga0070674_100046318 | Ga0070674_1000463183 | 95 |
| 22 | 3300005356 | Ga0070674_100287048 | Ga0070674_1002870483 | 95 |
| 23 | 3300005365 | Ga0070688_100001250 | Ga0070688_10000125011 | 95 |
| 24 | 3300005366 | Ga0070659_101923015 | Ga0070659_1019230151 | 95 |
| 25 | 3300005367 | Ga0070667_100413472 | Ga0070667_1004134722 | 95 |
| 26 | 3300005435 | Ga0070714_100089298 | Ga0070714_1000892983 | 95 |
| 27 | 3300005435 | Ga0070714_100090319 | Ga0070714_1000903194 | 95 |
| 28 | 3300005436 | Ga0070713_101366531 | Ga0070713_1013665312 | 95 |
| 29 | 3300005438 | Ga0070701_10963698 | Ga0070701_109636981 | 95 |
| 30 | 3300005441 | Ga0070700_100229234 | Ga0070700_1002292342 | 95 |
| 31 | 3300005455 | Ga0070663_102112682 | Ga0070663_1021126822 | 95 |
| 32 | 3300005457 | Ga0070662_100000004 | Ga0070662_100000004151 | 95 |
| 33 | 3300005459 | Ga0068867_100481143 | Ga0068867_1004811432 | 95 |
| 34 | 3300005466 | Ga0070685_10001410 | Ga0070685_1000141011 | 95 |
| 35 | 3300005466 | Ga0070685_10878395 | Ga0070685_108783951 | 95 |
| 36 | 3300005535 | Ga0070684_100024292 | Ga0070684_1000242924 | 95 |
| 37 | 3300005535 | Ga0070684_100156085 | Ga0070684_1001560853 | 95 |
| 38 | 3300005543 | Ga0070672_100000293 | Ga0070672_10000029324 | 95 |
| 39 | 3300005543 | Ga0070672_100521094 | Ga0070672_1005210942 | 95 |
| 40 | 3300005547 | Ga0070693_100004573 | Ga0070693_1000045736 | 95 |
| 41 | 3300005548 | Ga0070665_100000106 | Ga0070665_10000010624 | 95 |
| 42 | 3300005548 | Ga0070665_100039235 | Ga0070665_1000392354 | 95 |
| 43 | 3300005548 | Ga0070665_101042695 | Ga0070665_1010426952 | 95 |
| 44 | 3300005548 | Ga0070665_101114334 | Ga0070665_1011143341 | 95 |
| 45 | 3300005548 | Ga0070665_101678776 | Ga0070665_1016787762 | 95 |
| 46 | 3300005549 | Ga0070704_100740429 | Ga0070704_1007404292 | 95 |
| 47 | 3300005549 | Ga0070704_102043247 | Ga0070704_1020432471 | 95 |
| 48 | 3300005577 | Ga0068857_101572342 | Ga0068857_1015723422 | 95 |
| 49 | 3300005614 | Ga0068856_100008468 | Ga0068856_1000084683 | 95 |
| 50 | 3300005616 | Ga0068852_100000006 | Ga0068852_100000006150 | 95 |
| 51 | 3300005616 | Ga0068852_100579402 | Ga0068852_1005794022 | 95 |
| 52 | 3300005719 | Ga0068861_100441558 | Ga0068861_1004415582 | 95 |
| 53 | 3300005719 | Ga0068861_102309234 | Ga0068861_1023092342 | 95 |
| 54 | 3300005842 | Ga0068858_100000009 | Ga0068858_100000009179 | 95 |
| 55 | 3300005843 | Ga0068860_100141601 | Ga0068860_1001416012 | 95 |
| 56 | 3300005844 | Ga0068862_101501987 | Ga0068862_1015019871 | 95 |
| 57 | 3300005937 | Ga0081455_10021219 | Ga0081455_100212193 | 95 |
| 58 | 3300005981 | Ga0081538_10000467 | Ga0081538_1000046721 | 95 |
| 59 | 3300006175 | Ga0070712_100845309 | Ga0070712_1008453092 | 95 |
| 60 | 3300006847 | Ga0075431_100081736 | Ga0075431_1000817363 | 95 |
| 61 | 3300006881 | Ga0068865_100125588 | Ga0068865_1001255883 | 95 |
| 62 | 3300009098 | Ga0105245_10000254 | Ga0105245_100002544 | 95 |
| 63 | 3300009098 | Ga0105245_10735951 | Ga0105245_107359512 | 95 |
| 64 | 3300009098 | Ga0105245_11923573 | Ga0105245_119235732 | 95 |
| 65 | 3300009101 | Ga0105247_10000316 | Ga0105247_1000031637 | 95 |
| 66 | 3300009101 | Ga0105247_11493860 | Ga0105247_114938601 | 95 |
| 67 | 3300009148 | Ga0105243_10040421 | Ga0105243_100404217 | 95 |
| 68 | 3300009148 | Ga0105243_10162820 | Ga0105243_101628202 | 95 |
| 69 | 3300009174 | Ga0105241_10324889 | Ga0105241_103248891 | 95 |
| 70 | 3300009176 | Ga0105242_10000454 | Ga0105242_1000045416 | 95 |
| 71 | 3300009176 | Ga0105242_10118343 | Ga0105242_101183432 | 95 |
| 72 | 3300009176 | Ga0105242_10154085 | Ga0105242_101540852 | 95 |
| 73 | 3300009177 | Ga0105248_10000008 | Ga0105248_10000008310 | 95 |
| 74 | 3300009177 | Ga0105248_11736334 | Ga0105248_117363342 | 95 |
| 75 | 3300009551 | Ga0105238_10000011 | Ga0105238_10000011209 | 95 |
| 76 | 3300009551 | Ga0105238_10307402 | Ga0105238_103074022 | 95 |
| 77 | 3300009553 | Ga0105249_10582354 | Ga0105249_105823542 | 95 |
| 78 | 3300009553 | Ga0105249_10757070 | Ga0105249_107570702 | 95 |
| 79 | 3300009553 | Ga0105249_10903066 | Ga0105249_109030661 | 95 |
| 80 | 3300010375 | Ga0105239_10610284 | Ga0105239_106102843 | 95 |
| 81 | 3300013104 | Ga0157370_10141010 | Ga0157370_101410104 | 95 |
| 82 | 3300013105 | Ga0157369_10000020 | Ga0157369_10000020191 | 95 |
| 83 | 3300013296 | Ga0157374_10095265 | Ga0157374_100952653 | 95 |
| 84 | 3300013297 | Ga0157378_10005986 | Ga0157378_1000598614 | 95 |
| 85 | 3300013297 | Ga0157378_10030467 | Ga0157378_100304674 | 95 |
| 86 | 3300013306 | Ga0163162_11665096 | Ga0163162_116650962 | 95 |
| 87 | 3300013308 | Ga0157375_10173261 | Ga0157375_101732613 | 95 |
| 88 | 3300013308 | Ga0157375_10380635 | Ga0157375_103806352 | 95 |
| 89 | 3300013308 | Ga0157375_10401382 | Ga0157375_104013823 | 95 |
| 90 | 3300013308 | Ga0157375_10549233 | Ga0157375_105492332 | 95 |
| 91 | 3300013308 | Ga0157375_12750785 | Ga0157375_127507852 | 95 |
| 92 | 3300014325 | Ga0163163_11562753 | Ga0163163_115627532 | 95 |
| 93 | 3300014326 | Ga0157380_10002003 | Ga0157380_1000200314 | 95 |
| 94 | 3300014326 | Ga0157380_10174238 | Ga0157380_101742382 | 95 |
| 95 | 3300014326 | Ga0157380_12076472 | Ga0157380_120764722 | 95 |
| 96 | 3300014326 | Ga0157380_12949067 | Ga0157380_129490671 | 95 |
| 97 | 3300014745 | Ga0157377_11508729 | Ga0157377_115087291 | 95 |
| 98 | 3300014968 | Ga0157379_11175426 | Ga0157379_111754262 | 95 |
| 99 | 3300014968 | Ga0157379_11483396 | Ga0157379_114833961 | 95 |
| 100 | 3300014969 | Ga0157376_10197465 | Ga0157376_101974653 | 95 |
| 101 | 3300017792 | Ga0163161_10287628 | Ga0163161_102876282 | 95 |
| 102 | 3300020070 | Ga0206356_10048422 | Ga0206356_100484222 | 95 |
| 103 | 3300025900 | Ga0207710_10000458 | Ga0207710_1000045818 | 95 |
| 104 | 3300025903 | Ga0207680_10159342 | Ga0207680_101593423 | 95 |
| 105 | 3300025904 | Ga0207647_10565075 | Ga0207647_105650752 | 95 |
| 106 | 3300025907 | Ga0207645_10978167 | Ga0207645_109781672 | 95 |
| 107 | 3300025909 | Ga0207705_10167133 | Ga0207705_101671332 | 95 |
| 108 | 3300025914 | Ga0207671_10005068 | Ga0207671_100050682 | 95 |
| 109 | 3300025915 | Ga0207693_10052539 | Ga0207693_100525393 | 95 |
| 110 | 3300025915 | Ga0207693_10107054 | Ga0207693_101070542 | 95 |
| 111 | 3300025915 | Ga0207693_10734208 | Ga0207693_107342082 | 95 |
| 112 | 3300025915 | Ga0207693_10824648 | Ga0207693_108246482 | 95 |
| 113 | 3300025919 | Ga0207657_10362895 | Ga0207657_103628953 | 95 |
| 114 | 3300025920 | Ga0207649_10000009 | Ga0207649_10000009240 | 95 |
| 115 | 3300025920 | Ga0207649_10350271 | Ga0207649_103502712 | 95 |
| 116 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004413 | 95 |
| 117 | 3300025926 | Ga0207659_10000010 | Ga0207659_1000001066 | 95 |
| 118 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007430 | 95 |
| 119 | 3300025928 | Ga0207700_10200216 | Ga0207700_102002162 | 95 |
| 120 | 3300025929 | Ga0207664_10018436 | Ga0207664_100184366 | 95 |
| 121 | 3300025929 | Ga0207664_10100280 | Ga0207664_101002803 | 95 |
| 122 | 3300025929 | Ga0207664_10630625 | Ga0207664_106306253 | 95 |
| 123 | 3300025929 | Ga0207664_10733359 | Ga0207664_107333592 | 95 |
| 124 | 3300025932 | Ga0207690_10076663 | Ga0207690_100766633 | 95 |
| 125 | 3300025933 | Ga0207706_10000012 | Ga0207706_1000001267 | 95 |
| 126 | 3300025934 | Ga0207686_10356998 | Ga0207686_103569981 | 95 |
| 127 | 3300025934 | Ga0207686_10476060 | Ga0207686_104760602 | 95 |
| 128 | 3300025935 | Ga0207709_10291774 | Ga0207709_102917742 | 95 |
| 129 | 3300025936 | Ga0207670_10885940 | Ga0207670_108859402 | 95 |
| 130 | 3300025937 | Ga0207669_10229221 | Ga0207669_102292213 | 95 |
| 131 | 3300025937 | Ga0207669_10294267 | Ga0207669_102942672 | 95 |
| 132 | 3300025938 | Ga0207704_10166876 | Ga0207704_101668762 | 95 |
| 133 | 3300025940 | Ga0207691_10000044 | Ga0207691_100000443 | 95 |
| 134 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006704 | 95 |
| 135 | 3300025944 | Ga0207661_10000253 | Ga0207661_1000025340 | 95 |
| 136 | 3300025944 | Ga0207661_10148671 | Ga0207661_101486712 | 95 |
| 137 | 3300025961 | Ga0207712_10382987 | Ga0207712_103829872 | 95 |
| 138 | 3300025972 | Ga0207668_10882957 | Ga0207668_108829572 | 95 |
| 139 | 3300026023 | Ga0207677_10000200 | Ga0207677_1000020026 | 95 |
| 140 | 3300026035 | Ga0207703_10000023 | Ga0207703_1000002386 | 95 |
| 141 | 3300026035 | Ga0207703_11429498 | Ga0207703_114294982 | 95 |
| 142 | 3300026041 | Ga0207639_10161229 | Ga0207639_101612293 | 95 |
| 143 | 3300026075 | Ga0207708_10047844 | Ga0207708_100478444 | 95 |
| 144 | 3300026078 | Ga0207702_10000158 | Ga0207702_1000015879 | 95 |
| 145 | 3300026078 | Ga0207702_10004391 | Ga0207702_1000439112 | 95 |
| 146 | 3300026089 | Ga0207648_10738955 | Ga0207648_107389552 | 95 |
| 147 | 3300026118 | Ga0207675_101210725 | Ga0207675_1012107252 | 95 |
| 148 | 3300026142 | Ga0207698_10000013 | Ga0207698_1000001339 | 95 |
| 149 | 3300026142 | Ga0207698_10099362 | Ga0207698_100993622 | 95 |
| 150 | 3300028379 | Ga0268266_10000047 | Ga0268266_10000047176 | 95 |
| 151 | 3300028379 | Ga0268266_10009710 | Ga0268266_100097105 | 95 |
| 152 | 3300028379 | Ga0268266_10200557 | Ga0268266_102005572 | 95 |
| 153 | 3300028379 | Ga0268266_11348234 | Ga0268266_113482342 | 95 |
| 154 | 3300028380 | Ga0268265_11247673 | Ga0268265_112476732 | 95 |
| 155 | 3300028381 | Ga0268264_10095164 | Ga0268264_100951642 | 95 |
| 156 | 3300028573 | Ga0265334_10105748 | Ga0265334_101057481 | 95 |
| 157 | 3300028800 | Ga0265338_10395708 | Ga0265338_103957082 | 95 |
| 158 | 3300036401 | Ga0373937_0561247 | Ga0373937_0561247_177_467 | 95 |
| 159 | 3300037853 | Ga0436364_0739833 | Ga0436364_0739833_129_416 | 95 |
| 160 | 3300041458 | Ga0451798_1035661 | Ga0451798_1035661_175_465 | 95 |
| 161 | 3300041512 | Ga0451853_1685780 | Ga0451853_1685780_1160_1450 | 95 |
| 162 | 3300041512 | Ga0451853_3297983 | Ga0451853_3297983_3910_4200 | 95 |
| 163 | 3300042993 | Ga0439440_0016114 | Ga0439440_0016114_871_1194 | 95 |
| 164 | 3300044842 | Ga0466957_0029121 | Ga0466957_0029121_1115_1405 | 95 |
| 165 | 3300044842 | Ga0466957_0287140 | Ga0466957_0287140_242_532 | 95 |
| 166 | 3300045976 | Ga0466967_0342547 | Ga0466967_0342547_1003_1293 | 95 |
| 167 | 3300045976 | Ga0466967_1220413 | Ga0466967_1220413_446_733 | 95 |
| 168 | 3300046454 | Ga0495592_0166584 | Ga0495592_0166584_975_1265 | 95 |
| 169 | 3300046454 | Ga0495592_0218115 | Ga0495592_0218115_31_321 | 95 |
| 170 | 3300046459 | Ga0495629_0001726 | Ga0495629_0001726_12300_12590 | 95 |
| 171 | 3300046459 | Ga0495629_0003604 | Ga0495629_0003604_10257_10556 | 95 |
| 172 | 3300046459 | Ga0495629_0081270 | Ga0495629_0081270_1239_1529 | 95 |
| 173 | 3300046459 | Ga0495629_0240331 | Ga0495629_0240331_79_369 | 95 |
| 174 | 3300046459 | Ga0495629_0474019 | Ga0495629_0474019_311_601 | 95 |
| 175 | 3300046461 | Ga0495641_0000228 | Ga0495641_0000228_7625_7915 | 95 |
| 176 | 3300046461 | Ga0495641_0043135 | Ga0495641_0043135_523_813 | 95 |
| 177 | 3300046462 | Ga0495651_0051484 | Ga0495651_0051484_1475_1765 | 95 |
| 178 | 3300046463 | Ga0495653_0137335 | Ga0495653_0137335_187_477 | 95 |
| 179 | 3300046463 | Ga0495653_0817358 | Ga0495653_0817358_220_510 | 95 |
| 180 | 3300046476 | Ga0495662_0004365 | Ga0495662_0004365_1956_2246 | 95 |
| 181 | 3300046477 | Ga0495664_0243037 | Ga0495664_0243037_569_859 | 95 |
| 182 | 3300046499 | Ga0495594_0000029 | Ga0495594_0000029_44630_44920 | 95 |
| 183 | 3300046507 | Ga0495606_0000072 | Ga0495606_0000072_10713_11003 | 95 |
| 184 | 3300046514 | Ga0495618_0251286 | Ga0495618_0251286_304_594 | 95 |
| 185 | 3300046516 | Ga0495628_0023428 | Ga0495628_0023428_3291_3581 | 95 |
| 186 | 3300046516 | Ga0495628_0129509 | Ga0495628_0129509_889_1179 | 95 |
| 187 | 3300046516 | Ga0495628_0318506 | Ga0495628_0318506_818_1108 | 95 |
| 188 | 3300046517 | Ga0495630_0325744 | Ga0495630_0325744_419_709 | 95 |
| 189 | 3300046517 | Ga0495630_0871328 | Ga0495630_0871328_306_596 | 95 |
| 190 | 3300046523 | Ga0495644_0003786 | Ga0495644_0003786_5251_5550 | 95 |
| 191 | 3300046529 | Ga0495652_0000407 | Ga0495652_0000407_31441_31731 | 95 |
| 192 | 3300046529 | Ga0495652_0017869 | Ga0495652_0017869_2339_2629 | 95 |
| 193 | 3300046533 | Ga0495640_0017874 | Ga0495640_0017874_3011_3304 | 95 |
| 194 | 3300046533 | Ga0495640_0304088 | Ga0495640_0304088_81_371 | 95 |
| 195 | 3300046535 | Ga0495586_0000161 | Ga0495586_0000161_3357_3647 | 95 |
| 196 | 3300046536 | Ga0495587_0025086 | Ga0495587_0025086_76_366 | 95 |
| 197 | 3300046537 | Ga0495598_0056702 | Ga0495598_0056702_513_812 | 95 |
| 198 | 3300046543 | Ga0495645_0019665 | Ga0495645_0019665_1345_1635 | 95 |
| 199 | 3300046543 | Ga0495645_0126231 | Ga0495645_0126231_1486_1785 | 95 |
| 200 | 3300046557 | Ga0495622_0000550 | Ga0495622_0000550_8417_8707 | 95 |
| 201 | 3300046558 | Ga0495633_0055276 | Ga0495633_0055276_1167_1457 | 95 |
| 202 | 3300046559 | Ga0495667_0088032 | Ga0495667_0088032_452_748 | 95 |
| 203 | 3300046642 | Ga0495634_0005238 | Ga0495634_0005238_3286_3576 | 95 |
| 204 | 3300046642 | Ga0495634_0009160 | Ga0495634_0009160_2724_3014 | 95 |
| 205 | 3300046642 | Ga0495634_0077660 | Ga0495634_0077660_1021_1311 | 95 |
| 206 | 3300046674 | Ga0495588_0000134 | Ga0495588_0000134_13416_13706 | 95 |
| 207 | 3300046678 | Ga0495599_0017233 | Ga0495599_0017233_1543_1833 | 95 |
| 208 | 3300046678 | Ga0495599_0502167 | Ga0495599_0502167_92_391 | 95 |
| 209 | 3300046680 | Ga0495646_0354418 | Ga0495646_0354418_190_480 | 95 |
| 210 | 3300046681 | Ga0495647_0000018 | Ga0495647_0000018_69788_70078 | 95 |
| 211 | 3300046684 | Ga0495669_0136000 | Ga0495669_0136000_100_387 | 95 |
| 212 | 3300046689 | Ga0495613_0315370 | Ga0495613_0315370_233_523 | 95 |
| 213 | 3300046690 | Ga0495624_0000097 | Ga0495624_0000097_52365_52655 | 95 |
| 214 | 3300046691 | Ga0495670_0019972 | Ga0495670_0019972_447_737 | 95 |
| 215 | 3300046809 | Ga0495600_0007876 | Ga0495600_0007876_233_523 | 95 |
| 216 | 3300046809 | Ga0495600_0049137 | Ga0495600_0049137_893_1183 | 95 |
| 217 | 3300047319 | Ga0495674_0000064 | Ga0495674_0000064_33989_34282 | 95 |
| 218 | 3300047319 | Ga0495674_0067608 | Ga0495674_0067608_1501_1791 | 95 |
| 219 | 3300047319 | Ga0495674_0985485 | Ga0495674_0985485_292_591 | 95 |
| 220 | 3300047320 | Ga0495672_0012161 | Ga0495672_0012161_4545_4832 | 95 |
| 221 | 3300047320 | Ga0495672_0041619 | Ga0495672_0041619_1180_1470 | 95 |
| 222 | 3300047321 | Ga0495676_0002521 | Ga0495676_0002521_8686_8976 | 95 |
| 223 | 3300047322 | Ga0495680_0087972 | Ga0495680_0087972_1662_1952 | 95 |
| 224 | 3300047446 | Ga0495679_033543 | Ga0495679_033543_1320_1619 | 95 |
| 225 | 3300047471 | Ga0495684_0332784 | Ga0495684_0332784_126_416 | 95 |
| 226 | 3300047673 | Ga0495593_0180483 | Ga0495593_0180483_478_777 | 95 |
| 227 | 3300048088 | Ga0495602_0040615 | Ga0495602_0040615_3304_3594 | 95 |
| 228 | 3300048088 | Ga0495602_0807325 | Ga0495602_0807325_103_393 | 95 |
| 229 | 3300048903 | Ga0496100_0985900 | Ga0496100_0985900_136_429 | 95 |
| 230 | 3300048904 | Ga0496101_0549971 | Ga0496101_0549971_605_895 | 95 |
| 231 | 3300048905 | Ga0496102_0244723 | Ga0496102_0244723_921_1211 | 95 |
| 232 | 3300048905 | Ga0496102_0429586 | Ga0496102_0429586_273_563 | 95 |
| 233 | 3300048905 | Ga0496102_1655545 | Ga0496102_1655545_40_330 | 95 |
| 234 | 3300048906 | Ga0496103_0255744 | Ga0496103_0255744_269_559 | 95 |
| 235 | 3300048907 | Ga0496104_0000004 | Ga0496104_0000004_346747_347037 | 95 |
| 236 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_294794_295084 | 95 |
| 237 | 3300048909 | Ga0496106_0000151 | Ga0496106_0000151_4410_4700 | 95 |
| 238 | 3300048909 | Ga0496106_0459370 | Ga0496106_0459370_710_997 | 95 |
| 239 | 3300048910 | Ga0496107_0142710 | Ga0496107_0142710_1341_1631 | 95 |
| 240 | 3300048910 | Ga0496107_0183754 | Ga0496107_0183754_420_710 | 95 |
| 241 | 3300048910 | Ga0496107_0536654 | Ga0496107_0536654_474_767 | 95 |
| 242 | 3300048911 | Ga0496108_0049450 | Ga0496108_0049450_2209_2499 | 95 |
| 243 | 3300048912 | Ga0496109_0000249 | Ga0496109_0000249_45723_46013 | 95 |
| 244 | 3300048912 | Ga0496109_0826775 | Ga0496109_0826775_490_780 | 95 |
| 245 | 3300048912 | Ga0496109_0940095 | Ga0496109_0940095_80_367 | 95 |
| 246 | 3300048913 | Ga0496110_0011255 | Ga0496110_0011255_1853_2143 | 95 |
| 247 | 3300048913 | Ga0496110_0030348 | Ga0496110_0030348_3263_3553 | 95 |
| 248 | 3300048913 | Ga0496110_0270238 | Ga0496110_0270238_472_762 | 95 |
| 249 | 3300048913 | Ga0496110_0276481 | Ga0496110_0276481_1017_1307 | 95 |
| 250 | 3300048914 | Ga0496111_0131752 | Ga0496111_0131752_40_330 | 95 |
| 251 | 3300048914 | Ga0496111_0229400 | Ga0496111_0229400_715_1005 | 95 |
| 252 | 3300048914 | Ga0496111_0443323 | Ga0496111_0443323_236_523 | 95 |
| 253 | 3300048915 | Ga0496112_0904978 | Ga0496112_0904978_77_364 | 95 |
| 254 | 3300048916 | Ga0496113_0091448 | Ga0496113_0091448_806_1093 | 95 |
| 255 | 3300048917 | Ga0496114_0620830 | Ga0496114_0620830_296_586 | 95 |
| 256 | 3300048918 | Ga0496115_0000226 | Ga0496115_0000226_5308_5631 | 95 |
| 257 | 3300048919 | Ga0496116_0000735 | Ga0496116_0000735_4745_5035 | 95 |
| 258 | 3300048920 | Ga0496117_0004253 | Ga0496117_0004253_2005_2295 | 95 |
| 259 | 3300048920 | Ga0496117_0412246 | Ga0496117_0412246_52_342 | 95 |
| 260 | 3300048921 | Ga0496118_0014032 | Ga0496118_0014032_4503_4796 | 95 |
| 261 | 3300048921 | Ga0496118_0016560 | Ga0496118_0016560_4692_4982 | 95 |
| 262 | 3300048921 | Ga0496118_0389615 | Ga0496118_0389615_285_578 | 95 |
| 263 | 3300048922 | Ga0496119_0005911 | Ga0496119_0005911_4255_4545 | 95 |
| 264 | 3300048922 | Ga0496119_0008529 | Ga0496119_0008529_4766_5056 | 95 |
| 265 | 3300048922 | Ga0496119_0027449 | Ga0496119_0027449_1447_1737 | 95 |
| 266 | 3300048922 | Ga0496119_0276275 | Ga0496119_0276275_226_519 | 95 |
| 267 | 3300048923 | Ga0496120_0010399 | Ga0496120_0010399_5034_5324 | 95 |
| 268 | 3300048924 | Ga0496121_0025396 | Ga0496121_0025396_2186_2476 | 95 |
| 269 | 3300048924 | Ga0496121_0061202 | Ga0496121_0061202_1592_1882 | 95 |
| 270 | 3300048929 | Ga0496126_0400811 | Ga0496126_0400811_86_376 | 95 |
| 271 | 3300049568 | Ga0501031_0807419 | Ga0501031_0807419_78_377 | 95 |
| 272 | 3300049569 | Ga0501032_0528344 | Ga0501032_0528344_266_556 | 95 |
| 273 | 3300049571 | Ga0501034_0333038 | Ga0501034_0333038_1000_1290 | 95 |
| 274 | 3300049572 | Ga0501036_1676115 | Ga0501036_1676115_214_501 | 95 |
| 275 | 3300049576 | Ga0501040_0261083 | Ga0501040_0261083_401_688 | 95 |
| 276 | 3300049578 | Ga0501042_0024473 | Ga0501042_0024473_136_426 | 95 |
| 277 | 3300049578 | Ga0501042_0357908 | Ga0501042_0357908_337_624 | 95 |
| 278 | 3300049579 | Ga0501043_0645511 | Ga0501043_0645511_216_506 | 95 |
| 279 | 3300049579 | Ga0501043_0666048 | Ga0501043_0666048_228_518 | 95 |
| 280 | 3300049581 | Ga0501047_0006995 | Ga0501047_0006995_7826_8116 | 95 |
| 281 | 3300049581 | Ga0501047_0045524 | Ga0501047_0045524_678_968 | 95 |
| 282 | 3300049581 | Ga0501047_0286154 | Ga0501047_0286154_504_794 | 95 |
| 283 | 3300049582 | Ga0501048_1277404 | Ga0501048_1277404_118_408 | 95 |
| 284 | 3300049584 | Ga0501068_0133547 | Ga0501068_0133547_676_966 | 95 |
| 285 | 3300049584 | Ga0501068_0495805 | Ga0501068_0495805_295_585 | 95 |
| 286 | 3300049586 | Ga0501070_0088369 | Ga0501070_0088369_1484_1774 | 95 |
| 287 | 3300049590 | Ga0501074_0053997 | Ga0501074_0053997_442_732 | 95 |
| 288 | 3300049591 | Ga0501075_0009392 | Ga0501075_0009392_538_828 | 95 |
| 289 | 3300049591 | Ga0501075_0546991 | Ga0501075_0546991_14_304 | 95 |
| 290 | 3300049743 | Ga0501081_0118602 | Ga0501081_0118602_946_1236 | 95 |
| 291 | 3300049743 | Ga0501081_0711205 | Ga0501081_0711205_199_489 | 95 |
| 292 | 3300049744 | Ga0501083_0086471 | Ga0501083_0086471_698_988 | 95 |
| 293 | 3300049823 | Ga0501044_0399359 | Ga0501044_0399359_637_927 | 95 |
| 294 | 3300049824 | Ga0501045_0252710 | Ga0501045_0252710_516_806 | 95 |
| 295 | 3300050507 | nmdc:mga05p37_1012111_c1 | nmdc:mga05p37_1012111_c1_518_805 | 95 |
| 296 | 3300050510 | nmdc:mga06r32_1834163_c1 | nmdc:mga06r32_1834163_c1_210_500 | 95 |
| 297 | 3300050510 | nmdc:mga06r32_28506_c1 | nmdc:mga06r32_28506_c1_3502_3792 | 95 |
| 298 | 3300050515 | nmdc:mga0a205_6_c1 | nmdc:mga0a205_6_c1_123769_124059 | 95 |
| 299 | 3300053077 | Ga0495601_0000855 | Ga0495601_0000855_6104_6394 | 95 |
| 300 | 3300053077 | Ga0495601_0164884 | Ga0495601_0164884_1107_1397 | 95 |
| 301 | 3300053077 | Ga0495601_0359137 | Ga0495601_0359137_59_349 | 95 |
| 302 | 3300053077 | Ga0495601_0836812 | Ga0495601_0836812_283_573 | 95 |
| 303 | 3300053078 | Ga0495612_0000164 | Ga0495612_0000164_12268_12558 | 95 |
| 304 | 3300053078 | Ga0495612_0061466 | Ga0495612_0061466_1022_1309 | 95 |
| 305 | 3300053078 | Ga0495612_0121900 | Ga0495612_0121900_65_355 | 95 |
| 306 | 3300053078 | Ga0495612_0219485 | Ga0495612_0219485_531_821 | 95 |
| 307 | 3300053080 | Ga0500635_0244012 | Ga0500635_0244012_139_429 | 95 |
| 308 | 3300053083 | Ga0495655_0073697 | Ga0495655_0073697_369_659 | 95 |
| 309 | 3300053084 | Ga0495595_0259590 | Ga0495595_0259590_190_480 | 95 |
| 310 | 3300053085 | Ga0495619_0000157 | Ga0495619_0000157_41407_41697 | 95 |
| 311 | 3300053085 | Ga0495619_0167470 | Ga0495619_0167470_1095_1385 | 95 |
| 312 | 3300053085 | Ga0495619_0652155 | Ga0495619_0652155_168_458 | 95 |
| 313 | 3300053094 | Ga0500566_0462400 | Ga0500566_0462400_137_427 | 95 |
| 314 | 3300053119 | Ga0500595_046238 | Ga0500595_046238_239_529 | 95 |
| 315 | 3300053123 | Ga0500614_000451 | Ga0500614_000451_2273_2563 | 95 |
| 316 | 3300053134 | Ga0500658_0152208 | Ga0500658_0152208_539_829 | 95 |
| 317 | 3300061734 | Ga0530510_1201249 | Ga0530510_1201249_10_297 | 95 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7d34-assembly1.cif.gz_B | atclps1-peptide complex | 0.9427 | 17 | 94 |
| 4o2x-assembly2.cif.gz_B | structure of a malarial protein | 0.9403 | 20 | 95 |
| 4o2x-assembly1.cif.gz_A | structure of a malarial protein | 0.9162 | 20 | 95 |
| 7d34-assembly1.cif.gz_B | atclps1-peptide complex | 0.9088 | 17 | 94 |
| 3dnj-assembly2.cif.gz_A | the structure of the caulobacter crescentus clps protease adaptor protein in complex with a n-end rule peptide | 0.8883 | 21 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0IJ84_76_154_3.30.1390.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9636 | 20 | 93 | 3.30.1390.10 |
| af_Q8IEB2_84_184_3.30.1390.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9491 | 18 | 94 | 3.30.1390.10 |
| af_A0A0R0IJ84_76_154_3.30.1390.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.8818 | 20 | 93 | 3.30.1390.10 |
| 3o1fA00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.8655 | 19 | 95 | 3.30.1390.10 |
| af_P0A8Q6_1_106_3.30.1390.10 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.8361 | 14 | 95 | 3.30.1390.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W4VXJ9-F1-model_v4 | Clp protease ClpS | 0.9748 | 23 | 95 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A7S1BRN6-F1-model_v4 | Adaptor protein ClpS core domain-containing protein | 0.9652 | 21 | 93 |
GO:0006508
GO:0030163 |
| AF-U6MKK3-F1-model_v4 | ATP-dependent Clp protease adaptor domain-containing protein, putative | 0.9626 | 20 | 94 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A0F7U7B7-F1-model_v4 | ATP-dependent Clp protease adaptor domain-containing protein, putative | 0.9611 | 19 | 95 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A7S1KE53-F1-model_v4 | Adaptor protein ClpS core domain-containing protein | 0.9599 | 20 | 94 |
GO:0006508
GO:0030163 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar