F404191

General Info

Members Datasets Scaffolds Average Seq Length
317 203 317 96

Family's Representative Sequence

Representative Sequence 3300025936|Ga0207670_10885940|Ga0207670_108859402
Length 117
Sequence MVDGHAAGLFPDAETFRIMASVSTSTVERPRTDGPGSDLGGDWRVIVRNDSHNTFDHVAQSLARVLPGVSLERGHELAESIHNNGLAIVWSGPREPAEHYWQQLKAAGLTMAPLERA

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
103 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
104 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
195 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
196 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
197 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
200 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
201 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.58
Nodule 0
Rhizoplane 9.15
Rhizosphere 83.91
Stem 0
Stem Tuber 0
Unclassified 5.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000305 3300001977 Bacteria 7033
2 Ga0070670_100054576 3300005331 Bacteria 3431
3 Ga0068868_100000450 3300005338 Bacteria 27515
4 Ga0070660_100531488 3300005339 Bacteria 980
5 Ga0070661_100177024 3300005344 Bacteria 1622
6 Ga0070661_100534251 3300005344 Unclassified 942
7 Ga0070692_10044881 3300005345 Bacteria 2279
8 Ga0070668_100505597 3300005347 Bacteria 1047
9 Ga0070675_100000027 3300005354 Bacteria 106172
10 Ga0070675_100308753 3300005354 Bacteria 1395
11 Ga0070674_100046318 3300005356 Bacteria 2974
12 Ga0070674_100287048 3300005356 Bacteria 1307
13 Ga0070688_100001250 3300005365 Bacteria 12681
14 Ga0070659_101923015 3300005366 Bacteria 531
15 Ga0070667_100413472 3300005367 Bacteria 1229
16 Ga0070714_100089298 3300005435 Bacteria 2698
17 Ga0070714_100090319 3300005435 Bacteria 2682
18 Ga0070713_101366531 3300005436 Bacteria 687
19 Ga0070701_10963698 3300005438 Bacteria 593
20 Ga0070700_100229234 3300005441 Bacteria 1321
21 Ga0070663_102112682 3300005455 Bacteria 508
22 Ga0070662_100000004 3300005457 Bacteria 195534
23 Ga0068867_100481143 3300005459 Bacteria 1064
24 Ga0070685_10001410 3300005466 Bacteria 12591
25 Ga0070685_10878395 3300005466 Bacteria 666
26 Ga0070684_100024292 3300005535 Bacteria 5082
27 Ga0070684_100156085 3300005535 Bacteria 2069
28 Ga0070672_100000293 3300005543 Bacteria 28247
29 Ga0070672_100521094 3300005543 Bacteria 1030
30 Ga0070693_100004573 3300005547 Bacteria 6563
31 Ga0070665_100000106 3300005548 Bacteria 157315
32 Ga0070665_100039235 3300005548 Bacteria 4762
33 Ga0070665_101042695 3300005548 Bacteria 830
34 Ga0070665_101114334 3300005548 Bacteria 801
35 Ga0070665_101678776 3300005548 Unclassified 643
36 Ga0070704_100740429 3300005549 Bacteria 874
37 Ga0070704_102043247 3300005549 Bacteria 532
38 Ga0068857_101572342 3300005577 Bacteria 642
39 Ga0068856_100008468 3300005614 Bacteria 10010
40 Ga0068852_100000006 3300005616 Bacteria 159569
41 Ga0068852_100579402 3300005616 Bacteria 1125
42 Ga0068861_100441558 3300005719 Bacteria 1164
43 Ga0068861_102309234 3300005719 Bacteria 540
44 Ga0068858_100000009 3300005842 Bacteria 237748
45 Ga0068860_100141601 3300005843 Bacteria 2312
46 Ga0068860_100832372 3300005843 Bacteria 937
47 Ga0068862_101501987 3300005844 Bacteria 679
48 Ga0081455_10021219 3300005937 Bacteria 6097
49 Ga0081538_10000467 3300005981 Bacteria 45342
50 Ga0070712_100845309 3300006175 Bacteria 787
51 Ga0075431_100081736 3300006847 Bacteria 3336
52 Ga0068865_100125588 3300006881 Bacteria 1914
53 Ga0105245_10000254 3300009098 Bacteria 50918
54 Ga0105245_10735951 3300009098 Bacteria 1021
55 Ga0105245_11923573 3300009098 Bacteria 645
56 Ga0105247_10000316 3300009101 Bacteria 43374
57 Ga0105247_11493860 3300009101 Bacteria 551
58 Ga0105243_10040421 3300009148 Bacteria 3642
59 Ga0105243_10162820 3300009148 Bacteria 1925
60 Ga0105241_10324889 3300009174 Bacteria 1328
61 Ga0105242_10000454 3300009176 Bacteria 32662
62 Ga0105242_10118343 3300009176 Bacteria 2269
63 Ga0105242_10154085 3300009176 Unclassified 2006
64 Ga0105248_10000008 3300009177 Bacteria 403910
65 Ga0105248_11736334 3300009177 Bacteria 708
66 Ga0105238_10000011 3300009551 Bacteria 261080
67 Ga0105238_10307402 3300009551 Bacteria 1570
68 Ga0105249_10582354 3300009553 Unclassified 1172
69 Ga0105249_10757070 3300009553 Bacteria 1034
70 Ga0105249_10903066 3300009553 Bacteria 950
71 Ga0105239_10610284 3300010375 Bacteria 1245
72 Ga0105246_12425728 3300011119 Bacteria 515
73 Ga0157370_10141010 3300013104 Unclassified 2246
74 Ga0157369_10000020 3300013105 Bacteria 241679
75 Ga0157374_10095265 3300013296 Unclassified 2846
76 Ga0157378_10005986 3300013297 Bacteria 10663
77 Ga0157378_10030467 3300013297 Bacteria 4768
78 Ga0163162_11665096 3300013306 Bacteria 728
79 Ga0157375_10173261 3300013308 Bacteria 2306
80 Ga0157375_10380635 3300013308 Bacteria 1578
81 Ga0157375_10401382 3300013308 Bacteria 1537
82 Ga0157375_10549233 3300013308 Bacteria 1317
83 Ga0157375_12750785 3300013308 Bacteria 588
84 Ga0163163_11562753 3300014325 Unclassified 721
85 Ga0157380_10002003 3300014326 Bacteria 13578
86 Ga0157380_10174238 3300014326 Bacteria 1883
87 Ga0157380_12076472 3300014326 Bacteria 631
88 Ga0157380_12949067 3300014326 Bacteria 542
89 Ga0157377_11508729 3300014745 Bacteria 535
90 Ga0157379_11175426 3300014968 Bacteria 737
91 Ga0157379_11483396 3300014968 Unclassified 659
92 Ga0157376_10197465 3300014969 Bacteria 1849
93 Ga0163161_10287628 3300017792 Unclassified 1291
94 Ga0206356_10048422 3300020070 Bacteria 1957
95 Ga0207710_10000458 3300025900 Bacteria 26155
96 Ga0207680_10159342 3300025903 Bacteria 1512
97 Ga0207647_10565075 3300025904 Bacteria 630
98 Ga0207645_10978167 3300025907 Bacteria 573
99 Ga0207705_10167133 3300025909 Bacteria 1655
100 Ga0207671_10005068 3300025914 Bacteria 12301
101 Ga0207693_10052539 3300025915 Bacteria 3197
102 Ga0207693_10107054 3300025915 Bacteria 2193
103 Ga0207693_10734208 3300025915 Bacteria 763
104 Ga0207693_10824648 3300025915 Unclassified 714
105 Ga0207657_10362895 3300025919 Bacteria 1142
106 Ga0207649_10000009 3300025920 Bacteria 295544
107 Ga0207649_10350271 3300025920 Bacteria 1093
108 Ga0207694_10000004 3300025924 Bacteria 967075
109 Ga0207659_10000010 3300025926 Bacteria 286639
110 Ga0207687_10000007 3300025927 Bacteria 604185
111 Ga0207700_10200216 3300025928 Bacteria 1682
112 Ga0207664_10018436 3300025929 Bacteria 5139
113 Ga0207664_10100280 3300025929 Bacteria 2391
114 Ga0207664_10630625 3300025929 Bacteria 963
115 Ga0207664_10733359 3300025929 Bacteria 889
116 Ga0207690_10076663 3300025932 Bacteria 2322
117 Ga0207706_10000012 3300025933 Bacteria 195475
118 Ga0207686_10356998 3300025934 Bacteria 1102
119 Ga0207686_10476060 3300025934 Unclassified 965
120 Ga0207709_10291774 3300025935 Bacteria 1209
121 Ga0207670_10885940 3300025936 Bacteria 747
122 Ga0207669_10229221 3300025937 Bacteria 1369
123 Ga0207669_10294267 3300025937 Bacteria 1231
124 Ga0207704_10166876 3300025938 Bacteria 1574
125 Ga0207691_10000044 3300025940 Bacteria 100027
126 Ga0207711_10000006 3300025941 Bacteria 792692
127 Ga0207661_10000253 3300025944 Bacteria 34627
128 Ga0207661_10148671 3300025944 Bacteria 2023
129 Ga0207712_10382987 3300025961 Unclassified 1178
130 Ga0207668_10882957 3300025972 Bacteria 795
131 Ga0207677_10000200 3300026023 Bacteria 48320
132 Ga0207703_10000023 3300026035 Bacteria 222018
133 Ga0207703_11429498 3300026035 Bacteria 665
134 Ga0207639_10161229 3300026041 Bacteria 1890
135 Ga0207708_10047844 3300026075 Bacteria 3255
136 Ga0207702_10000158 3300026078 Bacteria 79984
137 Ga0207702_10004391 3300026078 Bacteria 12560
138 Ga0207702_12386462 3300026078 Bacteria 516
139 Ga0207648_10738955 3300026089 Bacteria 914
140 Ga0207675_101210725 3300026118 Bacteria 775
141 Ga0207698_10000013 3300026142 Bacteria 255414
142 Ga0207698_10099362 3300026142 Bacteria 2407
143 Ga0268266_10000047 3300028379 Bacteria 310996
144 Ga0268266_10009710 3300028379 Bacteria 8457
145 Ga0268266_10200557 3300028379 Bacteria 1826
146 Ga0268266_11348234 3300028379 Bacteria 689
147 Ga0268265_11247673 3300028380 Bacteria 742
148 Ga0268264_10095164 3300028381 Bacteria 2577
149 Ga0265334_10105748 3300028573 Unclassified 1015
150 Ga0265338_10395708 3300028800 Bacteria 986
151 Ga0373937_0561247 3300036401 Bacteria 1084
152 Ga0436364_0739833 3300037853 Bacteria 981
153 Ga0451798_1035661 3300041458 Unclassified 522
154 Ga0451853_1685780 3300041512 Bacteria 2002
155 Ga0451853_3297983 3300041512 Bacteria 5715
156 Ga0439440_0016114 3300042993 Bacteria 1631
157 Ga0466957_0029121 3300044842 Bacteria 3292
158 Ga0466957_0287140 3300044842 Bacteria 1102
159 Ga0466967_0342547 3300045976 Bacteria 1446
160 Ga0466967_1220413 3300045976 Bacteria 749
161 Ga0495592_0166584 3300046454 Bacteria 1512
162 Ga0495592_0218115 3300046454 Bacteria 1277
163 Ga0495629_0001726 3300046459 Bacteria 17147
164 Ga0495629_0003604 3300046459 Bacteria 11704
165 Ga0495629_0081270 3300046459 Bacteria 2262
166 Ga0495629_0240331 3300046459 Bacteria 1247
167 Ga0495629_0474019 3300046459 Bacteria 846
168 Ga0495641_0000228 3300046461 Bacteria 43671
169 Ga0495641_0043135 3300046461 Bacteria 2087
170 Ga0495651_0051484 3300046462 Bacteria 3174
171 Ga0495653_0137335 3300046463 Bacteria 1723
172 Ga0495653_0817358 3300046463 Bacteria 559
173 Ga0495662_0004365 3300046476 Bacteria 7100
174 Ga0495664_0243037 3300046477 Bacteria 1089
175 Ga0495594_0000029 3300046499 Bacteria 66789
176 Ga0495606_0000072 3300046507 Bacteria 173678
177 Ga0495618_0251286 3300046514 Bacteria 1109
178 Ga0495628_0023428 3300046516 Bacteria 5068
179 Ga0495628_0129509 3300046516 Bacteria 1931
180 Ga0495628_0318506 3300046516 Bacteria 1148
181 Ga0495630_0325744 3300046517 Bacteria 1175
182 Ga0495630_0871328 3300046517 Bacteria 686
183 Ga0495644_0003786 3300046523 Bacteria 5953
184 Ga0495652_0000407 3300046529 Bacteria 50232
185 Ga0495652_0017869 3300046529 Bacteria 6330
186 Ga0495640_0017874 3300046533 Bacteria 5271
187 Ga0495640_0304088 3300046533 Bacteria 990
188 Ga0495586_0000161 3300046535 Bacteria 43544
189 Ga0495587_0025086 3300046536 Bacteria 3646
190 Ga0495598_0056702 3300046537 Bacteria 1196
191 Ga0495645_0019665 3300046543 Bacteria 4864
192 Ga0495645_0126231 3300046543 Bacteria 1798
193 Ga0495622_0000550 3300046557 Bacteria 22511
194 Ga0495633_0055276 3300046558 Unclassified 1866
195 Ga0495667_0088032 3300046559 Unclassified 2013
196 Ga0495634_0005238 3300046642 Bacteria 10023
197 Ga0495634_0009160 3300046642 Bacteria 7312
198 Ga0495634_0077660 3300046642 Bacteria 2177
199 Ga0495588_0000134 3300046674 Bacteria 117581
200 Ga0495599_0017233 3300046678 Bacteria 4490
201 Ga0495599_0502167 3300046678 Bacteria 714
202 Ga0495646_0354418 3300046680 Bacteria 768
203 Ga0495647_0000018 3300046681 Bacteria 81701
204 Ga0495669_0136000 3300046684 Bacteria 1158
205 Ga0495613_0315370 3300046689 Bacteria 1080
206 Ga0495624_0000097 3300046690 Bacteria 58715
207 Ga0495670_0019972 3300046691 Bacteria 3301
208 Ga0495600_0007876 3300046809 Bacteria 6525
209 Ga0495600_0049137 3300046809 Bacteria 2752
210 Ga0495674_0000064 3300047319 Bacteria 71275
211 Ga0495674_0067608 3300047319 Bacteria 3095
212 Ga0495674_0985485 3300047319 Bacteria 647
213 Ga0495672_0012161 3300047320 Bacteria 6023
214 Ga0495672_0041619 3300047320 Bacteria 2777
215 Ga0495676_0002521 3300047321 Bacteria 16308
216 Ga0495680_0087972 3300047322 Unclassified 2335
217 Ga0495679_033543 3300047446 Bacteria 1639
218 Ga0495684_0332784 3300047471 Bacteria 1083
219 Ga0495593_0180483 3300047673 Bacteria 1063
220 Ga0495602_0040615 3300048088 Bacteria 4262
221 Ga0495602_0807325 3300048088 Bacteria 630
222 Ga0496100_0985900 3300048903 Unclassified 663
223 Ga0496101_0549971 3300048904 Bacteria 913
224 Ga0496102_0244723 3300048905 Bacteria 1691
225 Ga0496102_0429586 3300048905 Bacteria 1240
226 Ga0496102_1655545 3300048905 Unclassified 558
227 Ga0496103_0255744 3300048906 Bacteria 1127
228 Ga0496104_0000004 3300048907 Bacteria 641830
229 Ga0496105_0000001 3300048908 Bacteria 1328178
230 Ga0496106_0000151 3300048909 Bacteria 51430
231 Ga0496106_0459370 3300048909 Bacteria 1023
232 Ga0496107_0142710 3300048910 Bacteria 1770
233 Ga0496107_0183754 3300048910 Bacteria 1553
234 Ga0496107_0536654 3300048910 Bacteria 867
235 Ga0496108_0049450 3300048911 Bacteria 3517
236 Ga0496109_0000249 3300048912 Bacteria 51718
237 Ga0496109_0826775 3300048912 Unclassified 864
238 Ga0496109_0940095 3300048912 Bacteria 802
239 Ga0496110_0011255 3300048913 Bacteria 7314
240 Ga0496110_0030348 3300048913 Bacteria 4659
241 Ga0496110_0270238 3300048913 Bacteria 1548
242 Ga0496110_0276481 3300048913 Bacteria 1529
243 Ga0496111_0131752 3300048914 Bacteria 1850
244 Ga0496111_0229400 3300048914 Bacteria 1379
245 Ga0496111_0443323 3300048914 Bacteria 958
246 Ga0496112_0904978 3300048915 Bacteria 804
247 Ga0496113_0091448 3300048916 Bacteria 2345
248 Ga0496114_0620830 3300048917 Bacteria 952
249 Ga0496115_0000226 3300048918 Bacteria 51586
250 Ga0496116_0000735 3300048919 Bacteria 41771
251 Ga0496117_0004253 3300048920 Bacteria 15981
252 Ga0496117_0412246 3300048920 Bacteria 678
253 Ga0496118_0014032 3300048921 Bacteria 7524
254 Ga0496118_0016560 3300048921 Bacteria 6759
255 Ga0496118_0389615 3300048921 Bacteria 728
256 Ga0496119_0005911 3300048922 Bacteria 11538
257 Ga0496119_0008529 3300048922 Bacteria 8987
258 Ga0496119_0027449 3300048922 Bacteria 3911
259 Ga0496119_0276275 3300048922 Unclassified 837
260 Ga0496120_0010399 3300048923 Bacteria 6495
261 Ga0496121_0025396 3300048924 Bacteria 5621
262 Ga0496121_0061202 3300048924 Bacteria 3091
263 Ga0496126_0400811 3300048929 Bacteria 1113
264 Ga0501031_0807419 3300049568 Unclassified 601
265 Ga0501032_0528344 3300049569 Bacteria 753
266 Ga0501034_0333038 3300049571 Bacteria 1449
267 Ga0501036_1676115 3300049572 Unclassified 513
268 Ga0501040_0261083 3300049576 Bacteria 1236
269 Ga0501042_0024473 3300049578 Bacteria 4235
270 Ga0501042_0357908 3300049578 Unclassified 1056
271 Ga0501043_0645511 3300049579 Bacteria 778
272 Ga0501043_0666048 3300049579 Bacteria 763
273 Ga0501047_0006995 3300049581 Bacteria 10593
274 Ga0501047_0045524 3300049581 Bacteria 4243
275 Ga0501047_0286154 3300049581 Bacteria 1492
276 Ga0501047_0440260 3300049581 Bacteria 1133
277 Ga0501048_1277404 3300049582 Unclassified 528
278 Ga0501068_0133547 3300049584 Bacteria 1553
279 Ga0501068_0495805 3300049584 Unclassified 792
280 Ga0501070_0088369 3300049586 Bacteria 2565
281 Ga0501070_1279419 3300049586 Bacteria 560
282 Ga0501073_1289580 3300049589 Unclassified 501
283 Ga0501074_0053997 3300049590 Bacteria 2898
284 Ga0501075_0009392 3300049591 Bacteria 6842
285 Ga0501075_0546991 3300049591 Bacteria 884
286 Ga0501079_0006415 3300049741 Bacteria 8831
287 Ga0501080_0116518 3300049742 Bacteria 2476
288 Ga0501081_0118602 3300049743 Unclassified 1883
289 Ga0501081_0711205 3300049743 Bacteria 754
290 Ga0501083_0015081 3300049744 Bacteria 5409
291 Ga0501083_0086471 3300049744 Bacteria 2073
292 Ga0501044_0186240 3300049823 Bacteria 2040
293 Ga0501044_0399359 3300049823 Bacteria 1287
294 Ga0501045_0252710 3300049824 Unclassified 1312
295 nmdc:mga05p37_1012111_c1 3300050507 Bacteria 881
296 nmdc:mga06r32_1834163_c1 3300050510 Unclassified 542
297 nmdc:mga06r32_28506_c1 3300050510 Bacteria 5226
298 nmdc:mga0a205_6_c1 3300050515 Bacteria 129758
299 Ga0495601_0000855 3300053077 Bacteria 16586
300 Ga0495601_0164884 3300053077 Bacteria 1448
301 Ga0495601_0359137 3300053077 Bacteria 947
302 Ga0495601_0836812 3300053077 Bacteria 583
303 Ga0495612_0000164 3300053078 Bacteria 27579
304 Ga0495612_0061466 3300053078 Bacteria 1556
305 Ga0495612_0121900 3300053078 Unclassified 1122
306 Ga0495612_0219485 3300053078 Bacteria 841
307 Ga0500635_0244012 3300053080 Bacteria 704
308 Ga0495655_0073697 3300053083 Bacteria 960
309 Ga0495595_0259590 3300053084 Bacteria 871
310 Ga0495619_0000157 3300053085 Bacteria 49848
311 Ga0495619_0167470 3300053085 Bacteria 1519
312 Ga0495619_0652155 3300053085 Bacteria 718
313 Ga0500566_0462400 3300053094 Unclassified 553
314 Ga0500595_046238 3300053119 Bacteria 1369
315 Ga0500614_000451 3300053123 Bacteria 10624
316 Ga0500658_0152208 3300053134 Bacteria 1043
317 Ga0530510_1201249 3300061734 Bacteria 581

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300011119 Ga0105246_12425728 Ga0105246_124257282 93
2 3300005843 Ga0068860_100832372 Ga0068860_1008323722 94
3 3300026078 Ga0207702_12386462 Ga0207702_123864621 94
4 3300049581 Ga0501047_0440260 Ga0501047_0440260_634_921 94
5 3300049586 Ga0501070_1279419 Ga0501070_1279419_233_520 94
6 3300049589 Ga0501073_1289580 Ga0501073_1289580_76_363 94
7 3300049741 Ga0501079_0006415 Ga0501079_0006415_5164_5451 94
8 3300049742 Ga0501080_0116518 Ga0501080_0116518_747_1034 94
9 3300049744 Ga0501083_0015081 Ga0501083_0015081_751_1038 94
10 3300049823 Ga0501044_0186240 Ga0501044_0186240_316_603 94
11 3300001977 JGI24746J21847_1000305 JGI24746J21847_10003054 95
12 3300005331 Ga0070670_100054576 Ga0070670_1000545762 95
13 3300005338 Ga0068868_100000450 Ga0068868_1000004508 95
14 3300005339 Ga0070660_100531488 Ga0070660_1005314882 95
15 3300005344 Ga0070661_100177024 Ga0070661_1001770243 95
16 3300005344 Ga0070661_100534251 Ga0070661_1005342512 95
17 3300005345 Ga0070692_10044881 Ga0070692_100448812 95
18 3300005347 Ga0070668_100505597 Ga0070668_1005055972 95
19 3300005354 Ga0070675_100000027 Ga0070675_10000002733 95
20 3300005354 Ga0070675_100308753 Ga0070675_1003087532 95
21 3300005356 Ga0070674_100046318 Ga0070674_1000463183 95
22 3300005356 Ga0070674_100287048 Ga0070674_1002870483 95
23 3300005365 Ga0070688_100001250 Ga0070688_10000125011 95
24 3300005366 Ga0070659_101923015 Ga0070659_1019230151 95
25 3300005367 Ga0070667_100413472 Ga0070667_1004134722 95
26 3300005435 Ga0070714_100089298 Ga0070714_1000892983 95
27 3300005435 Ga0070714_100090319 Ga0070714_1000903194 95
28 3300005436 Ga0070713_101366531 Ga0070713_1013665312 95
29 3300005438 Ga0070701_10963698 Ga0070701_109636981 95
30 3300005441 Ga0070700_100229234 Ga0070700_1002292342 95
31 3300005455 Ga0070663_102112682 Ga0070663_1021126822 95
32 3300005457 Ga0070662_100000004 Ga0070662_100000004151 95
33 3300005459 Ga0068867_100481143 Ga0068867_1004811432 95
34 3300005466 Ga0070685_10001410 Ga0070685_1000141011 95
35 3300005466 Ga0070685_10878395 Ga0070685_108783951 95
36 3300005535 Ga0070684_100024292 Ga0070684_1000242924 95
37 3300005535 Ga0070684_100156085 Ga0070684_1001560853 95
38 3300005543 Ga0070672_100000293 Ga0070672_10000029324 95
39 3300005543 Ga0070672_100521094 Ga0070672_1005210942 95
40 3300005547 Ga0070693_100004573 Ga0070693_1000045736 95
41 3300005548 Ga0070665_100000106 Ga0070665_10000010624 95
42 3300005548 Ga0070665_100039235 Ga0070665_1000392354 95
43 3300005548 Ga0070665_101042695 Ga0070665_1010426952 95
44 3300005548 Ga0070665_101114334 Ga0070665_1011143341 95
45 3300005548 Ga0070665_101678776 Ga0070665_1016787762 95
46 3300005549 Ga0070704_100740429 Ga0070704_1007404292 95
47 3300005549 Ga0070704_102043247 Ga0070704_1020432471 95
48 3300005577 Ga0068857_101572342 Ga0068857_1015723422 95
49 3300005614 Ga0068856_100008468 Ga0068856_1000084683 95
50 3300005616 Ga0068852_100000006 Ga0068852_100000006150 95
51 3300005616 Ga0068852_100579402 Ga0068852_1005794022 95
52 3300005719 Ga0068861_100441558 Ga0068861_1004415582 95
53 3300005719 Ga0068861_102309234 Ga0068861_1023092342 95
54 3300005842 Ga0068858_100000009 Ga0068858_100000009179 95
55 3300005843 Ga0068860_100141601 Ga0068860_1001416012 95
56 3300005844 Ga0068862_101501987 Ga0068862_1015019871 95
57 3300005937 Ga0081455_10021219 Ga0081455_100212193 95
58 3300005981 Ga0081538_10000467 Ga0081538_1000046721 95
59 3300006175 Ga0070712_100845309 Ga0070712_1008453092 95
60 3300006847 Ga0075431_100081736 Ga0075431_1000817363 95
61 3300006881 Ga0068865_100125588 Ga0068865_1001255883 95
62 3300009098 Ga0105245_10000254 Ga0105245_100002544 95
63 3300009098 Ga0105245_10735951 Ga0105245_107359512 95
64 3300009098 Ga0105245_11923573 Ga0105245_119235732 95
65 3300009101 Ga0105247_10000316 Ga0105247_1000031637 95
66 3300009101 Ga0105247_11493860 Ga0105247_114938601 95
67 3300009148 Ga0105243_10040421 Ga0105243_100404217 95
68 3300009148 Ga0105243_10162820 Ga0105243_101628202 95
69 3300009174 Ga0105241_10324889 Ga0105241_103248891 95
70 3300009176 Ga0105242_10000454 Ga0105242_1000045416 95
71 3300009176 Ga0105242_10118343 Ga0105242_101183432 95
72 3300009176 Ga0105242_10154085 Ga0105242_101540852 95
73 3300009177 Ga0105248_10000008 Ga0105248_10000008310 95
74 3300009177 Ga0105248_11736334 Ga0105248_117363342 95
75 3300009551 Ga0105238_10000011 Ga0105238_10000011209 95
76 3300009551 Ga0105238_10307402 Ga0105238_103074022 95
77 3300009553 Ga0105249_10582354 Ga0105249_105823542 95
78 3300009553 Ga0105249_10757070 Ga0105249_107570702 95
79 3300009553 Ga0105249_10903066 Ga0105249_109030661 95
80 3300010375 Ga0105239_10610284 Ga0105239_106102843 95
81 3300013104 Ga0157370_10141010 Ga0157370_101410104 95
82 3300013105 Ga0157369_10000020 Ga0157369_10000020191 95
83 3300013296 Ga0157374_10095265 Ga0157374_100952653 95
84 3300013297 Ga0157378_10005986 Ga0157378_1000598614 95
85 3300013297 Ga0157378_10030467 Ga0157378_100304674 95
86 3300013306 Ga0163162_11665096 Ga0163162_116650962 95
87 3300013308 Ga0157375_10173261 Ga0157375_101732613 95
88 3300013308 Ga0157375_10380635 Ga0157375_103806352 95
89 3300013308 Ga0157375_10401382 Ga0157375_104013823 95
90 3300013308 Ga0157375_10549233 Ga0157375_105492332 95
91 3300013308 Ga0157375_12750785 Ga0157375_127507852 95
92 3300014325 Ga0163163_11562753 Ga0163163_115627532 95
93 3300014326 Ga0157380_10002003 Ga0157380_1000200314 95
94 3300014326 Ga0157380_10174238 Ga0157380_101742382 95
95 3300014326 Ga0157380_12076472 Ga0157380_120764722 95
96 3300014326 Ga0157380_12949067 Ga0157380_129490671 95
97 3300014745 Ga0157377_11508729 Ga0157377_115087291 95
98 3300014968 Ga0157379_11175426 Ga0157379_111754262 95
99 3300014968 Ga0157379_11483396 Ga0157379_114833961 95
100 3300014969 Ga0157376_10197465 Ga0157376_101974653 95
101 3300017792 Ga0163161_10287628 Ga0163161_102876282 95
102 3300020070 Ga0206356_10048422 Ga0206356_100484222 95
103 3300025900 Ga0207710_10000458 Ga0207710_1000045818 95
104 3300025903 Ga0207680_10159342 Ga0207680_101593423 95
105 3300025904 Ga0207647_10565075 Ga0207647_105650752 95
106 3300025907 Ga0207645_10978167 Ga0207645_109781672 95
107 3300025909 Ga0207705_10167133 Ga0207705_101671332 95
108 3300025914 Ga0207671_10005068 Ga0207671_100050682 95
109 3300025915 Ga0207693_10052539 Ga0207693_100525393 95
110 3300025915 Ga0207693_10107054 Ga0207693_101070542 95
111 3300025915 Ga0207693_10734208 Ga0207693_107342082 95
112 3300025915 Ga0207693_10824648 Ga0207693_108246482 95
113 3300025919 Ga0207657_10362895 Ga0207657_103628953 95
114 3300025920 Ga0207649_10000009 Ga0207649_10000009240 95
115 3300025920 Ga0207649_10350271 Ga0207649_103502712 95
116 3300025924 Ga0207694_10000004 Ga0207694_10000004413 95
117 3300025926 Ga0207659_10000010 Ga0207659_1000001066 95
118 3300025927 Ga0207687_10000007 Ga0207687_10000007430 95
119 3300025928 Ga0207700_10200216 Ga0207700_102002162 95
120 3300025929 Ga0207664_10018436 Ga0207664_100184366 95
121 3300025929 Ga0207664_10100280 Ga0207664_101002803 95
122 3300025929 Ga0207664_10630625 Ga0207664_106306253 95
123 3300025929 Ga0207664_10733359 Ga0207664_107333592 95
124 3300025932 Ga0207690_10076663 Ga0207690_100766633 95
125 3300025933 Ga0207706_10000012 Ga0207706_1000001267 95
126 3300025934 Ga0207686_10356998 Ga0207686_103569981 95
127 3300025934 Ga0207686_10476060 Ga0207686_104760602 95
128 3300025935 Ga0207709_10291774 Ga0207709_102917742 95
129 3300025936 Ga0207670_10885940 Ga0207670_108859402 95
130 3300025937 Ga0207669_10229221 Ga0207669_102292213 95
131 3300025937 Ga0207669_10294267 Ga0207669_102942672 95
132 3300025938 Ga0207704_10166876 Ga0207704_101668762 95
133 3300025940 Ga0207691_10000044 Ga0207691_100000443 95
134 3300025941 Ga0207711_10000006 Ga0207711_10000006704 95
135 3300025944 Ga0207661_10000253 Ga0207661_1000025340 95
136 3300025944 Ga0207661_10148671 Ga0207661_101486712 95
137 3300025961 Ga0207712_10382987 Ga0207712_103829872 95
138 3300025972 Ga0207668_10882957 Ga0207668_108829572 95
139 3300026023 Ga0207677_10000200 Ga0207677_1000020026 95
140 3300026035 Ga0207703_10000023 Ga0207703_1000002386 95
141 3300026035 Ga0207703_11429498 Ga0207703_114294982 95
142 3300026041 Ga0207639_10161229 Ga0207639_101612293 95
143 3300026075 Ga0207708_10047844 Ga0207708_100478444 95
144 3300026078 Ga0207702_10000158 Ga0207702_1000015879 95
145 3300026078 Ga0207702_10004391 Ga0207702_1000439112 95
146 3300026089 Ga0207648_10738955 Ga0207648_107389552 95
147 3300026118 Ga0207675_101210725 Ga0207675_1012107252 95
148 3300026142 Ga0207698_10000013 Ga0207698_1000001339 95
149 3300026142 Ga0207698_10099362 Ga0207698_100993622 95
150 3300028379 Ga0268266_10000047 Ga0268266_10000047176 95
151 3300028379 Ga0268266_10009710 Ga0268266_100097105 95
152 3300028379 Ga0268266_10200557 Ga0268266_102005572 95
153 3300028379 Ga0268266_11348234 Ga0268266_113482342 95
154 3300028380 Ga0268265_11247673 Ga0268265_112476732 95
155 3300028381 Ga0268264_10095164 Ga0268264_100951642 95
156 3300028573 Ga0265334_10105748 Ga0265334_101057481 95
157 3300028800 Ga0265338_10395708 Ga0265338_103957082 95
158 3300036401 Ga0373937_0561247 Ga0373937_0561247_177_467 95
159 3300037853 Ga0436364_0739833 Ga0436364_0739833_129_416 95
160 3300041458 Ga0451798_1035661 Ga0451798_1035661_175_465 95
161 3300041512 Ga0451853_1685780 Ga0451853_1685780_1160_1450 95
162 3300041512 Ga0451853_3297983 Ga0451853_3297983_3910_4200 95
163 3300042993 Ga0439440_0016114 Ga0439440_0016114_871_1194 95
164 3300044842 Ga0466957_0029121 Ga0466957_0029121_1115_1405 95
165 3300044842 Ga0466957_0287140 Ga0466957_0287140_242_532 95
166 3300045976 Ga0466967_0342547 Ga0466967_0342547_1003_1293 95
167 3300045976 Ga0466967_1220413 Ga0466967_1220413_446_733 95
168 3300046454 Ga0495592_0166584 Ga0495592_0166584_975_1265 95
169 3300046454 Ga0495592_0218115 Ga0495592_0218115_31_321 95
170 3300046459 Ga0495629_0001726 Ga0495629_0001726_12300_12590 95
171 3300046459 Ga0495629_0003604 Ga0495629_0003604_10257_10556 95
172 3300046459 Ga0495629_0081270 Ga0495629_0081270_1239_1529 95
173 3300046459 Ga0495629_0240331 Ga0495629_0240331_79_369 95
174 3300046459 Ga0495629_0474019 Ga0495629_0474019_311_601 95
175 3300046461 Ga0495641_0000228 Ga0495641_0000228_7625_7915 95
176 3300046461 Ga0495641_0043135 Ga0495641_0043135_523_813 95
177 3300046462 Ga0495651_0051484 Ga0495651_0051484_1475_1765 95
178 3300046463 Ga0495653_0137335 Ga0495653_0137335_187_477 95
179 3300046463 Ga0495653_0817358 Ga0495653_0817358_220_510 95
180 3300046476 Ga0495662_0004365 Ga0495662_0004365_1956_2246 95
181 3300046477 Ga0495664_0243037 Ga0495664_0243037_569_859 95
182 3300046499 Ga0495594_0000029 Ga0495594_0000029_44630_44920 95
183 3300046507 Ga0495606_0000072 Ga0495606_0000072_10713_11003 95
184 3300046514 Ga0495618_0251286 Ga0495618_0251286_304_594 95
185 3300046516 Ga0495628_0023428 Ga0495628_0023428_3291_3581 95
186 3300046516 Ga0495628_0129509 Ga0495628_0129509_889_1179 95
187 3300046516 Ga0495628_0318506 Ga0495628_0318506_818_1108 95
188 3300046517 Ga0495630_0325744 Ga0495630_0325744_419_709 95
189 3300046517 Ga0495630_0871328 Ga0495630_0871328_306_596 95
190 3300046523 Ga0495644_0003786 Ga0495644_0003786_5251_5550 95
191 3300046529 Ga0495652_0000407 Ga0495652_0000407_31441_31731 95
192 3300046529 Ga0495652_0017869 Ga0495652_0017869_2339_2629 95
193 3300046533 Ga0495640_0017874 Ga0495640_0017874_3011_3304 95
194 3300046533 Ga0495640_0304088 Ga0495640_0304088_81_371 95
195 3300046535 Ga0495586_0000161 Ga0495586_0000161_3357_3647 95
196 3300046536 Ga0495587_0025086 Ga0495587_0025086_76_366 95
197 3300046537 Ga0495598_0056702 Ga0495598_0056702_513_812 95
198 3300046543 Ga0495645_0019665 Ga0495645_0019665_1345_1635 95
199 3300046543 Ga0495645_0126231 Ga0495645_0126231_1486_1785 95
200 3300046557 Ga0495622_0000550 Ga0495622_0000550_8417_8707 95
201 3300046558 Ga0495633_0055276 Ga0495633_0055276_1167_1457 95
202 3300046559 Ga0495667_0088032 Ga0495667_0088032_452_748 95
203 3300046642 Ga0495634_0005238 Ga0495634_0005238_3286_3576 95
204 3300046642 Ga0495634_0009160 Ga0495634_0009160_2724_3014 95
205 3300046642 Ga0495634_0077660 Ga0495634_0077660_1021_1311 95
206 3300046674 Ga0495588_0000134 Ga0495588_0000134_13416_13706 95
207 3300046678 Ga0495599_0017233 Ga0495599_0017233_1543_1833 95
208 3300046678 Ga0495599_0502167 Ga0495599_0502167_92_391 95
209 3300046680 Ga0495646_0354418 Ga0495646_0354418_190_480 95
210 3300046681 Ga0495647_0000018 Ga0495647_0000018_69788_70078 95
211 3300046684 Ga0495669_0136000 Ga0495669_0136000_100_387 95
212 3300046689 Ga0495613_0315370 Ga0495613_0315370_233_523 95
213 3300046690 Ga0495624_0000097 Ga0495624_0000097_52365_52655 95
214 3300046691 Ga0495670_0019972 Ga0495670_0019972_447_737 95
215 3300046809 Ga0495600_0007876 Ga0495600_0007876_233_523 95
216 3300046809 Ga0495600_0049137 Ga0495600_0049137_893_1183 95
217 3300047319 Ga0495674_0000064 Ga0495674_0000064_33989_34282 95
218 3300047319 Ga0495674_0067608 Ga0495674_0067608_1501_1791 95
219 3300047319 Ga0495674_0985485 Ga0495674_0985485_292_591 95
220 3300047320 Ga0495672_0012161 Ga0495672_0012161_4545_4832 95
221 3300047320 Ga0495672_0041619 Ga0495672_0041619_1180_1470 95
222 3300047321 Ga0495676_0002521 Ga0495676_0002521_8686_8976 95
223 3300047322 Ga0495680_0087972 Ga0495680_0087972_1662_1952 95
224 3300047446 Ga0495679_033543 Ga0495679_033543_1320_1619 95
225 3300047471 Ga0495684_0332784 Ga0495684_0332784_126_416 95
226 3300047673 Ga0495593_0180483 Ga0495593_0180483_478_777 95
227 3300048088 Ga0495602_0040615 Ga0495602_0040615_3304_3594 95
228 3300048088 Ga0495602_0807325 Ga0495602_0807325_103_393 95
229 3300048903 Ga0496100_0985900 Ga0496100_0985900_136_429 95
230 3300048904 Ga0496101_0549971 Ga0496101_0549971_605_895 95
231 3300048905 Ga0496102_0244723 Ga0496102_0244723_921_1211 95
232 3300048905 Ga0496102_0429586 Ga0496102_0429586_273_563 95
233 3300048905 Ga0496102_1655545 Ga0496102_1655545_40_330 95
234 3300048906 Ga0496103_0255744 Ga0496103_0255744_269_559 95
235 3300048907 Ga0496104_0000004 Ga0496104_0000004_346747_347037 95
236 3300048908 Ga0496105_0000001 Ga0496105_0000001_294794_295084 95
237 3300048909 Ga0496106_0000151 Ga0496106_0000151_4410_4700 95
238 3300048909 Ga0496106_0459370 Ga0496106_0459370_710_997 95
239 3300048910 Ga0496107_0142710 Ga0496107_0142710_1341_1631 95
240 3300048910 Ga0496107_0183754 Ga0496107_0183754_420_710 95
241 3300048910 Ga0496107_0536654 Ga0496107_0536654_474_767 95
242 3300048911 Ga0496108_0049450 Ga0496108_0049450_2209_2499 95
243 3300048912 Ga0496109_0000249 Ga0496109_0000249_45723_46013 95
244 3300048912 Ga0496109_0826775 Ga0496109_0826775_490_780 95
245 3300048912 Ga0496109_0940095 Ga0496109_0940095_80_367 95
246 3300048913 Ga0496110_0011255 Ga0496110_0011255_1853_2143 95
247 3300048913 Ga0496110_0030348 Ga0496110_0030348_3263_3553 95
248 3300048913 Ga0496110_0270238 Ga0496110_0270238_472_762 95
249 3300048913 Ga0496110_0276481 Ga0496110_0276481_1017_1307 95
250 3300048914 Ga0496111_0131752 Ga0496111_0131752_40_330 95
251 3300048914 Ga0496111_0229400 Ga0496111_0229400_715_1005 95
252 3300048914 Ga0496111_0443323 Ga0496111_0443323_236_523 95
253 3300048915 Ga0496112_0904978 Ga0496112_0904978_77_364 95
254 3300048916 Ga0496113_0091448 Ga0496113_0091448_806_1093 95
255 3300048917 Ga0496114_0620830 Ga0496114_0620830_296_586 95
256 3300048918 Ga0496115_0000226 Ga0496115_0000226_5308_5631 95
257 3300048919 Ga0496116_0000735 Ga0496116_0000735_4745_5035 95
258 3300048920 Ga0496117_0004253 Ga0496117_0004253_2005_2295 95
259 3300048920 Ga0496117_0412246 Ga0496117_0412246_52_342 95
260 3300048921 Ga0496118_0014032 Ga0496118_0014032_4503_4796 95
261 3300048921 Ga0496118_0016560 Ga0496118_0016560_4692_4982 95
262 3300048921 Ga0496118_0389615 Ga0496118_0389615_285_578 95
263 3300048922 Ga0496119_0005911 Ga0496119_0005911_4255_4545 95
264 3300048922 Ga0496119_0008529 Ga0496119_0008529_4766_5056 95
265 3300048922 Ga0496119_0027449 Ga0496119_0027449_1447_1737 95
266 3300048922 Ga0496119_0276275 Ga0496119_0276275_226_519 95
267 3300048923 Ga0496120_0010399 Ga0496120_0010399_5034_5324 95
268 3300048924 Ga0496121_0025396 Ga0496121_0025396_2186_2476 95
269 3300048924 Ga0496121_0061202 Ga0496121_0061202_1592_1882 95
270 3300048929 Ga0496126_0400811 Ga0496126_0400811_86_376 95
271 3300049568 Ga0501031_0807419 Ga0501031_0807419_78_377 95
272 3300049569 Ga0501032_0528344 Ga0501032_0528344_266_556 95
273 3300049571 Ga0501034_0333038 Ga0501034_0333038_1000_1290 95
274 3300049572 Ga0501036_1676115 Ga0501036_1676115_214_501 95
275 3300049576 Ga0501040_0261083 Ga0501040_0261083_401_688 95
276 3300049578 Ga0501042_0024473 Ga0501042_0024473_136_426 95
277 3300049578 Ga0501042_0357908 Ga0501042_0357908_337_624 95
278 3300049579 Ga0501043_0645511 Ga0501043_0645511_216_506 95
279 3300049579 Ga0501043_0666048 Ga0501043_0666048_228_518 95
280 3300049581 Ga0501047_0006995 Ga0501047_0006995_7826_8116 95
281 3300049581 Ga0501047_0045524 Ga0501047_0045524_678_968 95
282 3300049581 Ga0501047_0286154 Ga0501047_0286154_504_794 95
283 3300049582 Ga0501048_1277404 Ga0501048_1277404_118_408 95
284 3300049584 Ga0501068_0133547 Ga0501068_0133547_676_966 95
285 3300049584 Ga0501068_0495805 Ga0501068_0495805_295_585 95
286 3300049586 Ga0501070_0088369 Ga0501070_0088369_1484_1774 95
287 3300049590 Ga0501074_0053997 Ga0501074_0053997_442_732 95
288 3300049591 Ga0501075_0009392 Ga0501075_0009392_538_828 95
289 3300049591 Ga0501075_0546991 Ga0501075_0546991_14_304 95
290 3300049743 Ga0501081_0118602 Ga0501081_0118602_946_1236 95
291 3300049743 Ga0501081_0711205 Ga0501081_0711205_199_489 95
292 3300049744 Ga0501083_0086471 Ga0501083_0086471_698_988 95
293 3300049823 Ga0501044_0399359 Ga0501044_0399359_637_927 95
294 3300049824 Ga0501045_0252710 Ga0501045_0252710_516_806 95
295 3300050507 nmdc:mga05p37_1012111_c1 nmdc:mga05p37_1012111_c1_518_805 95
296 3300050510 nmdc:mga06r32_1834163_c1 nmdc:mga06r32_1834163_c1_210_500 95
297 3300050510 nmdc:mga06r32_28506_c1 nmdc:mga06r32_28506_c1_3502_3792 95
298 3300050515 nmdc:mga0a205_6_c1 nmdc:mga0a205_6_c1_123769_124059 95
299 3300053077 Ga0495601_0000855 Ga0495601_0000855_6104_6394 95
300 3300053077 Ga0495601_0164884 Ga0495601_0164884_1107_1397 95
301 3300053077 Ga0495601_0359137 Ga0495601_0359137_59_349 95
302 3300053077 Ga0495601_0836812 Ga0495601_0836812_283_573 95
303 3300053078 Ga0495612_0000164 Ga0495612_0000164_12268_12558 95
304 3300053078 Ga0495612_0061466 Ga0495612_0061466_1022_1309 95
305 3300053078 Ga0495612_0121900 Ga0495612_0121900_65_355 95
306 3300053078 Ga0495612_0219485 Ga0495612_0219485_531_821 95
307 3300053080 Ga0500635_0244012 Ga0500635_0244012_139_429 95
308 3300053083 Ga0495655_0073697 Ga0495655_0073697_369_659 95
309 3300053084 Ga0495595_0259590 Ga0495595_0259590_190_480 95
310 3300053085 Ga0495619_0000157 Ga0495619_0000157_41407_41697 95
311 3300053085 Ga0495619_0167470 Ga0495619_0167470_1095_1385 95
312 3300053085 Ga0495619_0652155 Ga0495619_0652155_168_458 95
313 3300053094 Ga0500566_0462400 Ga0500566_0462400_137_427 95
314 3300053119 Ga0500595_046238 Ga0500595_046238_239_529 95
315 3300053123 Ga0500614_000451 Ga0500614_000451_2273_2563 95
316 3300053134 Ga0500658_0152208 Ga0500658_0152208_539_829 95
317 3300061734 Ga0530510_1201249 Ga0530510_1201249_10_297 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02617

ClpS

ATP-dependent Clp protease adaptor protein ClpS

40

115

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d34-assembly1.cif.gz_B atclps1-peptide complex 0.9427 17 94
4o2x-assembly2.cif.gz_B structure of a malarial protein 0.9403 20 95
4o2x-assembly1.cif.gz_A structure of a malarial protein 0.9162 20 95
7d34-assembly1.cif.gz_B atclps1-peptide complex 0.9088 17 94
3dnj-assembly2.cif.gz_A the structure of the caulobacter crescentus clps protease adaptor protein in complex with a n-end rule peptide 0.8883 21 95
ID Description Score Start End Superfamily
af_A0A0R0IJ84_76_154_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9636 20 93 3.30.1390.10
af_Q8IEB2_84_184_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9491 18 94 3.30.1390.10
af_A0A0R0IJ84_76_154_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.8818 20 93 3.30.1390.10
3o1fA00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.8655 19 95 3.30.1390.10
af_P0A8Q6_1_106_3.30.1390.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.8361 14 95 3.30.1390.10
ID Description Score Start End GO Terms
AF-A0A2W4VXJ9-F1-model_v4 Clp protease ClpS 0.9748 23 95 GO:0006508
GO:0008233
GO:0030163
AF-A0A7S1BRN6-F1-model_v4 Adaptor protein ClpS core domain-containing protein 0.9652 21 93 GO:0006508
GO:0030163
AF-U6MKK3-F1-model_v4 ATP-dependent Clp protease adaptor domain-containing protein, putative 0.9626 20 94 GO:0006508
GO:0008233
GO:0030163
AF-A0A0F7U7B7-F1-model_v4 ATP-dependent Clp protease adaptor domain-containing protein, putative 0.9611 19 95 GO:0006508
GO:0008233
GO:0030163
AF-A0A7S1KE53-F1-model_v4 Adaptor protein ClpS core domain-containing protein 0.9599 20 94 GO:0006508
GO:0030163

Feature Viewer

pLDDT pTM Quality
80.6 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map