F403962

General Info

Members Datasets Scaffolds Average Seq Length
316 203 632 189

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2990088156|2990089250
Length 216
Sequence DGSHSGVPHRRSPACRSCREPARGRLPAKVWLLQPGWYPSEVDSHLTLRVDGEEWSLTVDTRTTLLDALRDRLSITSPKKGCDHGQCGSCTVLIDGRRRLSCLTFAVAHDEAEITTAEGLATGESELHPVQQAFLDHDGFQCGYCTPGQICSAVGMLAEAEAGHPSVVTPTGNGSGESGRPAVLDDDEIRERMSGNLCRCGAYVNIVTAIRAVARR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
6 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
8 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
9 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
10 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
11 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
12 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
13 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
14 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
15 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
16 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
17 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
18 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
19 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
20 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
21 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
22 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
23 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
24 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
25 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
26 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
27 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
28 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
29 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
30 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
31 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
32 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
33 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
34 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
35 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
36 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
37 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
38 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
39 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
40 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
41 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
42 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
43 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
44 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
45 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
46 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
47 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
48 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
49 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
50 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
51 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
52 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
53 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
54 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
55 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
56 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
57 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
58 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
59 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
60 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
61 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
62 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
63 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
64 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
65 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
66 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
67 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
68 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
69 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
70 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
71 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
72 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
73 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
74 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
75 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
76 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
77 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
78 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
79 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
80 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
81 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
82 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
83 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
84 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
85 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
86 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
87 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
88 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
89 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
90 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
91 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
94 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
95 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
96 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
97 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
100 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
101 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
109 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
110 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
111 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
112 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
113 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
114 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
139 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
142 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
144 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
145 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
146 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
147 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
148 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
149 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
150 2643221578 Streptomyces sp. Root63 Isolate Unclassified
151 2643221647 Streptomyces sp. Root369 Isolate Unclassified
152 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
153 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
154 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
155 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
156 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
157 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
158 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
159 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
160 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
161 2808606448 Streptomyces sp. 193411 Isolate Unclassified
162 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
163 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
164 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
165 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
166 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
167 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
168 2862574272 Streptomyces sp. AcE210 Isolate Nodule
169 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
170 2867369537 Streptomyces sp. Z26 Isolate Unclassified
171 2867428634 Streptomyces sp. RP5T Isolate Unclassified
172 2867475112 Streptomyces sp. TM32 Isolate Unclassified
173 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
174 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
175 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
176 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
177 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
178 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
179 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
180 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
181 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
182 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
183 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
184 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
185 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
186 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
187 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
188 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
189 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
190 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
191 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
192 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
193 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
194 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
195 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
196 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
197 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
198 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
199 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
200 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
201 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
202 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
203 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.8
Metatranscriptomes 0.32
Isolates 20.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.11
Nodule 0.95
Rhizoplane 0.63
Rhizosphere 80.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10088687 3300001979 Bacteria 800
2 rootH1_10019582 3300003316 Bacteria 4023
3 rootH2_10013574 3300003320 Bacteria 28972
4 JGI25160J50197_1002334 3300003354 Bacteria 8880
5 JGI25160J50197_1022439 3300003354 Bacteria 1850
6 JGI25160J50197_1028730 3300003354 Bacteria 1487
7 Ga0068853_100013868 3300005539 Bacteria 6587
8 Ga0081455_10115460 3300005937 Bacteria 2125
9 Ga0075365_10522594 3300006038 Bacteria 839
10 Ga0075363_100061117 3300006048 Bacteria 2029
11 Ga0207426_1000760 3300025302 Bacteria 35891
12 Ga0207426_1002375 3300025302 Bacteria 12181
13 Ga0207426_1003430 3300025302 Bacteria 8631
14 Ga0207426_1014334 3300025302 Bacteria 2905
15 Ga0207426_1056370 3300025302 Bacteria 1147
16 Ga0207639_10264487 3300026041 Bacteria 1506
17 Ga0307515_10152261 3300028794 Bacteria 2410
18 Ga0307511_10000176 3300030521 Bacteria 62985
19 Ga0307511_10110970 3300030521 Bacteria 1745
20 Ga0307512_10003641 3300030522 Bacteria 17613
21 Ga0307512_10041953 3300030522 Bacteria 3796
22 Ga0307513_10090587 3300031456 Bacteria 3118
23 Ga0307508_10010034 3300031616 Bacteria 8676
24 Ga0307508_10093327 3300031616 Bacteria 2599
25 Ga0307514_10005770 3300031649 Bacteria 10935
26 Ga0307514_10035284 3300031649 Bacteria 3980
27 Ga0307516_10016782 3300031730 Bacteria 7646
28 Ga0307516_10030239 3300031730 Bacteria 5468
29 Ga0307413_10161403 3300031824 Bacteria 1575
30 Ga0307416_101083406 3300032002 Bacteria 905
31 Ga0307507_10052772 3300033179 Bacteria 3892
32 Ga0307510_10008811 3300033180 Bacteria 12023
33 Ga0307510_10239941 3300033180 Bacteria 1308
34 Ga0395899_0360154 3300037312 Bacteria 971
35 Ga0395900_0164187 3300037418 Bacteria 2264
36 Ga0395898_0028776 3300037466 Bacteria 5569
37 Ga0395898_0041909 3300037466 Bacteria 4519
38 Ga0395905_0949499 3300037471 Bacteria 763
39 Ga0439436_0000664 3300041404 Bacteria 9190
40 Ga0451800_0390081 3300041459 Bacteria 1439
41 Ga0451855_1254610 3300041511 Bacteria 960
42 Ga0451853_1232334 3300041512 Bacteria 2395
43 Ga0439450_106479 3300042008 Bacteria 715
44 Ga0439457_000791 3300042014 Bacteria 9431
45 Ga0439457_070701 3300042014 Bacteria 795
46 Ga0450920_038059 3300042122 Bacteria 956
47 Ga0450894_001934 3300042131 Bacteria 2862
48 Ga0450898_000255 3300042134 Bacteria 5864
49 Ga0450903_000099 3300042138 Bacteria 18213
50 Ga0439458_0000593 3300042157 Bacteria 9326
51 Ga0439458_0059598 3300042157 Bacteria 951
52 Ga0466969_0015971 3300044656 Bacteria 3935
53 Ga0466969_0329348 3300044656 Bacteria 691
54 Ga0466972_0000834 3300044658 Bacteria 14775
55 Ga0466972_0046595 3300044658 Bacteria 2098
56 Ga0466972_0153431 3300044658 Bacteria 1082
57 Ga0466965_0008953 3300044683 Bacteria 4640
58 Ga0466966_0008084 3300044684 Bacteria 6972
59 Ga0466966_0491801 3300044684 Bacteria 738
60 Ga0466961_0005484 3300044693 Bacteria 8001
61 Ga0466961_0048918 3300044693 Bacteria 2703
62 Ga0466961_0091508 3300044693 Bacteria 1920
63 Ga0466961_0339371 3300044693 Bacteria 915
64 Ga0466963_0010829 3300044694 Bacteria 5536
65 Ga0466971_0000798 3300044719 Bacteria 12732
66 Ga0466971_0305454 3300044719 Bacteria 765
67 Ga0466968_0126741 3300044735 Bacteria 1159
68 Ga0466970_0000152 3300044765 Bacteria 32457
69 Ga0466970_0001063 3300044765 Bacteria 13291
70 Ga0466970_0104416 3300044765 Bacteria 1545
71 Ga0466970_0298379 3300044765 Bacteria 908
72 Ga0466957_0001037 3300044842 Bacteria 14339
73 Ga0466957_0066383 3300044842 Bacteria 2224
74 Ga0466960_0021307 3300044901 Bacteria 2883
75 Ga0466959_0014069 3300045049 Bacteria 5809
76 Ga0466959_0175171 3300045049 Bacteria 1503
77 Ga0466959_0582488 3300045049 Bacteria 753
78 Ga0466967_0000293 3300045976 Bacteria 22336
79 Ga0466967_0031007 3300045976 Bacteria 4495
80 Ga0466967_0652477 3300045976 Bacteria 1041
81 Ga0495627_147113 3300046453 Bacteria 658
82 Ga0495592_0190936 3300046454 Bacteria 1388
83 Ga0495603_0090321 3300046455 Bacteria 1791
84 Ga0495603_0189997 3300046455 Bacteria 1187
85 Ga0495629_0033569 3300046459 Bacteria 3629
86 Ga0495638_0097865 3300046460 Bacteria 1759
87 Ga0495651_0003798 3300046462 Bacteria 11550
88 Ga0495651_0066958 3300046462 Bacteria 2740
89 Ga0495582_0017426 3300046473 Bacteria 3930
90 Ga0495605_0020357 3300046474 Bacteria 3526
91 Ga0495662_0005765 3300046476 Bacteria 6197
92 Ga0495662_0058278 3300046476 Bacteria 1865
93 Ga0495664_0004978 3300046477 Bacteria 7273
94 Ga0495664_0028546 3300046477 Bacteria 3258
95 Ga0495585_0029423 3300046492 Bacteria 3127
96 Ga0495594_0066629 3300046499 Bacteria 1998
97 Ga0495596_0144469 3300046500 Bacteria 924
98 Ga0495607_0069548 3300046501 Bacteria 1970
99 Ga0495607_0075643 3300046501 Bacteria 1865
100 Ga0495583_0006681 3300046506 Bacteria 7476
101 Ga0495606_0009690 3300046507 Bacteria 8106
102 Ga0495610_0092786 3300046512 Bacteria 1366
103 Ga0495616_0005639 3300046513 Bacteria 7663
104 Ga0495616_0114492 3300046513 Bacteria 1250
105 Ga0495620_0018507 3300046515 Bacteria 3448
106 Ga0495620_0019605 3300046515 Bacteria 3321
107 Ga0495628_0108831 3300046516 Bacteria 2133
108 Ga0495630_0023476 3300046517 Bacteria 4560
109 Ga0495631_0032370 3300046518 Bacteria 2359
110 Ga0495631_0064482 3300046518 Bacteria 1586
111 Ga0495643_0004235 3300046522 Bacteria 10153
112 Ga0495666_0055024 3300046526 Bacteria 1907
113 Ga0495666_0162575 3300046526 Bacteria 1035
114 Ga0495642_0112326 3300046528 Bacteria 1166
115 Ga0495652_0015816 3300046529 Bacteria 6755
116 Ga0495586_0027460 3300046535 Bacteria 3045
117 Ga0495587_0016291 3300046536 Bacteria 4625
118 Ga0495597_0061022 3300046542 Bacteria 1643
119 Ga0495597_0067240 3300046542 Bacteria 1550
120 Ga0495645_0009634 3300046543 Bacteria 6754
121 Ga0495622_0021196 3300046557 Bacteria 3027
122 Ga0495622_0097535 3300046557 Bacteria 1348
123 Ga0495668_0020237 3300046616 Bacteria 3828
124 Ga0495668_0052760 3300046616 Bacteria 2249
125 Ga0495668_0305457 3300046616 Bacteria 872
126 Ga0495634_0101692 3300046642 Bacteria 1856
127 Ga0495611_0018550 3300046648 Bacteria 2984
128 Ga0495611_0023295 3300046648 Bacteria 2686
129 Ga0495625_0041353 3300046660 Bacteria 3356
130 Ga0495625_0041754 3300046660 Bacteria 3337
131 Ga0495625_0443505 3300046660 Bacteria 803
132 Ga0495635_0002331 3300046663 Bacteria 12903
133 Ga0495635_0062414 3300046663 Bacteria 2559
134 Ga0495661_0012453 3300046665 Bacteria 5742
135 Ga0495588_0050939 3300046674 Bacteria 2131
136 Ga0495657_0004372 3300046675 Bacteria 11277
137 Ga0495657_0058370 3300046675 Bacteria 2562
138 Ga0495599_0141118 3300046678 Bacteria 1495
139 Ga0495623_0255182 3300046679 Bacteria 984
140 Ga0495646_0010028 3300046680 Bacteria 6021
141 Ga0495646_0074291 3300046680 Bacteria 1996
142 Ga0495613_0003257 3300046689 Bacteria 12141
143 Ga0495613_0008268 3300046689 Bacteria 7723
144 Ga0495624_0040149 3300046690 Bacteria 2998
145 Ga0495670_0060855 3300046691 Bacteria 1897
146 Ga0495671_0046375 3300046692 Bacteria 2173
147 Ga0495649_0015718 3300046694 Bacteria 4303
148 Ga0495649_0022446 3300046694 Bacteria 3532
149 Ga0495649_0060459 3300046694 Bacteria 2038
150 Ga0495589_0005595 3300046794 Bacteria 6627
151 Ga0495589_0007150 3300046794 Bacteria 5849
152 Ga0495589_0010923 3300046794 Bacteria 4717
153 Ga0495589_0015461 3300046794 Bacteria 3926
154 Ga0495589_0016894 3300046794 Bacteria 3747
155 Ga0495600_0014228 3300046809 Bacteria 5013
156 Ga0495660_0073357 3300046810 Bacteria 1810
157 Ga0495581_0009367 3300047315 Bacteria 5667
158 Ga0495581_0093596 3300047315 Bacteria 1744
159 Ga0495636_0010815 3300047318 Bacteria 3608
160 Ga0495636_0028778 3300047318 Bacteria 2267
161 Ga0495636_0028926 3300047318 Bacteria 2261
162 Ga0495636_0064318 3300047318 Bacteria 1556
163 Ga0495674_0125816 3300047319 Bacteria 2163
164 Ga0495674_0206378 3300047319 Bacteria 1629
165 Ga0495672_0278206 3300047320 Bacteria 801
166 Ga0495676_0004555 3300047321 Bacteria 12679
167 Ga0495676_0034752 3300047321 Bacteria 4225
168 Ga0495676_0060569 3300047321 Bacteria 2965
169 Ga0495680_0062912 3300047322 Bacteria 2851
170 Ga0495687_005607 3300047443 Bacteria 7936
171 Ga0495687_010178 3300047443 Bacteria 5174
172 Ga0495675_0362081 3300047444 Bacteria 851
173 Ga0495685_000489 3300047447 Bacteria 12254
174 Ga0495685_002735 3300047447 Bacteria 5559
175 Ga0495685_009407 3300047447 Bacteria 3262
176 Ga0495685_035573 3300047447 Bacteria 1711
177 Ga0495681_0053534 3300047470 Bacteria 1889
178 Ga0495593_0004935 3300047673 Bacteria 7907
179 Ga0495602_0030908 3300048088 Bacteria 5070
180 Ga0495614_0001988 3300048089 Bacteria 8993
181 Ga0495626_0015237 3300048091 Bacteria 3940
182 Ga0501308_001296 3300049128 Bacteria 1958
183 Ga0495678_060667 3300049459 Bacteria 1422
184 Ga0501031_0027251 3300049568 Bacteria 3726
185 Ga0501031_0033616 3300049568 Bacteria 3346
186 Ga0501032_0008683 3300049569 Bacteria 7402
187 Ga0501032_0211030 3300049569 Bacteria 1266
188 Ga0501033_0001228 3300049570 Bacteria 22982
189 Ga0501033_0015092 3300049570 Bacteria 5861
190 Ga0501033_0032322 3300049570 Bacteria 3930
191 Ga0501033_0152724 3300049570 Bacteria 1665
192 Ga0501034_0002717 3300049571 Bacteria 20840
193 Ga0501034_0021115 3300049571 Bacteria 6643
194 Ga0501034_0703947 3300049571 Bacteria 908
195 Ga0501036_0011763 3300049572 Bacteria 7251
196 Ga0501036_0019401 3300049572 Bacteria 5707
197 Ga0501036_0045651 3300049572 Bacteria 3711
198 Ga0501036_0171749 3300049572 Bacteria 1826
199 Ga0501037_0005606 3300049573 Bacteria 9149
200 Ga0501037_0033812 3300049573 Bacteria 3775
201 Ga0501037_0123469 3300049573 Bacteria 1860
202 Ga0501038_0020688 3300049574 Bacteria 5915
203 Ga0501038_0129517 3300049574 Bacteria 2073
204 Ga0501038_0500078 3300049574 Bacteria 930
205 Ga0501039_0001504 3300049575 Bacteria 17163
206 Ga0501039_0075709 3300049575 Bacteria 2616
207 Ga0501040_0194212 3300049576 Bacteria 1441
208 Ga0501042_0011009 3300049578 Bacteria 6089
209 Ga0501042_0011520 3300049578 Bacteria 5971
210 Ga0501043_0001120 3300049579 Bacteria 23524
211 Ga0501043_0005096 3300049579 Bacteria 10635
212 Ga0501043_0044760 3300049579 Bacteria 3480
213 Ga0501043_0053739 3300049579 Bacteria 3163
214 Ga0501043_0175465 3300049579 Bacteria 1671
215 Ga0501046_0007718 3300049580 Bacteria 9432
216 Ga0501046_0148706 3300049580 Bacteria 1768
217 Ga0501046_0328427 3300049580 Bacteria 1113
218 Ga0501047_0020491 3300049581 Bacteria 6348
219 Ga0501047_0024709 3300049581 Bacteria 5769
220 Ga0501047_0098051 3300049581 Bacteria 2809
221 Ga0501047_0508296 3300049581 Bacteria 1031
222 Ga0501048_0013658 3300049582 Bacteria 6024
223 Ga0501048_0045296 3300049582 Bacteria 3142
224 Ga0501070_0002406 3300049586 Bacteria 16417
225 Ga0501070_0179054 3300049586 Bacteria 1745
226 Ga0501070_0231803 3300049586 Bacteria 1513
227 Ga0501073_0074965 3300049589 Bacteria 2355
228 Ga0501073_0092969 3300049589 Bacteria 2096
229 Ga0501074_0070204 3300049590 Bacteria 2518
230 Ga0501076_0361872 3300049592 Bacteria 1192
231 Ga0501235_048261 3300049669 Bacteria 983
232 Ga0501080_0030154 3300049742 Bacteria 5053
233 Ga0501080_0506079 3300049742 Bacteria 1079
234 Ga0501035_0000667 3300049822 Bacteria 37784
235 Ga0501035_0021181 3300049822 Bacteria 5976
236 Ga0501035_0058435 3300049822 Bacteria 3436
237 Ga0501035_0080374 3300049822 Bacteria 2878
238 Ga0501035_0340188 3300049822 Bacteria 1257
239 Ga0501044_0004539 3300049823 Bacteria 15523
240 Ga0501044_0009074 3300049823 Bacteria 10870
241 Ga0501044_0013085 3300049823 Bacteria 8980
242 Ga0501044_0106640 3300049823 Bacteria 2813
243 Ga0501044_0272873 3300049823 Bacteria 1626
244 Ga0501045_0605125 3300049824 Bacteria 811
245 nmdc:mga03n38_56020_c1 3300050490 Bacteria 1778
246 Ga0495619_0047999 3300053085 Bacteria 2813
247 Ga0500640_009933 3300053095 Bacteria 3826
248 Ga0500573_0030478 3300053140 Bacteria 3112
249 Ga0466962_0000324 3300061719 Bacteria 20473
250 Ga0466962_0011025 3300061719 Bacteria 4351
251 2990089250 2990088156 Bacteria 6657676
252 2547408992 2547132111 Bacteria 8013147
253 2585311134 2582581313 Bacteria 10042643
254 2585320082 2582581314 Bacteria 11452267
255 2616693236 2616644814 Bacteria 11555299
256 2616904302 2616644941 Bacteria 8510691
257 2643904917 2643221578 Bacteria 9213798
258 2644268478 2643221647 Bacteria 10741251
259 2644402976 2643221673 Bacteria 9196637
260 2644441456 2643221678 Bacteria 9540101
261 2784586384 2784132148 Bacteria 8627943
262 2785346414 2784746763 Bacteria 9783172
263 2785372918 2784746768 Bacteria 10036182
264 2785372948 2784746768 Bacteria 10036182
265 2786666542 2786546132 Bacteria 10419719
266 2793978633 2791355406 Bacteria 11364898
267 2808846281 2808606359 Bacteria 9866990
268 2808916439 2808606375 Bacteria 9466072
269 2809229884 2808606448 Bacteria 8656184
270 2811846203 2808606982 Bacteria 7791042
271 2812354102 2811994879 Bacteria 9313447
272 2812483001 2811994917 Bacteria 7761064
273 2852635794 2852635781 Bacteria 8251373
274 2862178733 2862178590 Bacteria 8583590
275 2862390228 2862382967 Bacteria 10317375
276 2862580358 2862574272 Bacteria 10567477
277 2863407972 2863404153 Bacteria 9672205
278 2867371187 2867369537 Bacteria 6501581
279 2867430238 2867428634 Bacteria 9590268
280 2867476694 2867475112 Bacteria 6909112
281 2873158138 2873151551 Bacteria 8625867
282 2875398076 2875391855 Bacteria 7600475
283 2912727048 2912723979 Bacteria 8557534
284 2912757950 2912757875 Bacteria 7940295
285 2919473216 2919468124 Bacteria 9133025
286 2946052469 2946045630 Bacteria 8527308
287 2946071598 2946064051 Bacteria 8957905
288 2947225115 2947224130 Bacteria 9938529
289 2954681614 2954673503 Bacteria 9685905
290 2954719688 2954711539 Bacteria 10867210
291 2954729722 2954721474 Bacteria 10456478
292 2954730428 2954721474 Bacteria 10456478
293 2954731615 2954731030 Bacteria 10243860
294 2954732086 2954731030 Bacteria 10243860
295 2954748627 2954740390 Bacteria 10229294
296 2954749142 2954740390 Bacteria 10229294
297 2954750325 2954749733 Bacteria 10366972
298 2954751026 2954749733 Bacteria 10366972
299 2954767744 2954759201 Bacteria 9358192
300 2966605345 2966598605 Bacteria 7676064
301 2990091566 2990088156 Bacteria 6657676
302 2997453587 2997451912 Bacteria 8492419
303 3006429865 3006425503 Bacteria 6491253
304 3006497004 3006493962 Bacteria 8825450
305 8008560688 8008558824 Bacteria 10610750
306 8023626047 8023623736 Bacteria 8593882
307 8025415289 8025413630 Bacteria 7014048
308 8025480211 8025478263 Bacteria 8209203
309 8047902950 8047893842 Bacteria 11723082
310 8048135435 8048127548 Bacteria 11053136
311 8048370746 8048369669 Bacteria 11666822
312 8048388676 8048379754 Bacteria 11877923
313 8048407323 8048406513 Bacteria 8936924
314 8054163911 8054160619 Bacteria 7783213
315 8056064137 8056060235 Bacteria 7259403
316 8056453869 8056447290 Bacteria 7680491
317 JGI24740J21852_10088687
318 rootH1_10019582
319 rootH2_10013574
320 JGI25160J50197_1002334
321 JGI25160J50197_1022439
322 JGI25160J50197_1028730
323 Ga0068853_100013868
324 Ga0081455_10115460
325 Ga0075365_10522594
326 Ga0075363_100061117
327 Ga0207426_1000760
328 Ga0207426_1002375
329 Ga0207426_1003430
330 Ga0207426_1014334
331 Ga0207426_1056370
332 Ga0207639_10264487
333 Ga0307515_10152261
334 Ga0307511_10000176
335 Ga0307511_10110970
336 Ga0307512_10003641
337 Ga0307512_10041953
338 Ga0307513_10090587
339 Ga0307508_10010034
340 Ga0307508_10093327
341 Ga0307514_10005770
342 Ga0307514_10035284
343 Ga0307516_10016782
344 Ga0307516_10030239
345 Ga0307413_10161403
346 Ga0307416_101083406
347 Ga0307507_10052772
348 Ga0307510_10008811
349 Ga0307510_10239941
350 Ga0395899_0360154
351 Ga0395900_0164187
352 Ga0395898_0028776
353 Ga0395898_0041909
354 Ga0395905_0949499
355 Ga0439436_0000664
356 Ga0451800_0390081
357 Ga0451855_1254610
358 Ga0451853_1232334
359 Ga0439450_106479
360 Ga0439457_000791
361 Ga0439457_070701
362 Ga0450920_038059
363 Ga0450894_001934
364 Ga0450898_000255
365 Ga0450903_000099
366 Ga0439458_0000593
367 Ga0439458_0059598
368 Ga0466969_0015971
369 Ga0466969_0329348
370 Ga0466972_0000834
371 Ga0466972_0046595
372 Ga0466972_0153431
373 Ga0466965_0008953
374 Ga0466966_0008084
375 Ga0466966_0491801
376 Ga0466961_0005484
377 Ga0466961_0048918
378 Ga0466961_0091508
379 Ga0466961_0339371
380 Ga0466963_0010829
381 Ga0466971_0000798
382 Ga0466971_0305454
383 Ga0466968_0126741
384 Ga0466970_0000152
385 Ga0466970_0001063
386 Ga0466970_0104416
387 Ga0466970_0298379
388 Ga0466957_0001037
389 Ga0466957_0066383
390 Ga0466960_0021307
391 Ga0466959_0014069
392 Ga0466959_0175171
393 Ga0466959_0582488
394 Ga0466967_0000293
395 Ga0466967_0031007
396 Ga0466967_0652477
397 Ga0495627_147113
398 Ga0495592_0190936
399 Ga0495603_0090321
400 Ga0495603_0189997
401 Ga0495629_0033569
402 Ga0495638_0097865
403 Ga0495651_0003798
404 Ga0495651_0066958
405 Ga0495582_0017426
406 Ga0495605_0020357
407 Ga0495662_0005765
408 Ga0495662_0058278
409 Ga0495664_0004978
410 Ga0495664_0028546
411 Ga0495585_0029423
412 Ga0495594_0066629
413 Ga0495596_0144469
414 Ga0495607_0069548
415 Ga0495607_0075643
416 Ga0495583_0006681
417 Ga0495606_0009690
418 Ga0495610_0092786
419 Ga0495616_0005639
420 Ga0495616_0114492
421 Ga0495620_0018507
422 Ga0495620_0019605
423 Ga0495628_0108831
424 Ga0495630_0023476
425 Ga0495631_0032370
426 Ga0495631_0064482
427 Ga0495643_0004235
428 Ga0495666_0055024
429 Ga0495666_0162575
430 Ga0495642_0112326
431 Ga0495652_0015816
432 Ga0495586_0027460
433 Ga0495587_0016291
434 Ga0495597_0061022
435 Ga0495597_0067240
436 Ga0495645_0009634
437 Ga0495622_0021196
438 Ga0495622_0097535
439 Ga0495668_0020237
440 Ga0495668_0052760
441 Ga0495668_0305457
442 Ga0495634_0101692
443 Ga0495611_0018550
444 Ga0495611_0023295
445 Ga0495625_0041353
446 Ga0495625_0041754
447 Ga0495625_0443505
448 Ga0495635_0002331
449 Ga0495635_0062414
450 Ga0495661_0012453
451 Ga0495588_0050939
452 Ga0495657_0004372
453 Ga0495657_0058370
454 Ga0495599_0141118
455 Ga0495623_0255182
456 Ga0495646_0010028
457 Ga0495646_0074291
458 Ga0495613_0003257
459 Ga0495613_0008268
460 Ga0495624_0040149
461 Ga0495670_0060855
462 Ga0495671_0046375
463 Ga0495649_0015718
464 Ga0495649_0022446
465 Ga0495649_0060459
466 Ga0495589_0005595
467 Ga0495589_0007150
468 Ga0495589_0010923
469 Ga0495589_0015461
470 Ga0495589_0016894
471 Ga0495600_0014228
472 Ga0495660_0073357
473 Ga0495581_0009367
474 Ga0495581_0093596
475 Ga0495636_0010815
476 Ga0495636_0028778
477 Ga0495636_0028926
478 Ga0495636_0064318
479 Ga0495674_0125816
480 Ga0495674_0206378
481 Ga0495672_0278206
482 Ga0495676_0004555
483 Ga0495676_0034752
484 Ga0495676_0060569
485 Ga0495680_0062912
486 Ga0495687_005607
487 Ga0495687_010178
488 Ga0495675_0362081
489 Ga0495685_000489
490 Ga0495685_002735
491 Ga0495685_009407
492 Ga0495685_035573
493 Ga0495681_0053534
494 Ga0495593_0004935
495 Ga0495602_0030908
496 Ga0495614_0001988
497 Ga0495626_0015237
498 Ga0501308_001296
499 Ga0495678_060667
500 Ga0501031_0027251
501 Ga0501031_0033616
502 Ga0501032_0008683
503 Ga0501032_0211030
504 Ga0501033_0001228
505 Ga0501033_0015092
506 Ga0501033_0032322
507 Ga0501033_0152724
508 Ga0501034_0002717
509 Ga0501034_0021115
510 Ga0501034_0703947
511 Ga0501036_0011763
512 Ga0501036_0019401
513 Ga0501036_0045651
514 Ga0501036_0171749
515 Ga0501037_0005606
516 Ga0501037_0033812
517 Ga0501037_0123469
518 Ga0501038_0020688
519 Ga0501038_0129517
520 Ga0501038_0500078
521 Ga0501039_0001504
522 Ga0501039_0075709
523 Ga0501040_0194212
524 Ga0501042_0011009
525 Ga0501042_0011520
526 Ga0501043_0001120
527 Ga0501043_0005096
528 Ga0501043_0044760
529 Ga0501043_0053739
530 Ga0501043_0175465
531 Ga0501046_0007718
532 Ga0501046_0148706
533 Ga0501046_0328427
534 Ga0501047_0020491
535 Ga0501047_0024709
536 Ga0501047_0098051
537 Ga0501047_0508296
538 Ga0501048_0013658
539 Ga0501048_0045296
540 Ga0501070_0002406
541 Ga0501070_0179054
542 Ga0501070_0231803
543 Ga0501073_0074965
544 Ga0501073_0092969
545 Ga0501074_0070204
546 Ga0501076_0361872
547 Ga0501235_048261
548 Ga0501080_0030154
549 Ga0501080_0506079
550 Ga0501035_0000667
551 Ga0501035_0021181
552 Ga0501035_0058435
553 Ga0501035_0080374
554 Ga0501035_0340188
555 Ga0501044_0004539
556 Ga0501044_0009074
557 Ga0501044_0013085
558 Ga0501044_0106640
559 Ga0501044_0272873
560 Ga0501045_0605125
561 nmdc:mga03n38_56020_c1
562 Ga0495619_0047999
563 Ga0500640_009933
564 Ga0500573_0030478
565 Ga0466962_0000324
566 Ga0466962_0011025
567 2990089250
568 2547408992
569 2585311134
570 2585320082
571 2616693236
572 2616904302
573 2643904917
574 2644268478
575 2644402976
576 2644441456
577 2784586384
578 2785346414
579 2785372918
580 2785372948
581 2786666542
582 2793978633
583 2808846281
584 2808916439
585 2809229884
586 2811846203
587 2812354102
588 2812483001
589 2852635794
590 2862178733
591 2862390228
592 2862580358
593 2863407972
594 2867371187
595 2867430238
596 2867476694
597 2873158138
598 2875398076
599 2912727048
600 2912757950
601 2919473216
602 2946052469
603 2946071598
604 2947225115
605 2954681614
606 2954719688
607 2954729722
608 2954730428
609 2954731615
610 2954732086
611 2954748627
612 2954749142
613 2954750325
614 2954751026
615 2954767744
616 2966605345
617 2990091566
618 2997453587
619 3006429865
620 3006497004
621 8008560688
622 8023626047
623 8025415289
624 8025480211
625 8047902950
626 8048135435
627 8048370746
628 8048388676
629 8048407323
630 8054163911
631 8056064137
632 8056453869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

116

211

0.96

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

48

119

0.78

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

48

138

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ltu-assembly2.cif.gz_B crystal structure of ferredoxin from rhodopseudomonas palustris haa2 0.6401 10 84
3lb8-assembly1.cif.gz_C crystal structure of the covalent putidaredoxin reductase-putidaredoxin complex 0.6264 10 82
1l5p-assembly3.cif.gz_C crystal structure of trichomonas vaginalis ferredoxin 0.6234 10 81
3hui-assembly1.cif.gz_A crystal structure of the mutant a105r of [2fe-2s] ferredoxin in the class i cyp199a2 system from rhodopseudomonas palustris 0.617 5 84
7y5e-assembly1.cif.gz_NN in situ single-pbs-psii-psi-lhcs megacomplex. 0.5956 10 82
ID Description Score Start End Superfamily
5y6qA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.899 92 177 1.10.150.120
5g5hA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8975 86 176 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8866 86 177 1.10.150.120
5g5hA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.879 86 176 1.10.150.120
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8753 87 176 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A444QNL6-F1-model_v4 (2Fe-2S)-binding protein 0.8884 84 174 GO:0016903
GO:0046872
GO:0051537
AF-A0A382ITY9-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.8696 9 83 GO:0051537
AF-A0A444QNL6-F1-model_v4 (2Fe-2S)-binding protein 0.862 84 174 GO:0016903
GO:0046872
GO:0051537
AF-A0A350W5E3-F1-model_v4 Ferredoxin 0.8588 9 85 GO:0051537
AF-X1U994-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.8479 9 86 GO:0016903
GO:0051537

Map