F403671

General Info

Members Datasets Scaffolds Average Seq Length
316 208 632 216

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10062641|Ga0105239_100626412
Length 253
Sequence MYVKRDMRHTSNHRIPMGRVGFRFRVHRLRPDCNLHPSEENNVALRLGDDAPDFKAETTEGPIDFYDWKGDSWAVLFSHPKDFTPVCTTELGYTAKLKPEFEKRNVKVIGLSVDTPENHEGWANDIEETQGIRPNFPIISDADRKVSDLYDMIHPNASETTTVRSVFVIGADNKVKLMITYPASTGRNFDEILRVIDSLQLTAKYSVATPVNWKDGEDVIIVPAVSDEDAKTKFPKGFTTIKPYLRTTPQPNK

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
152 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
153 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
186 2511231024 Pseudomonas sp. GM84 Isolate Nodule
187 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
188 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
189 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
190 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
191 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
192 2643221658 Variovorax sp. Root411 Isolate Unclassified
193 2643221672 Variovorax sp. Root434 Isolate Unclassified
194 2765235841 Pseudomonas putida AA7 Isolate Unclassified
195 2818991446 Variovorax sp. 1180 Isolate Unclassified
196 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
197 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
198 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
199 2885198086 Variovorax sp. 679 Isolate Unclassified
200 2885211737 Variovorax sp. 553 Isolate Unclassified
201 2899924645 Variovorax sp. 369 Isolate Unclassified
202 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
203 2928037797 Variovorax sp. 1126 Isolate Unclassified
204 2928044640 Variovorax sp. 1128 Isolate Unclassified
205 2928051484 Variovorax sp. 1133 Isolate Unclassified
206 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
207 2928070936 Variovorax gossypii 1167 Isolate Unclassified
208 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.41
Metatranscriptomes 0.32
Isolates 7.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.16
Nodule 0.63
Rhizoplane 1.58
Rhizosphere 89.24
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10062641 3300010375 Bacteria 4082
2 Ga0058862_10093605 3300004803 Bacteria 716
3 Ga0065712_10169371 3300005290 Bacteria 1253
4 Ga0070676_10186398 3300005328 Bacteria 1352
5 Ga0070690_100008267 3300005330 Bacteria 5986
6 Ga0070670_100045419 3300005331 Bacteria 3776
7 Ga0070670_100171070 3300005331 Bacteria 1884
8 Ga0070666_10035530 3300005335 Bacteria 3305
9 Ga0070666_10118476 3300005335 Bacteria 1835
10 Ga0070680_100053482 3300005336 Bacteria 3296
11 Ga0070660_100040295 3300005339 Bacteria 3554
12 Ga0070669_100166937 3300005353 Bacteria 1714
13 Ga0070675_100239376 3300005354 Bacteria 1586
14 Ga0070675_100329286 3300005354 Bacteria 1351
15 Ga0070673_100165253 3300005364 Bacteria 1885
16 Ga0070673_100170432 3300005364 Bacteria 1858
17 Ga0070673_100377660 3300005364 Bacteria 1263
18 Ga0070688_100344017 3300005365 Bacteria 1090
19 Ga0070659_100073119 3300005366 Bacteria 2729
20 Ga0070667_100675025 3300005367 Bacteria 955
21 Ga0070709_10000013 3300005434 Bacteria 162177
22 Ga0070713_100611194 3300005436 Bacteria 1036
23 Ga0070701_10206361 3300005438 Bacteria 1164
24 Ga0070701_10301529 3300005438 Bacteria 985
25 Ga0070705_100585293 3300005440 Bacteria 861
26 Ga0070694_100025740 3300005444 Bacteria 3808
27 Ga0070694_100820925 3300005444 Bacteria 763
28 Ga0070708_100171940 3300005445 Bacteria 2023
29 Ga0070708_100332240 3300005445 Bacteria 1432
30 Ga0070663_100559365 3300005455 Bacteria 957
31 Ga0070662_100235252 3300005457 Bacteria 1467
32 Ga0070681_10013770 3300005458 Bacteria 8052
33 Ga0070706_100538057 3300005467 Unclassified 1087
34 Ga0070698_100620437 3300005471 Bacteria 1022
35 Ga0070679_100356678 3300005530 Bacteria 1410
36 Ga0070697_100292374 3300005536 Bacteria 1399
37 Ga0068853_100132963 3300005539 Bacteria 2228
38 Ga0068853_100565959 3300005539 Bacteria 1078
39 Ga0070695_100023526 3300005545 Bacteria 3788
40 Ga0070665_100426573 3300005548 Bacteria 1335
41 Ga0070704_100072595 3300005549 Bacteria 2504
42 Ga0070704_100206506 3300005549 Bacteria 1589
43 Ga0068855_100476330 3300005563 Bacteria 1359
44 Ga0068855_100493153 3300005563 Bacteria 1332
45 Ga0070664_100001282 3300005564 Bacteria 20117
46 Ga0070664_100448546 3300005564 Bacteria 1184
47 Ga0070664_100728240 3300005564 Bacteria 925
48 Ga0068857_100058279 3300005577 Bacteria 3429
49 Ga0068854_100074079 3300005578 Bacteria 2497
50 Ga0068854_100486584 3300005578 Bacteria 1037
51 Ga0068856_100081154 3300005614 Bacteria 3217
52 Ga0068856_100320974 3300005614 Bacteria 1566
53 Ga0070702_100180510 3300005615 Bacteria 1381
54 Ga0068859_100105846 3300005617 Bacteria 2872
55 Ga0068859_100208664 3300005617 Bacteria 2039
56 Ga0068859_100313210 3300005617 Bacteria 1663
57 Ga0068859_100441473 3300005617 Bacteria 1398
58 Ga0068859_100730500 3300005617 Bacteria 1080
59 Ga0068859_101377682 3300005617 Bacteria 778
60 Ga0068859_101434775 3300005617 Bacteria 761
61 Ga0068864_101270746 3300005618 Bacteria 736
62 Ga0068866_10674334 3300005718 Bacteria 706
63 Ga0068861_100082843 3300005719 Bacteria 2515
64 Ga0068861_100186215 3300005719 Bacteria 1731
65 Ga0068861_100625994 3300005719 Bacteria 991
66 Ga0068861_100715766 3300005719 Bacteria 932
67 Ga0068863_100345354 3300005841 Bacteria 1448
68 Ga0068858_100014182 3300005842 Bacteria 7514
69 Ga0068858_100057780 3300005842 Bacteria 3585
70 Ga0068858_100168512 3300005842 Bacteria 2064
71 Ga0068858_100617958 3300005842 Bacteria 1052
72 Ga0068860_100034874 3300005843 Bacteria 4827
73 Ga0068860_100216628 3300005843 Bacteria 1858
74 Ga0068860_101101398 3300005843 Bacteria 813
75 Ga0068862_100115114 3300005844 Bacteria 2364
76 Ga0068862_100459657 3300005844 Bacteria 1201
77 Ga0068862_100694083 3300005844 Bacteria 985
78 Ga0081538_10209090 3300005981 Bacteria 789
79 Ga0075368_10112737 3300006042 Bacteria 1122
80 Ga0075363_100066978 3300006048 Bacteria 1945
81 Ga0075364_10063277 3300006051 Bacteria 2429
82 Ga0070716_100383410 3300006173 Bacteria 1005
83 Ga0075367_10524160 3300006178 Bacteria 752
84 Ga0097621_100016689 3300006237 Bacteria 5559
85 Ga0068871_100012681 3300006358 Bacteria 6227
86 Ga0075428_100292972 3300006844 Bacteria 1750
87 Ga0075428_100518557 3300006844 Bacteria 1275
88 Ga0075430_100000388 3300006846 Bacteria 32348
89 Ga0075431_100065804 3300006847 Bacteria 3742
90 Ga0075431_100226087 3300006847 Bacteria 1908
91 Ga0075433_10123811 3300006852 Unclassified 2297
92 Ga0075433_10848678 3300006852 Bacteria 797
93 Ga0075433_10876840 3300006852 Bacteria 783
94 Ga0075434_100005385 3300006871 Bacteria 11645
95 Ga0075434_100129901 3300006871 Bacteria 2538
96 Ga0075434_101021117 3300006871 Bacteria 841
97 Ga0075429_100003194 3300006880 Bacteria 13937
98 Ga0075429_100008790 3300006880 Bacteria 8781
99 Ga0068865_100037750 3300006881 Bacteria 3264
100 Ga0068865_100184426 3300006881 Bacteria 1609
101 Ga0075436_100328679 3300006914 Bacteria 1099
102 Ga0097620_100105846 3300006931 Bacteria 2872
103 Ga0097620_100208680 3300006931 Bacteria 2039
104 Ga0097620_100313218 3300006931 Bacteria 1663
105 Ga0097620_100441431 3300006931 Bacteria 1398
106 Ga0097620_100730426 3300006931 Bacteria 1080
107 Ga0097620_101377795 3300006931 Bacteria 778
108 Ga0097620_101434758 3300006931 Bacteria 761
109 Ga0075435_100070969 3300007076 Bacteria 2844
110 Ga0105251_10050592 3300009011 Bacteria 1984
111 Ga0111539_10004321 3300009094 Bacteria 18600
112 Ga0111539_10028451 3300009094 Bacteria 6818
113 Ga0105245_10000129 3300009098 Bacteria 72208
114 Ga0105245_10009359 3300009098 Bacteria 8547
115 Ga0105245_10086757 3300009098 Bacteria 2871
116 Ga0105247_10245570 3300009101 Bacteria 1221
117 Ga0114129_10003908 3300009147 Bacteria 21033
118 Ga0114129_10077990 3300009147 Bacteria 4608
119 Ga0114129_10097347 3300009147 Bacteria 4074
120 Ga0114129_10133986 3300009147 Bacteria 3401
121 Ga0114129_10181860 3300009147 Bacteria 2860
122 Ga0114129_10787979 3300009147 Bacteria 1214
123 Ga0105241_10016263 3300009174 Bacteria 5451
124 Ga0105241_10146056 3300009174 Bacteria 1930
125 Ga0105241_10150559 3300009174 Bacteria 1903
126 Ga0105242_10017594 3300009176 Bacteria 5574
127 Ga0105242_10081947 3300009176 Bacteria 2699
128 Ga0105248_10019680 3300009177 Bacteria 7471
129 Ga0105248_10085144 3300009177 Bacteria 3557
130 Ga0105237_10112822 3300009545 Bacteria 2710
131 Ga0105249_10048518 3300009553 Bacteria 3871
132 Ga0105249_10305200 3300009553 Bacteria 1598
133 Ga0105249_10706426 3300009553 Bacteria 1068
134 Ga0105249_10754529 3300009553 Bacteria 1035
135 Ga0105249_11736027 3300009553 Bacteria 697
136 Ga0157373_10043892 3300013100 Bacteria 3192
137 Ga0157373_10121975 3300013100 Bacteria 1832
138 Ga0157369_10082940 3300013105 Bacteria 3429
139 Ga0157374_10180886 3300013296 Bacteria 2060
140 Ga0157374_10624226 3300013296 Bacteria 1089
141 Ga0157378_10090737 3300013297 Bacteria 2777
142 Ga0157378_10280992 3300013297 Bacteria 1604
143 Ga0163162_10466245 3300013306 Bacteria 1395
144 Ga0163162_10626269 3300013306 Bacteria 1201
145 Ga0157372_10377543 3300013307 Bacteria 1652
146 Ga0163163_10054438 3300014325 Bacteria 3953
147 Ga0163163_10142284 3300014325 Bacteria 2441
148 Ga0163163_10774485 3300014325 Bacteria 1023
149 Ga0157376_10455254 3300014969 Bacteria 1249
150 Ga0163161_10099920 3300017792 Bacteria 2158
151 Ga0163161_10177189 3300017792 Bacteria 1633
152 Ga0207710_10002669 3300025900 Bacteria 8204
153 Ga0207680_10478828 3300025903 Bacteria 885
154 Ga0207647_10352014 3300025904 Bacteria 834
155 Ga0207699_10000007 3300025906 Bacteria 405928
156 Ga0207707_10052369 3300025912 Bacteria 3554
157 Ga0207695_10108951 3300025913 Bacteria 2753
158 Ga0207693_10102387 3300025915 Bacteria 2246
159 Ga0207663_10659237 3300025916 Bacteria 826
160 Ga0207660_10258993 3300025917 Bacteria 1375
161 Ga0207660_10745421 3300025917 Bacteria 799
162 Ga0207657_10062247 3300025919 Bacteria 3196
163 Ga0207649_10143177 3300025920 Bacteria 1638
164 Ga0207652_10840979 3300025921 Bacteria 813
165 Ga0207646_10024188 3300025922 Bacteria 5567
166 Ga0207681_10072118 3300025923 Bacteria 2411
167 Ga0207650_10014382 3300025925 Bacteria 5500
168 Ga0207650_10564936 3300025925 Bacteria 954
169 Ga0207659_10332052 3300025926 Bacteria 1257
170 Ga0207687_10000092 3300025927 Bacteria 65810
171 Ga0207687_10011157 3300025927 Bacteria 5871
172 Ga0207687_10058858 3300025927 Bacteria 2704
173 Ga0207644_10189066 3300025931 Bacteria 1618
174 Ga0207690_10179909 3300025932 Bacteria 1591
175 Ga0207706_10272149 3300025933 Bacteria 1478
176 Ga0207686_10109482 3300025934 Bacteria 1860
177 Ga0207686_10198329 3300025934 Bacteria 1436
178 Ga0207709_10109726 3300025935 Bacteria 1842
179 Ga0207670_10008053 3300025936 Bacteria 5925
180 Ga0207669_10105723 3300025937 Bacteria 1873
181 Ga0207669_10349032 3300025937 Bacteria 1142
182 Ga0207704_10257962 3300025938 Bacteria 1313
183 Ga0207704_10351971 3300025938 Bacteria 1147
184 Ga0207665_10066058 3300025939 Bacteria 2461
185 Ga0207665_10171641 3300025939 Bacteria 1566
186 Ga0207711_10095760 3300025941 Bacteria 2619
187 Ga0207661_10285177 3300025944 Bacteria 1477
188 Ga0207679_10517194 3300025945 Bacteria 1067
189 Ga0207679_10607418 3300025945 Bacteria 986
190 Ga0207667_10114192 3300025949 Bacteria 2784
191 Ga0207667_10405937 3300025949 Bacteria 1387
192 Ga0207651_10090479 3300025960 Bacteria 2237
193 Ga0207651_10302302 3300025960 Bacteria 1331
194 Ga0207651_10316594 3300025960 Bacteria 1303
195 Ga0207712_10395501 3300025961 Bacteria 1160
196 Ga0207712_10674918 3300025961 Bacteria 900
197 Ga0207640_10110578 3300025981 Bacteria 1947
198 Ga0207640_10310068 3300025981 Bacteria 1252
199 Ga0207658_10108953 3300025986 Bacteria 2186
200 Ga0207658_10232551 3300025986 Bacteria 1557
201 Ga0207658_10377693 3300025986 Bacteria 1240
202 Ga0207703_10009094 3300026035 Bacteria 7821
203 Ga0207703_10104230 3300026035 Bacteria 2409
204 Ga0207703_10272707 3300026035 Bacteria 1533
205 Ga0207703_10332144 3300026035 Bacteria 1395
206 Ga0207639_10121389 3300026041 Bacteria 2148
207 Ga0207678_10856930 3300026067 Bacteria 803
208 Ga0207702_10106587 3300026078 Bacteria 2483
209 Ga0207641_10293765 3300026088 Bacteria 1532
210 Ga0207676_10205450 3300026095 Bacteria 1743
211 Ga0207676_10226811 3300026095 Bacteria 1667
212 Ga0207674_10094072 3300026116 Bacteria 2984
213 Ga0207675_100241308 3300026118 Bacteria 1746
214 Ga0207698_10810867 3300026142 Bacteria 939
215 Ga0209813_10144055 3300027866 Bacteria 848
216 Ga0207428_10033646 3300027907 Bacteria 4207
217 Ga0268265_10139249 3300028380 Bacteria 2029
218 Ga0268265_10448519 3300028380 Bacteria 1204
219 Ga0268265_10549296 3300028380 Bacteria 1096
220 Ga0268264_10243379 3300028381 Bacteria 1667
221 Ga0268264_10275498 3300028381 Bacteria 1574
222 Ga0268264_11026448 3300028381 Bacteria 832
223 Ga0265318_10099858 3300028577 Bacteria 1068
224 Ga0265325_10086673 3300031241 Bacteria 1549
225 Ga0265327_10006915 3300031251 Bacteria 8919
226 Ga0307413_10184346 3300031824 Bacteria 1492
227 Ga0307406_10395983 3300031901 Bacteria 1093
228 Ga0307407_10204188 3300031903 Bacteria 1326
229 Ga0307409_100098700 3300031995 Bacteria 2416
230 Ga0307409_100480948 3300031995 Bacteria 1205
231 Ga0307415_100206269 3300032126 Bacteria 1564
232 Ga0373926_0002222 3300035083 Bacteria 6128
233 Ga0373931_0117584 3300035691 Bacteria 1516
234 Ga0373927_0002292 3300035695 Bacteria 14012
235 Ga0395900_0323919 3300037418 Unclassified 1521
236 Ga0436365_1311885 3300039437 Bacteria 755
237 Ga0453683_0022773 3300044673 Bacteria 3994
238 Ga0453684_0002096 3300044712 Bacteria 50405
239 Ga0451576_0330072 3300045051 Bacteria 1596
240 Ga0495585_0024617 3300046492 Bacteria 3450
241 Ga0495633_0062869 3300046558 Bacteria 1738
242 Ga0495611_0031765 3300046648 Bacteria 2325
243 Ga0495670_0010645 3300046691 Bacteria 4520
244 Ga0495636_0004304 3300047318 Bacteria 5587
245 Ga0495685_031714 3300047447 Bacteria 1816
246 Ga0495681_0063588 3300047470 Bacteria 1693
247 Ga0495602_0205339 3300048088 Bacteria 1500
248 Ga0496104_0323309 3300048907 Bacteria 1456
249 Ga0496111_0141155 3300048914 Bacteria 1785
250 Ga0496123_0080372 3300048926 Bacteria 1987
251 Ga0496124_0001393 3300048927 Bacteria 36270
252 Ga0496125_0191996 3300048928 Bacteria 1347
253 Ga0496126_0109965 3300048929 Bacteria 2401
254 Ga0501033_0149989 3300049570 Bacteria 1682
255 Ga0501034_0009952 3300049571 Bacteria 9937
256 Ga0501034_0052885 3300049571 Bacteria 4091
257 Ga0501034_0081928 3300049571 Bacteria 3229
258 Ga0501034_0249573 3300049571 Bacteria 1719
259 Ga0501039_0452796 3300049575 Bacteria 1008
260 Ga0501043_0409988 3300049579 Bacteria 1023
261 Ga0501047_0100698 3300049581 Bacteria 2769
262 Ga0501047_0208182 3300049581 Bacteria 1815
263 Ga0501075_0759511 3300049591 Bacteria 738
264 Ga0501076_0264347 3300049592 Bacteria 1409
265 Ga0501080_0211131 3300049742 Bacteria 1779
266 Ga0501080_0277466 3300049742 Bacteria 1524
267 Ga0501083_0009063 3300049744 Bacteria 7026
268 Ga0501083_0405269 3300049744 Bacteria 887
269 Ga0501044_0099357 3300049823 Bacteria 2929
270 nmdc:mga00v17_384889_c1 3300050491 Bacteria 912
271 nmdc:mga04h51_18466_c1 3300050495 Bacteria 2054
272 nmdc:mga07m45_51104_c1 3300050496 Bacteria 2330
273 nmdc:mga05p37_103691_c1 3300050507 Bacteria 3500
274 nmdc:mga05p37_183657_c1 3300050507 Bacteria 2543
275 nmdc:mga05p37_622464_c1 3300050507 Bacteria 1214
276 nmdc:mga09592_124_c1 3300050508 Bacteria 49270
277 nmdc:mga09592_173186_c1 3300050508 Bacteria 1866
278 nmdc:mga09592_42815_c1 3300050508 Bacteria 3809
279 nmdc:mga0qj67_1294_c1 3300050509 Bacteria 17537
280 nmdc:mga06r32_1089_c1 3300050510 Bacteria 24368
281 nmdc:mga06r32_119960_c1 3300050510 Bacteria 2593
282 nmdc:mga06r32_22634_c1 3300050510 Bacteria 5812
283 nmdc:mga08y16_4847_c1 3300050511 Bacteria 14042
284 nmdc:mga0n895_263384_c1 3300050512 Bacteria 1749
285 nmdc:mga0n895_26939_c1 3300050512 Bacteria 5453
286 nmdc:mga0rr50_78237_c1 3300050513 Bacteria 2544
287 nmdc:mga08x19_322762_c1 3300050514 Bacteria 1075
288 nmdc:mga0a205_140715_c1 3300050515 Bacteria 2313
289 nmdc:mga0a205_148615_c1 3300050515 Unclassified 2243
290 nmdc:mga0a205_205583_c1 3300050515 Bacteria 1858
291 Ga0500604_0042044 3300053151 Bacteria 1384
292 Ga0501082_0055887 3300060353 Bacteria 3400
293 Ga0530510_0003147 3300061734 Bacteria 11333
294 2511375502 2511231024 Bacteria 5835885
295 2513227123 2513020051 Bacteria 6053213
296 2599623654 2599185214 Bacteria 8209958
297 2599671727 2599185226 Bacteria 8233575
298 2599681260 2599185227 Bacteria 8246414
299 2599693337 2599185229 Bacteria 8216126
300 2644327615 2643221658 Bacteria 6064537
301 2644401481 2643221672 Bacteria 6322190
302 2765586557 2765235841 Bacteria 6137024
303 2819597208 2818991446 Bacteria 7757362
304 2831266333 2831265667 Bacteria 7184833
305 2838057555 2838054893 Bacteria 7451788
306 2883359097 2883354860 Bacteria 5865246
307 2885204456 2885198086 Bacteria 7212419
308 2885218109 2885211737 Bacteria 7212420
309 2899924712 2899924645 Bacteria 7487985
310 2904548164 2904541872 Bacteria 8915136
311 2928039161 2928037797 Bacteria 7273642
312 2928045234 2928044640 Bacteria 7271509
313 2928053039 2928051484 Bacteria 7773759
314 2928064290 2928064002 Bacteria 7419480
315 2928071727 2928070936 Bacteria 8062541
316 2929163093 2929160207 Bacteria 9075316
317 Ga0105239_10062641
318 Ga0058862_10093605
319 Ga0065712_10169371
320 Ga0070676_10186398
321 Ga0070690_100008267
322 Ga0070670_100045419
323 Ga0070670_100171070
324 Ga0070666_10035530
325 Ga0070666_10118476
326 Ga0070680_100053482
327 Ga0070660_100040295
328 Ga0070669_100166937
329 Ga0070675_100239376
330 Ga0070675_100329286
331 Ga0070673_100165253
332 Ga0070673_100170432
333 Ga0070673_100377660
334 Ga0070688_100344017
335 Ga0070659_100073119
336 Ga0070667_100675025
337 Ga0070709_10000013
338 Ga0070713_100611194
339 Ga0070701_10206361
340 Ga0070701_10301529
341 Ga0070705_100585293
342 Ga0070694_100025740
343 Ga0070694_100820925
344 Ga0070708_100171940
345 Ga0070708_100332240
346 Ga0070663_100559365
347 Ga0070662_100235252
348 Ga0070681_10013770
349 Ga0070706_100538057
350 Ga0070698_100620437
351 Ga0070679_100356678
352 Ga0070697_100292374
353 Ga0068853_100132963
354 Ga0068853_100565959
355 Ga0070695_100023526
356 Ga0070665_100426573
357 Ga0070704_100072595
358 Ga0070704_100206506
359 Ga0068855_100476330
360 Ga0068855_100493153
361 Ga0070664_100001282
362 Ga0070664_100448546
363 Ga0070664_100728240
364 Ga0068857_100058279
365 Ga0068854_100074079
366 Ga0068854_100486584
367 Ga0068856_100081154
368 Ga0068856_100320974
369 Ga0070702_100180510
370 Ga0068859_100105846
371 Ga0068859_100208664
372 Ga0068859_100313210
373 Ga0068859_100441473
374 Ga0068859_100730500
375 Ga0068859_101377682
376 Ga0068859_101434775
377 Ga0068864_101270746
378 Ga0068866_10674334
379 Ga0068861_100082843
380 Ga0068861_100186215
381 Ga0068861_100625994
382 Ga0068861_100715766
383 Ga0068863_100345354
384 Ga0068858_100014182
385 Ga0068858_100057780
386 Ga0068858_100168512
387 Ga0068858_100617958
388 Ga0068860_100034874
389 Ga0068860_100216628
390 Ga0068860_101101398
391 Ga0068862_100115114
392 Ga0068862_100459657
393 Ga0068862_100694083
394 Ga0081538_10209090
395 Ga0075368_10112737
396 Ga0075363_100066978
397 Ga0075364_10063277
398 Ga0070716_100383410
399 Ga0075367_10524160
400 Ga0097621_100016689
401 Ga0068871_100012681
402 Ga0075428_100292972
403 Ga0075428_100518557
404 Ga0075430_100000388
405 Ga0075431_100065804
406 Ga0075431_100226087
407 Ga0075433_10123811
408 Ga0075433_10848678
409 Ga0075433_10876840
410 Ga0075434_100005385
411 Ga0075434_100129901
412 Ga0075434_101021117
413 Ga0075429_100003194
414 Ga0075429_100008790
415 Ga0068865_100037750
416 Ga0068865_100184426
417 Ga0075436_100328679
418 Ga0097620_100105846
419 Ga0097620_100208680
420 Ga0097620_100313218
421 Ga0097620_100441431
422 Ga0097620_100730426
423 Ga0097620_101377795
424 Ga0097620_101434758
425 Ga0075435_100070969
426 Ga0105251_10050592
427 Ga0111539_10004321
428 Ga0111539_10028451
429 Ga0105245_10000129
430 Ga0105245_10009359
431 Ga0105245_10086757
432 Ga0105247_10245570
433 Ga0114129_10003908
434 Ga0114129_10077990
435 Ga0114129_10097347
436 Ga0114129_10133986
437 Ga0114129_10181860
438 Ga0114129_10787979
439 Ga0105241_10016263
440 Ga0105241_10146056
441 Ga0105241_10150559
442 Ga0105242_10017594
443 Ga0105242_10081947
444 Ga0105248_10019680
445 Ga0105248_10085144
446 Ga0105237_10112822
447 Ga0105249_10048518
448 Ga0105249_10305200
449 Ga0105249_10706426
450 Ga0105249_10754529
451 Ga0105249_11736027
452 Ga0157373_10043892
453 Ga0157373_10121975
454 Ga0157369_10082940
455 Ga0157374_10180886
456 Ga0157374_10624226
457 Ga0157378_10090737
458 Ga0157378_10280992
459 Ga0163162_10466245
460 Ga0163162_10626269
461 Ga0157372_10377543
462 Ga0163163_10054438
463 Ga0163163_10142284
464 Ga0163163_10774485
465 Ga0157376_10455254
466 Ga0163161_10099920
467 Ga0163161_10177189
468 Ga0207710_10002669
469 Ga0207680_10478828
470 Ga0207647_10352014
471 Ga0207699_10000007
472 Ga0207707_10052369
473 Ga0207695_10108951
474 Ga0207693_10102387
475 Ga0207663_10659237
476 Ga0207660_10258993
477 Ga0207660_10745421
478 Ga0207657_10062247
479 Ga0207649_10143177
480 Ga0207652_10840979
481 Ga0207646_10024188
482 Ga0207681_10072118
483 Ga0207650_10014382
484 Ga0207650_10564936
485 Ga0207659_10332052
486 Ga0207687_10000092
487 Ga0207687_10011157
488 Ga0207687_10058858
489 Ga0207644_10189066
490 Ga0207690_10179909
491 Ga0207706_10272149
492 Ga0207686_10109482
493 Ga0207686_10198329
494 Ga0207709_10109726
495 Ga0207670_10008053
496 Ga0207669_10105723
497 Ga0207669_10349032
498 Ga0207704_10257962
499 Ga0207704_10351971
500 Ga0207665_10066058
501 Ga0207665_10171641
502 Ga0207711_10095760
503 Ga0207661_10285177
504 Ga0207679_10517194
505 Ga0207679_10607418
506 Ga0207667_10114192
507 Ga0207667_10405937
508 Ga0207651_10090479
509 Ga0207651_10302302
510 Ga0207651_10316594
511 Ga0207712_10395501
512 Ga0207712_10674918
513 Ga0207640_10110578
514 Ga0207640_10310068
515 Ga0207658_10108953
516 Ga0207658_10232551
517 Ga0207658_10377693
518 Ga0207703_10009094
519 Ga0207703_10104230
520 Ga0207703_10272707
521 Ga0207703_10332144
522 Ga0207639_10121389
523 Ga0207678_10856930
524 Ga0207702_10106587
525 Ga0207641_10293765
526 Ga0207676_10205450
527 Ga0207676_10226811
528 Ga0207674_10094072
529 Ga0207675_100241308
530 Ga0207698_10810867
531 Ga0209813_10144055
532 Ga0207428_10033646
533 Ga0268265_10139249
534 Ga0268265_10448519
535 Ga0268265_10549296
536 Ga0268264_10243379
537 Ga0268264_10275498
538 Ga0268264_11026448
539 Ga0265318_10099858
540 Ga0265325_10086673
541 Ga0265327_10006915
542 Ga0307413_10184346
543 Ga0307406_10395983
544 Ga0307407_10204188
545 Ga0307409_100098700
546 Ga0307409_100480948
547 Ga0307415_100206269
548 Ga0373926_0002222
549 Ga0373931_0117584
550 Ga0373927_0002292
551 Ga0395900_0323919
552 Ga0436365_1311885
553 Ga0453683_0022773
554 Ga0453684_0002096
555 Ga0451576_0330072
556 Ga0495585_0024617
557 Ga0495633_0062869
558 Ga0495611_0031765
559 Ga0495670_0010645
560 Ga0495636_0004304
561 Ga0495685_031714
562 Ga0495681_0063588
563 Ga0495602_0205339
564 Ga0496104_0323309
565 Ga0496111_0141155
566 Ga0496123_0080372
567 Ga0496124_0001393
568 Ga0496125_0191996
569 Ga0496126_0109965
570 Ga0501033_0149989
571 Ga0501034_0009952
572 Ga0501034_0052885
573 Ga0501034_0081928
574 Ga0501034_0249573
575 Ga0501039_0452796
576 Ga0501043_0409988
577 Ga0501047_0100698
578 Ga0501047_0208182
579 Ga0501075_0759511
580 Ga0501076_0264347
581 Ga0501080_0211131
582 Ga0501080_0277466
583 Ga0501083_0009063
584 Ga0501083_0405269
585 Ga0501044_0099357
586 nmdc:mga00v17_384889_c1
587 nmdc:mga04h51_18466_c1
588 nmdc:mga07m45_51104_c1
589 nmdc:mga05p37_103691_c1
590 nmdc:mga05p37_183657_c1
591 nmdc:mga05p37_622464_c1
592 nmdc:mga09592_124_c1
593 nmdc:mga09592_173186_c1
594 nmdc:mga09592_42815_c1
595 nmdc:mga0qj67_1294_c1
596 nmdc:mga06r32_1089_c1
597 nmdc:mga06r32_119960_c1
598 nmdc:mga06r32_22634_c1
599 nmdc:mga08y16_4847_c1
600 nmdc:mga0n895_263384_c1
601 nmdc:mga0n895_26939_c1
602 nmdc:mga0rr50_78237_c1
603 nmdc:mga08x19_322762_c1
604 nmdc:mga0a205_140715_c1
605 nmdc:mga0a205_148615_c1
606 nmdc:mga0a205_205583_c1
607 Ga0500604_0042044
608 Ga0501082_0055887
609 Ga0530510_0003147
610 2511375502
611 2513227123
612 2599623654
613 2599671727
614 2599681260
615 2599693337
616 2644327615
617 2644401481
618 2765586557
619 2819597208
620 2831266333
621 2838057555
622 2883359097
623 2885204456
624 2885218109
625 2899924712
626 2904548164
627 2928039161
628 2928045234
629 2928053039
630 2928064290
631 2928071727
632 2929163093

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

47

178

0.97

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

198

237

0.95

PF08534

Redoxin

Redoxin

46

196

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.972 3 210
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9706 3 210
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9673 3 210
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9611 3 210
5ykj-assembly1.cif.gz_A structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems 0.9445 3 207
ID Description Score Start End Superfamily
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9977 146 208 3.30.1020.10
af_I1KRJ7_151_218_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9847 146 207 3.30.1020.10
af_O08709_156_224_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9837 146 208 3.30.1020.10
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9741 146 207 3.30.1020.10
af_Q8IAM2_153_220_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9705 146 207 3.30.1020.10
ID Description Score Start End GO Terms
AF-A0A354QA58-F1-model_v4 Peroxidase 0.9807 137 210 GO:0051920
AF-A0A835YS60-F1-model_v4 Peroxiredoxin C-terminal domain-containing protein 0.9778 123 208 GO:0051920
AF-A0A3D2S068-F1-model_v4 Peroxidase 0.9718 1 106 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A519P2T9-F1-model_v4 deleted 0.971 117 211
AF-A0A659YRX5-F1-model_v4 deleted 0.9701 1 104

Map