F403667

General Info

Members Datasets Scaffolds Average Seq Length
316 170 632 250

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10110937|Ga0105237_101109373
Length 229
Sequence MQTFLSMFPIQASTHAAEVDHMTILVHWLMLVKGANPKASYTGAHGKFAKSTEVAVAVIEIGILIFYAIPAWATRVKAFPAESQAVVVRVVAEQFAWNVHYPGPDGKFGRTDIKLVSADNPLGLDRSDPNAKDDITTINQLNLPVDRPVLVHLSSKDVIHSFGLYEMRVKQDAVPGLDIPVWFIPNRIGDYEITCSQLCGLGHYRMRGFVNIRSQADYEKFLASGGQNP

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
127 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
128 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
129 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
130 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
131 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
132 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
133 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
134 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
135 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
136 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 5.38
Rhizosphere 94.3
Stem 0
Stem Tuber 0
Unclassified 16.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10110937 3300009545 Bacteria 2734
2 Ga0065714_10147026 3300005288 Bacteria 1117
3 Ga0065712_10142937 3300005290 Bacteria 1430
4 Ga0065715_10176386 3300005293 Bacteria 1508
5 Ga0065707_10045599 3300005295 Bacteria 1138
6 Ga0065707_10105703 3300005295 Unclassified 2632
7 Ga0070676_10005359 3300005328 Bacteria 6831
8 Ga0070690_100010063 3300005330 Bacteria 5490
9 Ga0070690_100346528 3300005330 Unclassified 1077
10 Ga0070670_100032321 3300005331 Bacteria 4507
11 Ga0070666_10087272 3300005335 Bacteria 2138
12 Ga0070666_10172321 3300005335 Bacteria 1516
13 Ga0070666_10230231 3300005335 Unclassified 1308
14 Ga0070680_100515138 3300005336 Bacteria 1024
15 Ga0070689_100069682 3300005340 Bacteria 2744
16 Ga0070689_100093909 3300005340 Bacteria 2368
17 Ga0070691_10001728 3300005341 Bacteria 9485
18 Ga0070687_100229439 3300005343 Unclassified 1142
19 Ga0070661_100629915 3300005344 Bacteria 869
20 Ga0070692_10105342 3300005345 Unclassified 1552
21 Ga0070668_100208239 3300005347 Bacteria 1608
22 Ga0070668_100208643 3300005347 Bacteria 1606
23 Ga0070669_100023632 3300005353 Bacteria 4402
24 Ga0070669_100031544 3300005353 Bacteria 3827
25 Ga0070669_100053128 3300005353 Bacteria 2965
26 Ga0070675_100298106 3300005354 Bacteria 1420
27 Ga0070674_100170957 3300005356 Bacteria 1657
28 Ga0070674_100373758 3300005356 Bacteria 1158
29 Ga0070673_100074187 3300005364 Bacteria 2741
30 Ga0070673_100125491 3300005364 Bacteria 2147
31 Ga0070673_100528049 3300005364 Bacteria 1070
32 Ga0070688_100029659 3300005365 Bacteria 3277
33 Ga0070688_100067596 3300005365 Bacteria 2277
34 Ga0070688_100173387 3300005365 Bacteria 1490
35 Ga0070667_100057160 3300005367 Unclassified 3296
36 Ga0070667_100135860 3300005367 Unclassified 2150
37 Ga0070667_100405111 3300005367 Unclassified 1242
38 Ga0070714_100016015 3300005435 Bacteria 6044
39 Ga0070701_10034778 3300005438 Bacteria 2526
40 Ga0070705_100016790 3300005440 Bacteria 3810
41 Ga0070705_100035361 3300005440 Unclassified 2800
42 Ga0070700_100010175 3300005441 Bacteria 5185
43 Ga0070694_100010066 3300005444 Bacteria 5815
44 Ga0070694_100350444 3300005444 Bacteria 1144
45 Ga0070678_100419909 3300005456 Bacteria 1166
46 Ga0070662_100117152 3300005457 Bacteria 2037
47 Ga0068867_100012807 3300005459 Bacteria 5934
48 Ga0068867_100051864 3300005459 Bacteria 3026
49 Ga0070685_10064369 3300005466 Bacteria 2156
50 Ga0070707_100121089 3300005468 Bacteria 2541
51 Ga0070698_100026990 3300005471 Bacteria 5972
52 Ga0070698_100055411 3300005471 Bacteria 4020
53 Ga0070699_100009880 3300005518 Bacteria 8263
54 Ga0070697_100030202 3300005536 Bacteria 4352
55 Ga0070697_100277982 3300005536 Unclassified 1436
56 Ga0070672_100016241 3300005543 Bacteria 5325
57 Ga0070686_100002486 3300005544 Bacteria 10150
58 Ga0070686_100235642 3300005544 Unclassified 1330
59 Ga0070686_100312770 3300005544 Bacteria 1168
60 Ga0070686_100378477 3300005544 Bacteria 1071
61 Ga0070695_100003699 3300005545 Bacteria 8913
62 Ga0070695_100013076 3300005545 Bacteria 4986
63 Ga0070695_100308722 3300005545 Bacteria 1172
64 Ga0070696_100026541 3300005546 Bacteria 3941
65 Ga0070665_100008701 3300005548 Bacteria 10272
66 Ga0070704_100010915 3300005549 Bacteria 5540
67 Ga0070704_100020400 3300005549 Bacteria 4272
68 Ga0070664_100315803 3300005564 Bacteria 1415
69 Ga0068854_100021646 3300005578 Bacteria 4365
70 Ga0068854_100059875 3300005578 Bacteria 2753
71 Ga0070702_100001638 3300005615 Bacteria 9276
72 Ga0068852_100163187 3300005616 Bacteria 2082
73 Ga0068859_100262972 3300005617 Bacteria 1817
74 Ga0068859_100457113 3300005617 Unclassified 1373
75 Ga0068864_100042832 3300005618 Bacteria 3874
76 Ga0068866_10203753 3300005718 Bacteria 1184
77 Ga0068861_100018796 3300005719 Bacteria 4927
78 Ga0068863_100079860 3300005841 Unclassified 3098
79 Ga0068863_100140616 3300005841 Unclassified 2307
80 Ga0068858_100021298 3300005842 Bacteria 6055
81 Ga0068858_100161492 3300005842 Unclassified 2110
82 Ga0068858_100170416 3300005842 Bacteria 2053
83 Ga0068858_100343546 3300005842 Bacteria 1429
84 Ga0068858_100418173 3300005842 Bacteria 1289
85 Ga0068860_100047666 3300005843 Bacteria 4083
86 Ga0068862_100106106 3300005844 Bacteria 2462
87 Ga0068862_100122167 3300005844 Bacteria 2296
88 Ga0081455_10234714 3300005937 Bacteria 1351
89 Ga0081539_10128447 3300005985 Bacteria 1248
90 Ga0081539_10165193 3300005985 Bacteria 1051
91 Ga0070716_100520446 3300006173 Bacteria 881
92 Ga0097621_100198513 3300006237 Bacteria 1740
93 Ga0097621_100240959 3300006237 Unclassified 1581
94 Ga0097621_100503943 3300006237 Bacteria 1097
95 Ga0068871_100021916 3300006358 Bacteria 4920
96 Ga0068871_100231266 3300006358 Unclassified 1604
97 Ga0068871_100609001 3300006358 Bacteria 994
98 Ga0075428_100116199 3300006844 Bacteria 2914
99 Ga0075433_10249075 3300006852 Bacteria 1576
100 Ga0075433_10264412 3300006852 Unclassified 1525
101 Ga0075434_100004066 3300006871 Bacteria 13112
102 Ga0075434_100108885 3300006871 Bacteria 2781
103 Ga0075434_100321138 3300006871 Bacteria 1569
104 Ga0068865_100342589 3300006881 Bacteria 1208
105 Ga0075436_100010413 3300006914 Bacteria 6374
106 Ga0075436_100064174 3300006914 Unclassified 2538
107 Ga0075436_100093342 3300006914 Bacteria 2092
108 Ga0097620_100262956 3300006931 Bacteria 1817
109 Ga0097620_100457130 3300006931 Unclassified 1373
110 Ga0075435_100001499 3300007076 Bacteria 14991
111 Ga0075435_100020280 3300007076 Bacteria 5090
112 Ga0075435_100116273 3300007076 Unclassified 2228
113 Ga0075435_100162675 3300007076 Bacteria 1880
114 Ga0105240_10042264 3300009093 Bacteria 5809
115 Ga0105240_10423646 3300009093 Unclassified 1495
116 Ga0111539_10026076 3300009094 Bacteria 7155
117 Ga0111539_10172376 3300009094 Bacteria 2528
118 Ga0111539_10390884 3300009094 Bacteria 1620
119 Ga0111539_10411923 3300009094 Bacteria 1574
120 Ga0105245_10044442 3300009098 Bacteria 3965
121 Ga0105247_10012411 3300009101 Bacteria 5117
122 Ga0114129_10001435 3300009147 Bacteria 32173
123 Ga0114129_10022782 3300009147 Bacteria 8880
124 Ga0114129_10045015 3300009147 Bacteria 6206
125 Ga0114129_10114829 3300009147 Bacteria 3712
126 Ga0114129_11120609 3300009147 Bacteria 984
127 Ga0105243_10009374 3300009148 Bacteria 7459
128 Ga0105243_10495634 3300009148 Bacteria 1156
129 Ga0105241_10037687 3300009174 Bacteria 3642
130 Ga0105242_10003751 3300009176 Bacteria 11808
131 Ga0105242_10017552 3300009176 Bacteria 5580
132 Ga0105248_10006216 3300009177 Bacteria 13093
133 Ga0105248_10018733 3300009177 Bacteria 7655
134 Ga0105248_10032706 3300009177 Bacteria 5809
135 Ga0105248_10064373 3300009177 Bacteria 4117
136 Ga0105248_10082101 3300009177 Bacteria 3623
137 Ga0105248_10085283 3300009177 Bacteria 3554
138 Ga0105248_10225859 3300009177 Bacteria 2107
139 Ga0105248_10302393 3300009177 Bacteria 1801
140 Ga0105248_11105938 3300009177 Bacteria 896
141 Ga0105238_10556656 3300009551 Unclassified 1151
142 Ga0157374_10054298 3300013296 Bacteria 3737
143 Ga0157378_10066721 3300013297 Bacteria 3223
144 Ga0157378_10499124 3300013297 Bacteria 1215
145 Ga0163162_10068005 3300013306 Bacteria 3613
146 Ga0163162_10310027 3300013306 Unclassified 1710
147 Ga0157375_10111312 3300013308 Bacteria 2837
148 Ga0157375_10165006 3300013308 Bacteria 2359
149 Ga0163163_10007871 3300014325 Bacteria 9417
150 Ga0157380_10046940 3300014326 Bacteria 3394
151 Ga0157380_10154068 3300014326 Unclassified 1990
152 Ga0157379_10008200 3300014968 Bacteria 9072
153 Ga0157379_10040273 3300014968 Bacteria 4169
154 Ga0157379_10112942 3300014968 Bacteria 2442
155 Ga0157376_10008296 3300014969 Bacteria 7487
156 Ga0157376_10022540 3300014969 Bacteria 4912
157 Ga0157376_10154395 3300014969 Unclassified 2074
158 Ga0207710_10030217 3300025900 Bacteria 2362
159 Ga0207688_10093072 3300025901 Bacteria 1733
160 Ga0207680_10344786 3300025903 Unclassified 1045
161 Ga0207645_10002542 3300025907 Bacteria 14280
162 Ga0207684_10352587 3300025910 Unclassified 1266
163 Ga0207654_10012257 3300025911 Bacteria 4389
164 Ga0207695_10062013 3300025913 Bacteria 3862
165 Ga0207695_10179197 3300025913 Bacteria 2040
166 Ga0207662_10003313 3300025918 Bacteria 8263
167 Ga0207662_10106906 3300025918 Unclassified 1740
168 Ga0207662_10233132 3300025918 Unclassified 1203
169 Ga0207646_10101300 3300025922 Bacteria 2582
170 Ga0207646_10138597 3300025922 Bacteria 2191
171 Ga0207681_10009213 3300025923 Bacteria 6033
172 Ga0207681_10013508 3300025923 Bacteria 5056
173 Ga0207681_10033473 3300025923 Bacteria 3370
174 Ga0207681_10128947 3300025923 Bacteria 1867
175 Ga0207659_10051058 3300025926 Bacteria 2939
176 Ga0207659_10165340 3300025926 Bacteria 1741
177 Ga0207687_10068617 3300025927 Bacteria 2526
178 Ga0207687_10095249 3300025927 Unclassified 2180
179 Ga0207700_10015627 3300025928 Bacteria 5015
180 Ga0207664_10026169 3300025929 Bacteria 4406
181 Ga0207644_10031442 3300025931 Bacteria 3698
182 Ga0207706_10123496 3300025933 Bacteria 2277
183 Ga0207686_10001967 3300025934 Bacteria 11329
184 Ga0207670_10031733 3300025936 Bacteria 3390
185 Ga0207670_10055732 3300025936 Bacteria 2673
186 Ga0207669_10090860 3300025937 Bacteria 1987
187 Ga0207669_10188614 3300025937 Bacteria 1485
188 Ga0207704_10025186 3300025938 Bacteria 3242
189 Ga0207665_10417880 3300025939 Bacteria 1024
190 Ga0207691_10027126 3300025940 Bacteria 5374
191 Ga0207711_10006556 3300025941 Bacteria 9803
192 Ga0207711_10019243 3300025941 Bacteria 5684
193 Ga0207711_10390848 3300025941 Unclassified 1291
194 Ga0207711_10768205 3300025941 Bacteria 898
195 Ga0207689_10333835 3300025942 Unclassified 1259
196 Ga0207661_10462392 3300025944 Bacteria 1157
197 Ga0207651_10045410 3300025960 Bacteria 2947
198 Ga0207651_10793860 3300025960 Bacteria 839
199 Ga0207668_10108571 3300025972 Unclassified 2077
200 Ga0207668_10190408 3300025972 Bacteria 1625
201 Ga0207640_10015460 3300025981 Bacteria 4418
202 Ga0207640_10110221 3300025981 Bacteria 1949
203 Ga0207640_10338540 3300025981 Bacteria 1204
204 Ga0207658_10188435 3300025986 Unclassified 1713
205 Ga0207658_10418285 3300025986 Bacteria 1181
206 Ga0207677_10100524 3300026023 Bacteria 2127
207 Ga0207677_10215835 3300026023 Unclassified 1535
208 Ga0207703_10024929 3300026035 Bacteria 4706
209 Ga0207703_10042300 3300026035 Bacteria 3654
210 Ga0207703_10133512 3300026035 Bacteria 2146
211 Ga0207708_10016993 3300026075 Bacteria 5477
212 Ga0207708_10067854 3300026075 Bacteria 2729
213 Ga0207641_10002008 3300026088 Bacteria 19393
214 Ga0207641_10112287 3300026088 Unclassified 2418
215 Ga0207648_10014508 3300026089 Bacteria 7276
216 Ga0207648_10194312 3300026089 Bacteria 1799
217 Ga0207648_10921823 3300026089 Bacteria 817
218 Ga0207676_10010218 3300026095 Bacteria 6678
219 Ga0207675_100030967 3300026118 Bacteria 4983
220 Ga0207675_100062022 3300026118 Bacteria 3491
221 Ga0207675_100807131 3300026118 Bacteria 952
222 Ga0207683_10408351 3300026121 Bacteria 1250
223 Ga0207698_10149347 3300026142 Bacteria 2026
224 Ga0207428_10080724 3300027907 Bacteria 2540
225 Ga0207428_10082549 3300027907 Bacteria 2508
226 Ga0207428_10198282 3300027907 Bacteria 1511
227 Ga0207428_10271916 3300027907 Bacteria 1259
228 Ga0207428_10281697 3300027907 Unclassified 1234
229 Ga0268266_10006329 3300028379 Bacteria 10851
230 Ga0268265_10017461 3300028380 Bacteria 4953
231 Ga0268265_10141814 3300028380 Bacteria 2013
232 Ga0268265_10562337 3300028380 Bacteria 1084
233 Ga0268265_10723128 3300028380 Bacteria 964
234 Ga0268264_10302214 3300028381 Bacteria 1507
235 Ga0268264_10487031 3300028381 Bacteria 1200
236 Ga0373948_0009697 3300034817 Unclassified 1666
237 Ga0373950_0000159 3300034818 Bacteria 9864
238 Ga0373958_0002198 3300034819 Bacteria 2708
239 Ga0373959_0000541 3300034820 Bacteria 6737
240 Ga0373938_0004149 3300034957 Bacteria 2402
241 Ga0373929_0001210 3300035085 Bacteria 4991
242 Ga0373949_0000697 3300035090 Bacteria 10925
243 Ga0373951_0001237 3300035091 Bacteria 6766
244 Ga0373952_0002397 3300035092 Bacteria 3376
245 Ga0373952_0034005 3300035092 Bacteria 1147
246 Ga0373932_0001647 3300035112 Bacteria 6119
247 Ga0373932_0030003 3300035112 Unclassified 1505
248 Ga0373939_0000518 3300035114 Bacteria 9713
249 Ga0373941_0000527 3300035115 Bacteria 7669
250 Ga0373954_0148795 3300035118 Bacteria 1144
251 Ga0373942_0004245 3300035207 Bacteria 3337
252 Ga0373961_0003053 3300035241 Bacteria 4213
253 Ga0373962_0001536 3300035242 Bacteria 5460
254 Ga0373962_0021443 3300035242 Unclassified 1705
255 Ga0373962_0038828 3300035242 Bacteria 1334
256 Ga0373931_0042912 3300035691 Bacteria 2379
257 Ga0373931_0178848 3300035691 Unclassified 1255
258 Ga0373925_0182805 3300037068 Bacteria 1661
259 Ga0395900_0370558 3300037418 Bacteria 1402
260 Ga0451576_0010034 3300045051 Bacteria 10906
261 Ga0451576_0869951 3300045051 Bacteria 946
262 Ga0495647_0011463 3300046681 Bacteria 3039
263 Ga0495669_0004209 3300046684 Bacteria 5923
264 Ga0495669_0030510 3300046684 Bacteria 2367
265 Ga0495649_0172835 3300046694 Bacteria 1130
266 Ga0496102_0372904 3300048905 Unclassified 1343
267 Ga0496104_0131588 3300048907 Bacteria 2403
268 Ga0496104_0410804 3300048907 Bacteria 1266
269 Ga0496106_0066523 3300048909 Bacteria 2745
270 Ga0496107_0405707 3300048910 Unclassified 1013
271 Ga0496108_0042050 3300048911 Bacteria 3814
272 Ga0496109_0591775 3300048912 Unclassified 1045
273 Ga0496110_0738247 3300048913 Bacteria 887
274 Ga0496111_0318976 3300048914 Bacteria 1151
275 Ga0496112_0009087 3300048915 Bacteria 8929
276 Ga0496112_0091143 3300048915 Bacteria 3017
277 Ga0496112_0196980 3300048915 Unclassified 1975
278 Ga0496112_0218191 3300048915 Unclassified 1864
279 Ga0496112_0837923 3300048915 Bacteria 843
280 Ga0496113_0164192 3300048916 Bacteria 1757
281 Ga0496114_0066540 3300048917 Bacteria 3021
282 Ga0496114_0119659 3300048917 Unclassified 2264
283 Ga0501076_0105008 3300049592 Bacteria 2280
284 nmdc:mga05p37_22585_c1 3300050507 Bacteria 7629
285 nmdc:mga05p37_252990_c1 3300050507 Archaea 2112
286 nmdc:mga05p37_46505_c1 3300050507 Bacteria 5336
287 nmdc:mga05p37_78239_c1 3300050507 Bacteria 4072
288 nmdc:mga05p37_9103_c1 3300050507 Bacteria 11737
289 nmdc:mga09592_75613_c1 3300050508 Bacteria 2863
290 nmdc:mga09592_80868_c1 3300050508 Bacteria 2767
291 nmdc:mga06r32_31557_c1 3300050510 Bacteria 4977
292 nmdc:mga08y16_209424_c1 3300050511 Unclassified 2019
293 nmdc:mga08y16_254144_c1 3300050511 Bacteria 1816
294 nmdc:mga08y16_377337_c1 3300050511 Unclassified 1454
295 nmdc:mga08y16_52037_c1 3300050511 Bacteria 4285
296 nmdc:mga08y16_6656_c1 3300050511 Bacteria 12122
297 nmdc:mga08y16_7157_c1 3300050511 Bacteria 11711
298 nmdc:mga0n895_28384_c1 3300050512 Bacteria 5322
299 nmdc:mga0n895_315166_c1 3300050512 Bacteria 1585
300 nmdc:mga0n895_859_c1 3300050512 Bacteria 21838
301 nmdc:mga0rr50_109_c1 3300050513 Bacteria 46163
302 nmdc:mga0rr50_35265_c1 3300050513 Bacteria 3591
303 nmdc:mga0rr50_44439_c1 3300050513 Bacteria 3258
304 nmdc:mga08x19_224_c1 3300050514 Bacteria 43344
305 nmdc:mga08x19_24050_c1 3300050514 Bacteria 3783
306 nmdc:mga08x19_419420_c1 3300050514 Bacteria 940
307 nmdc:mga08x19_92986_c1 3300050514 Bacteria 1993
308 nmdc:mga08x19_9879_c1 3300050514 Bacteria 5721
309 nmdc:mga0a205_216591_c1 3300050515 Bacteria 1802
310 nmdc:mga0a205_230728_c1 3300050515 Bacteria 1734
311 nmdc:mga0a205_2484_c1 3300050515 Bacteria 16260
312 nmdc:mga0a205_426044_c1 3300050515 Unclassified 1189
313 nmdc:mga0a205_437688_c1 3300050515 Bacteria 1168
314 nmdc:mga0a205_669338_c1 3300050515 Bacteria 889
315 Ga0495619_0212216 3300053085 Unclassified 1341
316 Ga0500658_0159037 3300053134 Bacteria 1022
317 Ga0105237_10110937
318 Ga0065714_10147026
319 Ga0065712_10142937
320 Ga0065715_10176386
321 Ga0065707_10045599
322 Ga0065707_10105703
323 Ga0070676_10005359
324 Ga0070690_100010063
325 Ga0070690_100346528
326 Ga0070670_100032321
327 Ga0070666_10087272
328 Ga0070666_10172321
329 Ga0070666_10230231
330 Ga0070680_100515138
331 Ga0070689_100069682
332 Ga0070689_100093909
333 Ga0070691_10001728
334 Ga0070687_100229439
335 Ga0070661_100629915
336 Ga0070692_10105342
337 Ga0070668_100208239
338 Ga0070668_100208643
339 Ga0070669_100023632
340 Ga0070669_100031544
341 Ga0070669_100053128
342 Ga0070675_100298106
343 Ga0070674_100170957
344 Ga0070674_100373758
345 Ga0070673_100074187
346 Ga0070673_100125491
347 Ga0070673_100528049
348 Ga0070688_100029659
349 Ga0070688_100067596
350 Ga0070688_100173387
351 Ga0070667_100057160
352 Ga0070667_100135860
353 Ga0070667_100405111
354 Ga0070714_100016015
355 Ga0070701_10034778
356 Ga0070705_100016790
357 Ga0070705_100035361
358 Ga0070700_100010175
359 Ga0070694_100010066
360 Ga0070694_100350444
361 Ga0070678_100419909
362 Ga0070662_100117152
363 Ga0068867_100012807
364 Ga0068867_100051864
365 Ga0070685_10064369
366 Ga0070707_100121089
367 Ga0070698_100026990
368 Ga0070698_100055411
369 Ga0070699_100009880
370 Ga0070697_100030202
371 Ga0070697_100277982
372 Ga0070672_100016241
373 Ga0070686_100002486
374 Ga0070686_100235642
375 Ga0070686_100312770
376 Ga0070686_100378477
377 Ga0070695_100003699
378 Ga0070695_100013076
379 Ga0070695_100308722
380 Ga0070696_100026541
381 Ga0070665_100008701
382 Ga0070704_100010915
383 Ga0070704_100020400
384 Ga0070664_100315803
385 Ga0068854_100021646
386 Ga0068854_100059875
387 Ga0070702_100001638
388 Ga0068852_100163187
389 Ga0068859_100262972
390 Ga0068859_100457113
391 Ga0068864_100042832
392 Ga0068866_10203753
393 Ga0068861_100018796
394 Ga0068863_100079860
395 Ga0068863_100140616
396 Ga0068858_100021298
397 Ga0068858_100161492
398 Ga0068858_100170416
399 Ga0068858_100343546
400 Ga0068858_100418173
401 Ga0068860_100047666
402 Ga0068862_100106106
403 Ga0068862_100122167
404 Ga0081455_10234714
405 Ga0081539_10128447
406 Ga0081539_10165193
407 Ga0070716_100520446
408 Ga0097621_100198513
409 Ga0097621_100240959
410 Ga0097621_100503943
411 Ga0068871_100021916
412 Ga0068871_100231266
413 Ga0068871_100609001
414 Ga0075428_100116199
415 Ga0075433_10249075
416 Ga0075433_10264412
417 Ga0075434_100004066
418 Ga0075434_100108885
419 Ga0075434_100321138
420 Ga0068865_100342589
421 Ga0075436_100010413
422 Ga0075436_100064174
423 Ga0075436_100093342
424 Ga0097620_100262956
425 Ga0097620_100457130
426 Ga0075435_100001499
427 Ga0075435_100020280
428 Ga0075435_100116273
429 Ga0075435_100162675
430 Ga0105240_10042264
431 Ga0105240_10423646
432 Ga0111539_10026076
433 Ga0111539_10172376
434 Ga0111539_10390884
435 Ga0111539_10411923
436 Ga0105245_10044442
437 Ga0105247_10012411
438 Ga0114129_10001435
439 Ga0114129_10022782
440 Ga0114129_10045015
441 Ga0114129_10114829
442 Ga0114129_11120609
443 Ga0105243_10009374
444 Ga0105243_10495634
445 Ga0105241_10037687
446 Ga0105242_10003751
447 Ga0105242_10017552
448 Ga0105248_10006216
449 Ga0105248_10018733
450 Ga0105248_10032706
451 Ga0105248_10064373
452 Ga0105248_10082101
453 Ga0105248_10085283
454 Ga0105248_10225859
455 Ga0105248_10302393
456 Ga0105248_11105938
457 Ga0105238_10556656
458 Ga0157374_10054298
459 Ga0157378_10066721
460 Ga0157378_10499124
461 Ga0163162_10068005
462 Ga0163162_10310027
463 Ga0157375_10111312
464 Ga0157375_10165006
465 Ga0163163_10007871
466 Ga0157380_10046940
467 Ga0157380_10154068
468 Ga0157379_10008200
469 Ga0157379_10040273
470 Ga0157379_10112942
471 Ga0157376_10008296
472 Ga0157376_10022540
473 Ga0157376_10154395
474 Ga0207710_10030217
475 Ga0207688_10093072
476 Ga0207680_10344786
477 Ga0207645_10002542
478 Ga0207684_10352587
479 Ga0207654_10012257
480 Ga0207695_10062013
481 Ga0207695_10179197
482 Ga0207662_10003313
483 Ga0207662_10106906
484 Ga0207662_10233132
485 Ga0207646_10101300
486 Ga0207646_10138597
487 Ga0207681_10009213
488 Ga0207681_10013508
489 Ga0207681_10033473
490 Ga0207681_10128947
491 Ga0207659_10051058
492 Ga0207659_10165340
493 Ga0207687_10068617
494 Ga0207687_10095249
495 Ga0207700_10015627
496 Ga0207664_10026169
497 Ga0207644_10031442
498 Ga0207706_10123496
499 Ga0207686_10001967
500 Ga0207670_10031733
501 Ga0207670_10055732
502 Ga0207669_10090860
503 Ga0207669_10188614
504 Ga0207704_10025186
505 Ga0207665_10417880
506 Ga0207691_10027126
507 Ga0207711_10006556
508 Ga0207711_10019243
509 Ga0207711_10390848
510 Ga0207711_10768205
511 Ga0207689_10333835
512 Ga0207661_10462392
513 Ga0207651_10045410
514 Ga0207651_10793860
515 Ga0207668_10108571
516 Ga0207668_10190408
517 Ga0207640_10015460
518 Ga0207640_10110221
519 Ga0207640_10338540
520 Ga0207658_10188435
521 Ga0207658_10418285
522 Ga0207677_10100524
523 Ga0207677_10215835
524 Ga0207703_10024929
525 Ga0207703_10042300
526 Ga0207703_10133512
527 Ga0207708_10016993
528 Ga0207708_10067854
529 Ga0207641_10002008
530 Ga0207641_10112287
531 Ga0207648_10014508
532 Ga0207648_10194312
533 Ga0207648_10921823
534 Ga0207676_10010218
535 Ga0207675_100030967
536 Ga0207675_100062022
537 Ga0207675_100807131
538 Ga0207683_10408351
539 Ga0207698_10149347
540 Ga0207428_10080724
541 Ga0207428_10082549
542 Ga0207428_10198282
543 Ga0207428_10271916
544 Ga0207428_10281697
545 Ga0268266_10006329
546 Ga0268265_10017461
547 Ga0268265_10141814
548 Ga0268265_10562337
549 Ga0268265_10723128
550 Ga0268264_10302214
551 Ga0268264_10487031
552 Ga0373948_0009697
553 Ga0373950_0000159
554 Ga0373958_0002198
555 Ga0373959_0000541
556 Ga0373938_0004149
557 Ga0373929_0001210
558 Ga0373949_0000697
559 Ga0373951_0001237
560 Ga0373952_0002397
561 Ga0373952_0034005
562 Ga0373932_0001647
563 Ga0373932_0030003
564 Ga0373939_0000518
565 Ga0373941_0000527
566 Ga0373954_0148795
567 Ga0373942_0004245
568 Ga0373961_0003053
569 Ga0373962_0001536
570 Ga0373962_0021443
571 Ga0373962_0038828
572 Ga0373931_0042912
573 Ga0373931_0178848
574 Ga0373925_0182805
575 Ga0395900_0370558
576 Ga0451576_0010034
577 Ga0451576_0869951
578 Ga0495647_0011463
579 Ga0495669_0004209
580 Ga0495669_0030510
581 Ga0495649_0172835
582 Ga0496102_0372904
583 Ga0496104_0131588
584 Ga0496104_0410804
585 Ga0496106_0066523
586 Ga0496107_0405707
587 Ga0496108_0042050
588 Ga0496109_0591775
589 Ga0496110_0738247
590 Ga0496111_0318976
591 Ga0496112_0009087
592 Ga0496112_0091143
593 Ga0496112_0196980
594 Ga0496112_0218191
595 Ga0496112_0837923
596 Ga0496113_0164192
597 Ga0496114_0066540
598 Ga0496114_0119659
599 Ga0501076_0105008
600 nmdc:mga05p37_22585_c1
601 nmdc:mga05p37_252990_c1
602 nmdc:mga05p37_46505_c1
603 nmdc:mga05p37_78239_c1
604 nmdc:mga05p37_9103_c1
605 nmdc:mga09592_75613_c1
606 nmdc:mga09592_80868_c1
607 nmdc:mga06r32_31557_c1
608 nmdc:mga08y16_209424_c1
609 nmdc:mga08y16_254144_c1
610 nmdc:mga08y16_377337_c1
611 nmdc:mga08y16_52037_c1
612 nmdc:mga08y16_6656_c1
613 nmdc:mga08y16_7157_c1
614 nmdc:mga0n895_28384_c1
615 nmdc:mga0n895_315166_c1
616 nmdc:mga0n895_859_c1
617 nmdc:mga0rr50_109_c1
618 nmdc:mga0rr50_35265_c1
619 nmdc:mga0rr50_44439_c1
620 nmdc:mga08x19_224_c1
621 nmdc:mga08x19_24050_c1
622 nmdc:mga08x19_419420_c1
623 nmdc:mga08x19_92986_c1
624 nmdc:mga08x19_9879_c1
625 nmdc:mga0a205_216591_c1
626 nmdc:mga0a205_230728_c1
627 nmdc:mga0a205_2484_c1
628 nmdc:mga0a205_426044_c1
629 nmdc:mga0a205_437688_c1
630 nmdc:mga0a205_669338_c1
631 Ga0495619_0212216
632 Ga0500658_0159037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

86

212

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cua-assembly2.cif.gz_B the cua domain of cytochrome ba3 from thermus thermophilus 0.9216 149 224
2cua-assembly1.cif.gz_A the cua domain of cytochrome ba3 from thermus thermophilus 0.9173 149 224
6pty-assembly2.cif.gz_B soluble model of human cua (tt3lh) 0.9154 149 224
8gym-assembly1.cif.gz_c2 cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.9066 150 233
6ptt-assembly2.cif.gz_B soluble model of arabidopsis thaliana cua (tt3lat) 0.9064 149 224
ID Description Score Start End Superfamily
2yevE02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9317 95 234 2.60.40.420
af_Q8I6V2_60_165_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9172 150 230 2.60.40.420
af_A0A1D6ED90_406_498_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9157 150 231 2.60.40.420
5u7nF00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9056 149 224 2.60.40.420
af_Q2FZJ9_108_266_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8999 87 234 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A7C2EVG6-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9446 90 227 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A7C7WHT2-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9433 65 239 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A523LR61-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9414 99 239 GO:0004129
GO:0005507
GO:0016020
AF-A0A2G4EVY8-F1-model_v4 Cytochrome c oxidase subunit 2 (EC 7.1.1.9) 0.9395 96 238 GO:0004129
GO:0005507
GO:0005886
GO:0042773
AF-A0A7W1TTH5-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9295 76 235 GO:0004129
GO:0005507
GO:0016020
GO:0042773

Map