F403598
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 316 | 188 | 306 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300005985|Ga0081539_10028445|Ga0081539_100284454 |
| Length | 242 |
| Sequence | MLYVPGGAHYIKGICPNTTGRPMLFSRKKLEMPTPETALKGRAEPIPTAKSHFLNKRALKGPYPDGLETAIFGLGCFWGAERKFWEIGDGIWVTAVGYAGGGTPNPTYEEVCSGRTGHNEVVLVVFDPKKVSYEELLKTFWESHDPTQGMRQGNDVGTQYRSGIYAFSPAQRAAAEASKAAYQKVLAANGYGPITTEILDAPPFYFAEDYHQQYLAKVPHGYCGLGGTGLSCPVGVGVKAGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 2 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 3 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 4 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 5 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 6 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 7 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 8 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 9 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 42 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 43 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 44 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 45 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 46 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 47 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 92 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 95 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 96 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 97 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 98 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 99 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 100 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 101 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 102 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 103 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 104 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 105 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 106 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 107 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 109 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 110 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 111 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 112 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 113 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 114 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 120 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 121 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 122 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 123 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 124 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 125 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 126 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 127 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 128 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 129 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 130 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 131 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 132 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 133 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 134 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 135 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 136 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 165 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 166 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 167 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 168 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 181 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 182 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 183 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 184 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 187 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 188 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.57 |
| Metatranscriptomes | 1.27 |
| Isolates | 3.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.38 |
| Nodule | 0.95 |
| Rhizoplane | 10.76 |
| Rhizosphere | 80.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25405J52794_10029314 | 3300003911 | Bacteria | 1138 |
| 2 | Ga0070676_10206780 | 3300005328 | Bacteria | 1289 |
| 3 | Ga0070690_100209876 | 3300005330 | Bacteria | 1359 |
| 4 | Ga0068869_100135815 | 3300005334 | Bacteria | 1895 |
| 5 | Ga0068869_100525546 | 3300005334 | Bacteria | 991 |
| 6 | Ga0070680_100005401 | 3300005336 | Bacteria | 9673 |
| 7 | Ga0070680_100011093 | 3300005336 | Bacteria | 6965 |
| 8 | Ga0070691_10014062 | 3300005341 | Bacteria | 3670 |
| 9 | Ga0070668_100025461 | 3300005347 | Bacteria | 4485 |
| 10 | Ga0070668_100223558 | 3300005347 | Bacteria | 1554 |
| 11 | Ga0070669_100146726 | 3300005353 | Bacteria | 1824 |
| 12 | Ga0070659_100363727 | 3300005366 | Bacteria | 1216 |
| 13 | Ga0070703_10140104 | 3300005406 | Bacteria | 898 |
| 14 | Ga0070701_10002688 | 3300005438 | Bacteria | 6895 |
| 15 | Ga0070705_100000110 | 3300005440 | Bacteria | 46763 |
| 16 | Ga0070705_100013550 | 3300005440 | Bacteria | 4174 |
| 17 | Ga0070700_100005181 | 3300005441 | Bacteria | 6887 |
| 18 | Ga0070700_100008573 | 3300005441 | Bacteria | 5568 |
| 19 | Ga0070694_100000271 | 3300005444 | Bacteria | 27422 |
| 20 | Ga0070708_100053259 | 3300005445 | Bacteria | 3590 |
| 21 | Ga0070663_100013406 | 3300005455 | Bacteria | 5227 |
| 22 | Ga0070681_10011531 | 3300005458 | Bacteria | 8749 |
| 23 | Ga0070706_100033816 | 3300005467 | Bacteria | 4720 |
| 24 | Ga0070699_100000653 | 3300005518 | Bacteria | 32414 |
| 25 | Ga0070697_100710686 | 3300005536 | Bacteria | 887 |
| 26 | Ga0070672_100023540 | 3300005543 | Bacteria | 4542 |
| 27 | Ga0070695_100001347 | 3300005545 | Bacteria | 13614 |
| 28 | Ga0070696_100000720 | 3300005546 | Bacteria | 21146 |
| 29 | Ga0070696_100319762 | 3300005546 | Bacteria | 1194 |
| 30 | Ga0070693_100049499 | 3300005547 | Bacteria | 2398 |
| 31 | Ga0070704_100002027 | 3300005549 | Bacteria | 11229 |
| 32 | Ga0068857_100124753 | 3300005577 | Bacteria | 2320 |
| 33 | Ga0070702_100110123 | 3300005615 | Bacteria | 1706 |
| 34 | Ga0068859_100000897 | 3300005617 | Bacteria | 30326 |
| 35 | Ga0068861_100192336 | 3300005719 | Bacteria | 1707 |
| 36 | Ga0068863_100118892 | 3300005841 | Bacteria | 2519 |
| 37 | Ga0068863_100120516 | 3300005841 | Bacteria | 2501 |
| 38 | Ga0068860_100160042 | 3300005843 | Bacteria | 2171 |
| 39 | Ga0068862_100084776 | 3300005844 | Bacteria | 2753 |
| 40 | Ga0081455_10001600 | 3300005937 | Bacteria | 27663 |
| 41 | Ga0081540_1002271 | 3300005983 | Bacteria | 15795 |
| 42 | Ga0081540_1040628 | 3300005983 | Bacteria | 2422 |
| 43 | Ga0081540_1121463 | 3300005983 | Bacteria | 1083 |
| 44 | Ga0081539_10028445 | 3300005985 | Bacteria | 3515 |
| 45 | Ga0075368_10023161 | 3300006042 | Bacteria | 2369 |
| 46 | Ga0075363_100003600 | 3300006048 | Bacteria | 6633 |
| 47 | Ga0075364_10024925 | 3300006051 | Bacteria | 3803 |
| 48 | Ga0075367_10009204 | 3300006178 | Bacteria | 5153 |
| 49 | Ga0075367_10019901 | 3300006178 | Bacteria | 3729 |
| 50 | Ga0075367_10077317 | 3300006178 | Bacteria | 2009 |
| 51 | Ga0075428_100094957 | 3300006844 | Bacteria | 3250 |
| 52 | Ga0075428_100250628 | 3300006844 | Bacteria | 1908 |
| 53 | Ga0075428_100503397 | 3300006844 | Bacteria | 1296 |
| 54 | Ga0075428_100581689 | 3300006844 | Bacteria | 1196 |
| 55 | Ga0075430_100001086 | 3300006846 | Bacteria | 21581 |
| 56 | Ga0075430_100003847 | 3300006846 | Bacteria | 12638 |
| 57 | Ga0075430_100292259 | 3300006846 | Bacteria | 1348 |
| 58 | Ga0075431_100001007 | 3300006847 | Bacteria | 25062 |
| 59 | Ga0075431_100003740 | 3300006847 | Bacteria | 14780 |
| 60 | Ga0075431_100289633 | 3300006847 | Bacteria | 1657 |
| 61 | Ga0075433_10014493 | 3300006852 | Bacteria | 6442 |
| 62 | Ga0075433_10120378 | 3300006852 | Bacteria | 2330 |
| 63 | Ga0075433_10173900 | 3300006852 | Bacteria | 1916 |
| 64 | Ga0075433_10287343 | 3300006852 | Bacteria | 1457 |
| 65 | Ga0075434_100002734 | 3300006871 | Bacteria | 15582 |
| 66 | Ga0075434_100188992 | 3300006871 | Bacteria | 2080 |
| 67 | Ga0075429_100033729 | 3300006880 | Bacteria | 4448 |
| 68 | Ga0075429_100143811 | 3300006880 | Bacteria | 2088 |
| 69 | Ga0075429_100257420 | 3300006880 | Bacteria | 1528 |
| 70 | Ga0075436_100115023 | 3300006914 | Bacteria | 1879 |
| 71 | Ga0097620_100000897 | 3300006931 | Bacteria | 30326 |
| 72 | Ga0075435_100006275 | 3300007076 | Bacteria | 8392 |
| 73 | Ga0075435_100038567 | 3300007076 | Bacteria | 3809 |
| 74 | Ga0075435_100363360 | 3300007076 | Bacteria | 1242 |
| 75 | Ga0111539_10006991 | 3300009094 | Bacteria | 14476 |
| 76 | Ga0111539_10033078 | 3300009094 | Bacteria | 6278 |
| 77 | Ga0111539_10202437 | 3300009094 | Bacteria | 2315 |
| 78 | Ga0111539_10323600 | 3300009094 | Bacteria | 1794 |
| 79 | Ga0111539_10615922 | 3300009094 | Bacteria | 1264 |
| 80 | Ga0111539_10646200 | 3300009094 | Bacteria | 1232 |
| 81 | Ga0105245_10032391 | 3300009098 | Bacteria | 4627 |
| 82 | Ga0105245_10841468 | 3300009098 | Bacteria | 957 |
| 83 | Ga0105247_10274473 | 3300009101 | Bacteria | 1161 |
| 84 | Ga0114129_10038575 | 3300009147 | Bacteria | 6737 |
| 85 | Ga0114129_10090617 | 3300009147 | Bacteria | 4238 |
| 86 | Ga0114129_10195539 | 3300009147 | Bacteria | 2743 |
| 87 | Ga0114129_10241153 | 3300009147 | Bacteria | 2430 |
| 88 | Ga0105246_10031744 | 3300011119 | Bacteria | 3497 |
| 89 | Ga0163162_10168103 | 3300013306 | Bacteria | 2317 |
| 90 | Ga0157375_10401809 | 3300013308 | Bacteria | 1537 |
| 91 | Ga0157380_11033599 | 3300014326 | Bacteria | 857 |
| 92 | Ga0157379_10064957 | 3300014968 | Bacteria | 3261 |
| 93 | Ga0197907_11021076 | 3300020069 | Bacteria | 1288 |
| 94 | Ga0206356_11007371 | 3300020070 | Bacteria | 2245 |
| 95 | Ga0206354_10406870 | 3300020081 | Bacteria | 9875 |
| 96 | Ga0206353_10284142 | 3300020082 | Bacteria | 2344 |
| 97 | Ga0207653_10002066 | 3300025885 | Bacteria | 6396 |
| 98 | Ga0207710_10132148 | 3300025900 | Bacteria | 1199 |
| 99 | Ga0207705_10007752 | 3300025909 | Bacteria | 7888 |
| 100 | Ga0207684_10078056 | 3300025910 | Bacteria | 2816 |
| 101 | Ga0207707_10006735 | 3300025912 | Bacteria | 10030 |
| 102 | Ga0207707_10050044 | 3300025912 | Bacteria | 3641 |
| 103 | Ga0207660_10004218 | 3300025917 | Bacteria | 9361 |
| 104 | Ga0207660_10008002 | 3300025917 | Bacteria | 6833 |
| 105 | Ga0207652_10003668 | 3300025921 | Bacteria | 12635 |
| 106 | Ga0207652_10116264 | 3300025921 | Bacteria | 2376 |
| 107 | Ga0207681_10129313 | 3300025923 | Bacteria | 1865 |
| 108 | Ga0207659_10262083 | 3300025926 | Bacteria | 1407 |
| 109 | Ga0207687_10041635 | 3300025927 | Bacteria | 3155 |
| 110 | Ga0207691_10033468 | 3300025940 | Bacteria | 4785 |
| 111 | Ga0207689_10154039 | 3300025942 | Bacteria | 1895 |
| 112 | Ga0207679_10337396 | 3300025945 | Bacteria | 1310 |
| 113 | Ga0207712_10011557 | 3300025961 | Bacteria | 5628 |
| 114 | Ga0207668_10405187 | 3300025972 | Bacteria | 1154 |
| 115 | Ga0207668_10469522 | 3300025972 | Bacteria | 1077 |
| 116 | Ga0207703_10276280 | 3300026035 | Bacteria | 1524 |
| 117 | Ga0207708_10004787 | 3300026075 | Bacteria | 9967 |
| 118 | Ga0207708_10022899 | 3300026075 | Bacteria | 4719 |
| 119 | Ga0207641_10104109 | 3300026088 | Bacteria | 2505 |
| 120 | Ga0207674_10002699 | 3300026116 | Bacteria | 22159 |
| 121 | Ga0207675_100187365 | 3300026118 | Bacteria | 1984 |
| 122 | Ga0207675_100248595 | 3300026118 | Bacteria | 1721 |
| 123 | Ga0209813_10014000 | 3300027866 | Bacteria | 2152 |
| 124 | Ga0207428_10146528 | 3300027907 | Bacteria | 1799 |
| 125 | Ga0268265_10000395 | 3300028380 | Bacteria | 46647 |
| 126 | Ga0268265_10010728 | 3300028380 | Bacteria | 6186 |
| 127 | Ga0268264_10014161 | 3300028381 | Bacteria | 6559 |
| 128 | Ga0265327_10003157 | 3300031251 | Bacteria | 16162 |
| 129 | Ga0316575_10006417 | 3300031665 | Bacteria | 4227 |
| 130 | Ga0316579_10008355 | 3300031691 | Bacteria | 4313 |
| 131 | Ga0316579_10130079 | 3300031691 | Bacteria | 1212 |
| 132 | Ga0316576_10019615 | 3300031727 | Bacteria | 4634 |
| 133 | Ga0307410_10795503 | 3300031852 | Bacteria | 804 |
| 134 | Ga0307409_100672064 | 3300031995 | Bacteria | 1032 |
| 135 | Ga0373958_0015788 | 3300034819 | Bacteria | 1339 |
| 136 | Ga0373952_0012524 | 3300035092 | Bacteria | 1670 |
| 137 | Ga0373939_0054500 | 3300035114 | Bacteria | 1253 |
| 138 | Ga0373961_0004287 | 3300035241 | Bacteria | 3453 |
| 139 | Ga0373962_0120489 | 3300035242 | Bacteria | 836 |
| 140 | Ga0373931_0005278 | 3300035691 | Bacteria | 5956 |
| 141 | Ga0373931_0134939 | 3300035691 | Bacteria | 1424 |
| 142 | Ga0373931_0241362 | 3300035691 | Bacteria | 1095 |
| 143 | Ga0373927_0553193 | 3300035695 | Bacteria | 760 |
| 144 | Ga0373937_0232264 | 3300036401 | Bacteria | 1737 |
| 145 | Ga0373937_0420246 | 3300036401 | Bacteria | 1269 |
| 146 | Ga0316582_0298083 | 3300036647 | Bacteria | 1107 |
| 147 | Ga0316584_0005609 | 3300036712 | Bacteria | 8448 |
| 148 | Ga0395900_0806980 | 3300037418 | Bacteria | 866 |
| 149 | Ga0436365_1230432 | 3300039437 | Bacteria | 938 |
| 150 | Ga0439450_012184 | 3300042008 | Bacteria | 1702 |
| 151 | Ga0466959_0699001 | 3300045049 | Bacteria | 680 |
| 152 | Ga0495603_0208455 | 3300046455 | Bacteria | 1129 |
| 153 | Ga0495648_0035469 | 3300046524 | Bacteria | 3233 |
| 154 | Ga0495652_0361004 | 3300046529 | Bacteria | 1038 |
| 155 | Ga0495635_0182142 | 3300046663 | Bacteria | 1428 |
| 156 | Ga0495680_0129282 | 3300047322 | Bacteria | 1857 |
| 157 | Ga0496101_0200844 | 3300048904 | Bacteria | 1541 |
| 158 | Ga0496101_0349859 | 3300048904 | Bacteria | 1161 |
| 159 | Ga0496102_0004952 | 3300048905 | Bacteria | 11280 |
| 160 | Ga0496102_0072925 | 3300048905 | Bacteria | 3156 |
| 161 | Ga0496102_0156168 | 3300048905 | Bacteria | 2145 |
| 162 | Ga0496103_0035266 | 3300048906 | Bacteria | 3062 |
| 163 | Ga0496104_0006775 | 3300048907 | Bacteria | 10091 |
| 164 | Ga0496104_0008027 | 3300048907 | Bacteria | 9361 |
| 165 | Ga0496105_0051098 | 3300048908 | Bacteria | 3416 |
| 166 | Ga0496105_0063554 | 3300048908 | Bacteria | 3045 |
| 167 | Ga0496105_0659605 | 3300048908 | Bacteria | 806 |
| 168 | Ga0496106_0013644 | 3300048909 | Bacteria | 5998 |
| 169 | Ga0496106_0014063 | 3300048909 | Bacteria | 5913 |
| 170 | Ga0496106_0224131 | 3300048909 | Bacteria | 1500 |
| 171 | Ga0496107_0003141 | 3300048910 | Bacteria | 10984 |
| 172 | Ga0496107_0020554 | 3300048910 | Bacteria | 4665 |
| 173 | Ga0496108_0005291 | 3300048911 | Bacteria | 10416 |
| 174 | Ga0496108_0264703 | 3300048911 | Bacteria | 1496 |
| 175 | Ga0496109_0028757 | 3300048912 | Bacteria | 4976 |
| 176 | Ga0496109_0062342 | 3300048912 | Bacteria | 3409 |
| 177 | Ga0496109_0071193 | 3300048912 | Bacteria | 3192 |
| 178 | Ga0496110_0060879 | 3300048913 | Bacteria | 3331 |
| 179 | Ga0496110_0075854 | 3300048913 | Bacteria | 2988 |
| 180 | Ga0496110_0570954 | 3300048913 | Bacteria | 1027 |
| 181 | Ga0496111_0020116 | 3300048914 | Bacteria | 4643 |
| 182 | Ga0496111_0031626 | 3300048914 | Bacteria | 3771 |
| 183 | Ga0496111_0617978 | 3300048914 | Bacteria | 792 |
| 184 | Ga0496112_0096255 | 3300048915 | Bacteria | 2931 |
| 185 | Ga0496112_0309977 | 3300048915 | Bacteria | 1523 |
| 186 | Ga0496113_0006375 | 3300048916 | Bacteria | 7468 |
| 187 | Ga0496113_0097265 | 3300048916 | Bacteria | 2277 |
| 188 | Ga0496113_0219010 | 3300048916 | Bacteria | 1517 |
| 189 | Ga0496114_0255447 | 3300048917 | Bacteria | 1542 |
| 190 | Ga0496115_0073867 | 3300048918 | Bacteria | 2768 |
| 191 | Ga0496121_0007595 | 3300048924 | Bacteria | 13052 |
| 192 | Ga0496126_0083444 | 3300048929 | Bacteria | 2820 |
| 193 | Ga0501031_0134838 | 3300049568 | Bacteria | 1613 |
| 194 | Ga0501033_0096491 | 3300049570 | Bacteria | 2160 |
| 195 | Ga0501034_0031238 | 3300049571 | Bacteria | 5411 |
| 196 | Ga0501034_0075989 | 3300049571 | Bacteria | 3366 |
| 197 | Ga0501036_0129631 | 3300049572 | Bacteria | 2130 |
| 198 | Ga0501036_0316621 | 3300049572 | Bacteria | 1304 |
| 199 | Ga0501036_0419213 | 3300049572 | Bacteria | 1116 |
| 200 | Ga0501036_0829028 | 3300049572 | Bacteria | 761 |
| 201 | Ga0501037_0342717 | 3300049573 | Bacteria | 1032 |
| 202 | Ga0501039_0078821 | 3300049575 | Bacteria | 2563 |
| 203 | Ga0501039_0222771 | 3300049575 | Bacteria | 1483 |
| 204 | Ga0501039_0408474 | 3300049575 | Bacteria | 1066 |
| 205 | Ga0501040_0197462 | 3300049576 | Bacteria | 1428 |
| 206 | Ga0501040_0354451 | 3300049576 | Bacteria | 1051 |
| 207 | Ga0501041_0033691 | 3300049577 | Bacteria | 3100 |
| 208 | Ga0501041_0060622 | 3300049577 | Bacteria | 2316 |
| 209 | Ga0501041_0209276 | 3300049577 | Bacteria | 1223 |
| 210 | Ga0501042_0139813 | 3300049578 | Bacteria | 1746 |
| 211 | Ga0501042_0214694 | 3300049578 | Bacteria | 1388 |
| 212 | Ga0501046_0050039 | 3300049580 | Bacteria | 3302 |
| 213 | Ga0501046_0107062 | 3300049580 | Bacteria | 2139 |
| 214 | Ga0501046_0241873 | 3300049580 | Bacteria | 1331 |
| 215 | Ga0501047_0013713 | 3300049581 | Bacteria | 7694 |
| 216 | Ga0501047_0080281 | 3300049581 | Bacteria | 3135 |
| 217 | Ga0501047_0191530 | 3300049581 | Bacteria | 1908 |
| 218 | Ga0501047_0231376 | 3300049581 | Bacteria | 1702 |
| 219 | Ga0501048_0011117 | 3300049582 | Bacteria | 6711 |
| 220 | Ga0501067_0015374 | 3300049583 | Bacteria | 4237 |
| 221 | Ga0501067_0072485 | 3300049583 | Bacteria | 1908 |
| 222 | Ga0501070_0050738 | 3300049586 | Bacteria | 3444 |
| 223 | Ga0501070_0202656 | 3300049586 | Bacteria | 1629 |
| 224 | Ga0501070_0528354 | 3300049586 | Bacteria | 946 |
| 225 | Ga0501071_0058608 | 3300049587 | Bacteria | 2785 |
| 226 | Ga0501072_0219047 | 3300049588 | Bacteria | 1517 |
| 227 | Ga0501073_0030530 | 3300049589 | Bacteria | 3848 |
| 228 | Ga0501074_0278363 | 3300049590 | Bacteria | 1190 |
| 229 | Ga0501074_0713061 | 3300049590 | Bacteria | 708 |
| 230 | Ga0501075_0017149 | 3300049591 | Bacteria | 5227 |
| 231 | Ga0501075_0502285 | 3300049591 | Bacteria | 925 |
| 232 | Ga0501076_0084534 | 3300049592 | Bacteria | 2549 |
| 233 | Ga0501077_0043060 | 3300049593 | Bacteria | 2869 |
| 234 | Ga0501077_0043383 | 3300049593 | Bacteria | 2859 |
| 235 | Ga0501077_0121276 | 3300049593 | Bacteria | 1657 |
| 236 | Ga0501079_0087883 | 3300049741 | Bacteria | 2406 |
| 237 | Ga0501079_0089215 | 3300049741 | Bacteria | 2388 |
| 238 | Ga0501079_0242577 | 3300049741 | Bacteria | 1408 |
| 239 | Ga0501080_0133762 | 3300049742 | Bacteria | 2295 |
| 240 | Ga0501080_0378009 | 3300049742 | Bacteria | 1277 |
| 241 | Ga0501081_0010949 | 3300049743 | Bacteria | 5927 |
| 242 | Ga0501081_0058620 | 3300049743 | Bacteria | 2665 |
| 243 | Ga0501081_0406827 | 3300049743 | Bacteria | 1008 |
| 244 | Ga0501081_0495616 | 3300049743 | Bacteria | 910 |
| 245 | Ga0501083_0380086 | 3300049744 | Bacteria | 918 |
| 246 | Ga0501035_0053845 | 3300049822 | Bacteria | 3597 |
| 247 | Ga0501035_0116360 | 3300049822 | Bacteria | 2339 |
| 248 | Ga0501044_0016875 | 3300049823 | Bacteria | 7834 |
| 249 | Ga0501044_0106424 | 3300049823 | Bacteria | 2817 |
| 250 | Ga0501044_0168752 | 3300049823 | Bacteria | 2161 |
| 251 | Ga0501044_0219996 | 3300049823 | Bacteria | 1850 |
| 252 | Ga0501045_0089336 | 3300049824 | Bacteria | 2276 |
| 253 | Ga0501045_0539878 | 3300049824 | Bacteria | 865 |
| 254 | nmdc:mga03n38_17105_c1 | 3300050490 | Bacteria | 2833 |
| 255 | nmdc:mga00v17_8619_c1 | 3300050491 | Bacteria | 5491 |
| 256 | nmdc:mga06z11_12730_c1 | 3300050494 | Bacteria | 3668 |
| 257 | nmdc:mga06z11_1992_c1 | 3300050494 | Bacteria | 7729 |
| 258 | nmdc:mga04h51_43278_c1 | 3300050495 | Bacteria | 1481 |
| 259 | nmdc:mga04h51_5597_c1 | 3300050495 | Bacteria | 3209 |
| 260 | nmdc:mga05p37_179825_c1 | 3300050507 | Bacteria | 2574 |
| 261 | nmdc:mga05p37_197996_c1 | 3300050507 | Bacteria | 2435 |
| 262 | nmdc:mga05p37_226937_c1 | 3300050507 | Bacteria | 2251 |
| 263 | nmdc:mga05p37_260352_c1 | 3300050507 | Bacteria | 2076 |
| 264 | nmdc:mga09592_21943_c1 | 3300050508 | Bacteria | 5266 |
| 265 | nmdc:mga09592_438015_c1 | 3300050508 | Bacteria | 1128 |
| 266 | nmdc:mga09592_682438_c1 | 3300050508 | Bacteria | 875 |
| 267 | nmdc:mga09592_95076_c1 | 3300050508 | Bacteria | 2549 |
| 268 | nmdc:mga0qj67_10579_c1 | 3300050509 | Bacteria | 6891 |
| 269 | nmdc:mga0qj67_293_c1 | 3300050509 | Bacteria | 34938 |
| 270 | nmdc:mga0qj67_416871_c1 | 3300050509 | Bacteria | 1083 |
| 271 | nmdc:mga0qj67_71578_c1 | 3300050509 | Bacteria | 2768 |
| 272 | nmdc:mga0qj67_93295_c1 | 3300050509 | Bacteria | 2420 |
| 273 | nmdc:mga06r32_173124_c1 | 3300050510 | Bacteria | 2143 |
| 274 | nmdc:mga06r32_175566_c1 | 3300050510 | Bacteria | 2127 |
| 275 | nmdc:mga06r32_24317_c1 | 3300050510 | Bacteria | 5621 |
| 276 | nmdc:mga06r32_533531_c1 | 3300050510 | Bacteria | 1149 |
| 277 | nmdc:mga06r32_555093_c1 | 3300050510 | Bacteria | 1122 |
| 278 | nmdc:mga06r32_7918_c1 | 3300050510 | Bacteria | 9554 |
| 279 | nmdc:mga08y16_121960_c1 | 3300050511 | Bacteria | 2713 |
| 280 | nmdc:mga08y16_183082_c1 | 3300050511 | Bacteria | 2174 |
| 281 | nmdc:mga08y16_446791_c1 | 3300050511 | Bacteria | 1319 |
| 282 | nmdc:mga08y16_99217_c1 | 3300050511 | Bacteria | 3032 |
| 283 | nmdc:mga0n895_111887_c1 | 3300050512 | Bacteria | 2747 |
| 284 | nmdc:mga0n895_14262_c1 | 3300050512 | Bacteria | 7211 |
| 285 | nmdc:mga0rr50_116432_c1 | 3300050513 | Bacteria | 2122 |
| 286 | nmdc:mga0rr50_14197_c1 | 3300050513 | Bacteria | 5216 |
| 287 | nmdc:mga08x19_110076_c1 | 3300050514 | Bacteria | 1836 |
| 288 | nmdc:mga0a205_1647_c1 | 3300050515 | Bacteria | 19196 |
| 289 | nmdc:mga0a205_376697_c1 | 3300050515 | Bacteria | 1285 |
| 290 | nmdc:mga0a205_639867_c1 | 3300050515 | Bacteria | 915 |
| 291 | Ga0495601_0255869 | 3300053077 | Bacteria | 1143 |
| 292 | Ga0495612_0115473 | 3300053078 | Bacteria | 1152 |
| 293 | Ga0495595_0252247 | 3300053084 | Bacteria | 883 |
| 294 | Ga0500595_052535 | 3300053119 | Bacteria | 1257 |
| 295 | Ga0500652_000043 | 3300053131 | Bacteria | 64726 |
| 296 | Ga0500616_0027897 | 3300053153 | Bacteria | 3115 |
| 297 | Ga0500636_0103134 | 3300053177 | Bacteria | 1619 |
| 298 | Ga0501084_0009341 | 3300054114 | Bacteria | 8114 |
| 299 | Ga0501084_0232555 | 3300054114 | Bacteria | 1556 |
| 300 | Ga0501082_0026911 | 3300060353 | Bacteria | 4955 |
| 301 | Ga0501082_0518219 | 3300060353 | Bacteria | 1042 |
| 302 | Ga0501082_0679695 | 3300060353 | Bacteria | 901 |
| 303 | Ga0530510_0060387 | 3300061734 | Bacteria | 2743 |
| 304 | Ga0530510_0227052 | 3300061734 | Bacteria | 1388 |
| 305 | Ga0530510_0301091 | 3300061734 | Bacteria | 1200 |
| 306 | Ga0530510_0386365 | 3300061734 | Bacteria | 1054 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005334 | Ga0068869_100525546 | Ga0068869_1005255461 | 196 |
| 2 | 3300042008 | Ga0439450_012184 | Ga0439450_012184_950_1570 | 200 |
| 3 | 3300045049 | Ga0466959_0699001 | Ga0466959_0699001_18_641 | 205 |
| 4 | iso_pu_bacteria | 2990088156 | 2990092647 | 205 |
| 5 | 3300049586 | Ga0501070_0528354 | Ga0501070_0528354_160_786 | 207 |
| 6 | 3300049589 | Ga0501073_0030530 | Ga0501073_0030530_1108_1734 | 207 |
| 7 | iso_pu_bacteria | 2862705112 | 2862708577 | 207 |
| 8 | iso_pu_bacteria | 2990044586 | 2990048298 | 207 |
| 9 | iso_pu_bacteria | 8008485437 | 8008491335 | 207 |
| 10 | iso_pu_bacteria | 8025524527 | 8025530665 | 207 |
| 11 | 3300005330 | Ga0070690_100209876 | Ga0070690_1002098762 | 209 |
| 12 | 3300005334 | Ga0068869_100135815 | Ga0068869_1001358151 | 209 |
| 13 | 3300005336 | Ga0070680_100011093 | Ga0070680_1000110934 | 209 |
| 14 | 3300005406 | Ga0070703_10140104 | Ga0070703_101401042 | 209 |
| 15 | 3300005438 | Ga0070701_10002688 | Ga0070701_100026888 | 209 |
| 16 | 3300005441 | Ga0070700_100005181 | Ga0070700_1000051813 | 209 |
| 17 | 3300005445 | Ga0070708_100053259 | Ga0070708_1000532594 | 209 |
| 18 | 3300005455 | Ga0070663_100013406 | Ga0070663_1000134062 | 209 |
| 19 | 3300005545 | Ga0070695_100001347 | Ga0070695_10000134712 | 209 |
| 20 | 3300005547 | Ga0070693_100049499 | Ga0070693_1000494994 | 209 |
| 21 | 3300005577 | Ga0068857_100124753 | Ga0068857_1001247534 | 209 |
| 22 | 3300005615 | Ga0070702_100110123 | Ga0070702_1001101232 | 209 |
| 23 | 3300005617 | Ga0068859_100000897 | Ga0068859_1000008972 | 209 |
| 24 | 3300005841 | Ga0068863_100120516 | Ga0068863_1001205164 | 209 |
| 25 | 3300005843 | Ga0068860_100160042 | Ga0068860_1001600422 | 209 |
| 26 | 3300005844 | Ga0068862_100084776 | Ga0068862_1000847762 | 209 |
| 27 | 3300006844 | Ga0075428_100250628 | Ga0075428_1002506282 | 209 |
| 28 | 3300006844 | Ga0075428_100581689 | Ga0075428_1005816892 | 209 |
| 29 | 3300006852 | Ga0075433_10287343 | Ga0075433_102873432 | 209 |
| 30 | 3300006931 | Ga0097620_100000897 | Ga0097620_10000089735 | 209 |
| 31 | 3300011119 | Ga0105246_10031744 | Ga0105246_100317444 | 209 |
| 32 | 3300025885 | Ga0207653_10002066 | Ga0207653_100020662 | 209 |
| 33 | 3300025912 | Ga0207707_10050044 | Ga0207707_100500444 | 209 |
| 34 | 3300025917 | Ga0207660_10008002 | Ga0207660_100080024 | 209 |
| 35 | 3300025942 | Ga0207689_10154039 | Ga0207689_101540392 | 209 |
| 36 | 3300025945 | Ga0207679_10337396 | Ga0207679_103373962 | 209 |
| 37 | 3300025961 | Ga0207712_10011557 | Ga0207712_100115574 | 209 |
| 38 | 3300026075 | Ga0207708_10004787 | Ga0207708_100047873 | 209 |
| 39 | 3300026088 | Ga0207641_10104109 | Ga0207641_101041092 | 209 |
| 40 | 3300026116 | Ga0207674_10002699 | Ga0207674_1000269915 | 209 |
| 41 | 3300028380 | Ga0268265_10000395 | Ga0268265_1000039514 | 209 |
| 42 | 3300034819 | Ga0373958_0015788 | Ga0373958_0015788_158_787 | 209 |
| 43 | 3300048905 | Ga0496102_0004952 | Ga0496102_0004952_9051_9680 | 209 |
| 44 | 3300048906 | Ga0496103_0035266 | Ga0496103_0035266_1693_2322 | 209 |
| 45 | 3300048909 | Ga0496106_0014063 | Ga0496106_0014063_3381_4010 | 209 |
| 46 | 3300048910 | Ga0496107_0003141 | Ga0496107_0003141_6341_6970 | 209 |
| 47 | 3300006846 | Ga0075430_100003847 | Ga0075430_1000038474 | 211 |
| 48 | 3300006847 | Ga0075431_100003740 | Ga0075431_1000037404 | 211 |
| 49 | 3300006852 | Ga0075433_10120378 | Ga0075433_101203784 | 211 |
| 50 | 3300046663 | Ga0495635_0182142 | Ga0495635_0182142_208_843 | 211 |
| 51 | 3300049590 | Ga0501074_0713061 | Ga0501074_0713061_20_655 | 211 |
| 52 | 3300053077 | Ga0495601_0255869 | Ga0495601_0255869_230_865 | 211 |
| 53 | 3300053078 | Ga0495612_0115473 | Ga0495612_0115473_200_835 | 211 |
| 54 | 3300061734 | Ga0530510_0386365 | Ga0530510_0386365_10_645 | 211 |
| 55 | iso_pu_bacteria | 2684623035 | 2686533874 | 211 |
| 56 | iso_pu_bacteria | 2687453743 | 2689995311 | 211 |
| 57 | iso_pu_bacteria | 2895880812 | 2895886494 | 211 |
| 58 | 3300031665 | Ga0316575_10006417 | Ga0316575_100064172 | 212 |
| 59 | 3300031691 | Ga0316579_10008355 | Ga0316579_100083552 | 212 |
| 60 | 3300031727 | Ga0316576_10019615 | Ga0316576_100196152 | 212 |
| 61 | 3300036647 | Ga0316582_0298083 | Ga0316582_0298083_296_1009 | 212 |
| 62 | 3300036712 | Ga0316584_0005609 | Ga0316584_0005609_2658_3371 | 212 |
| 63 | 3300049568 | Ga0501031_0134838 | Ga0501031_0134838_845_1510 | 212 |
| 64 | 3300005546 | Ga0070696_100319762 | Ga0070696_1003197622 | 213 |
| 65 | 3300005467 | Ga0070706_100033816 | Ga0070706_1000338162 | 214 |
| 66 | 3300025910 | Ga0207684_10078056 | Ga0207684_100780562 | 214 |
| 67 | 3300036401 | Ga0373937_0420246 | Ga0373937_0420246_428_1075 | 214 |
| 68 | 3300005336 | Ga0070680_100005401 | Ga0070680_1000054014 | 215 |
| 69 | 3300005458 | Ga0070681_10011531 | Ga0070681_100115318 | 215 |
| 70 | 3300005536 | Ga0070697_100710686 | Ga0070697_1007106862 | 215 |
| 71 | 3300005543 | Ga0070672_100023540 | Ga0070672_1000235405 | 215 |
| 72 | 3300009094 | Ga0111539_10646200 | Ga0111539_106462002 | 215 |
| 73 | 3300020069 | Ga0197907_11021076 | Ga0197907_110210762 | 215 |
| 74 | 3300020070 | Ga0206356_11007371 | Ga0206356_110073712 | 215 |
| 75 | 3300020081 | Ga0206354_10406870 | Ga0206354_104068702 | 215 |
| 76 | 3300020082 | Ga0206353_10284142 | Ga0206353_102841422 | 215 |
| 77 | 3300025909 | Ga0207705_10007752 | Ga0207705_100077529 | 215 |
| 78 | 3300025912 | Ga0207707_10006735 | Ga0207707_100067352 | 215 |
| 79 | 3300025917 | Ga0207660_10004218 | Ga0207660_100042186 | 215 |
| 80 | 3300025921 | Ga0207652_10003668 | Ga0207652_1000366812 | 215 |
| 81 | 3300025926 | Ga0207659_10262083 | Ga0207659_102620832 | 215 |
| 82 | 3300025940 | Ga0207691_10033468 | Ga0207691_100334685 | 215 |
| 83 | 3300037418 | Ga0395900_0806980 | Ga0395900_0806980_170_820 | 215 |
| 84 | 3300046524 | Ga0495648_0035469 | Ga0495648_0035469_312_974 | 215 |
| 85 | 3300047322 | Ga0495680_0129282 | Ga0495680_0129282_893_1543 | 215 |
| 86 | 3300048908 | Ga0496105_0659605 | Ga0496105_0659605_47_703 | 215 |
| 87 | 3300048911 | Ga0496108_0264703 | Ga0496108_0264703_163_819 | 215 |
| 88 | 3300048912 | Ga0496109_0062342 | Ga0496109_0062342_901_1557 | 215 |
| 89 | 3300048913 | Ga0496110_0570954 | Ga0496110_0570954_201_857 | 215 |
| 90 | 3300048914 | Ga0496111_0617978 | Ga0496111_0617978_28_684 | 215 |
| 91 | 3300049571 | Ga0501034_0075989 | Ga0501034_0075989_654_1304 | 215 |
| 92 | 3300049576 | Ga0501040_0354451 | Ga0501040_0354451_222_872 | 215 |
| 93 | 3300049580 | Ga0501046_0107062 | Ga0501046_0107062_835_1485 | 215 |
| 94 | 3300049581 | Ga0501047_0080281 | Ga0501047_0080281_912_1562 | 215 |
| 95 | 3300049581 | Ga0501047_0191530 | Ga0501047_0191530_422_1072 | 215 |
| 96 | 3300049583 | Ga0501067_0015374 | Ga0501067_0015374_2511_3161 | 215 |
| 97 | 3300049742 | Ga0501080_0378009 | Ga0501080_0378009_550_1200 | 215 |
| 98 | 3300049823 | Ga0501044_0106424 | Ga0501044_0106424_1170_1820 | 215 |
| 99 | 3300049823 | Ga0501044_0219996 | Ga0501044_0219996_972_1628 | 215 |
| 100 | 3300050511 | nmdc:mga08y16_446791_c1 | nmdc:mga08y16_446791_c1_351_1004 | 215 |
| 101 | 3300053084 | Ga0495595_0252247 | Ga0495595_0252247_42_692 | 215 |
| 102 | iso_pu_bacteria | 2671180195 | 2671837298 | 215 |
| 103 | iso_pu_bacteria | 2773857922 | 2774855454 | 215 |
| 104 | 3300006844 | Ga0075428_100094957 | Ga0075428_1000949572 | 216 |
| 105 | 3300009147 | Ga0114129_10038575 | Ga0114129_100385754 | 216 |
| 106 | 3300031251 | Ga0265327_10003157 | Ga0265327_1000315714 | 216 |
| 107 | 3300025972 | Ga0207668_10405187 | Ga0207668_104051872 | 217 |
| 108 | 3300049575 | Ga0501039_0078821 | Ga0501039_0078821_36_710 | 217 |
| 109 | 3300053119 | Ga0500595_052535 | Ga0500595_052535_251_904 | 217 |
| 110 | 3300053131 | Ga0500652_000043 | Ga0500652_000043_62388_63041 | 217 |
| 111 | 3300053177 | Ga0500636_0103134 | Ga0500636_0103134_587_1240 | 217 |
| 112 | 3300005440 | Ga0070705_100000110 | Ga0070705_10000011015 | 218 |
| 113 | 3300005444 | Ga0070694_100000271 | Ga0070694_10000027113 | 218 |
| 114 | 3300005518 | Ga0070699_100000653 | Ga0070699_10000065316 | 218 |
| 115 | 3300005546 | Ga0070696_100000720 | Ga0070696_10000072016 | 218 |
| 116 | 3300005549 | Ga0070704_100002027 | Ga0070704_10000202712 | 218 |
| 117 | 3300006846 | Ga0075430_100001086 | Ga0075430_1000010863 | 218 |
| 118 | 3300009147 | Ga0114129_10241153 | Ga0114129_102411532 | 218 |
| 119 | 3300014326 | Ga0157380_11033599 | Ga0157380_110335991 | 218 |
| 120 | 3300028381 | Ga0268264_10014161 | Ga0268264_100141611 | 218 |
| 121 | 3300031691 | Ga0316579_10130079 | Ga0316579_101300791 | 218 |
| 122 | 3300031852 | Ga0307410_10795503 | Ga0307410_107955031 | 218 |
| 123 | 3300031995 | Ga0307409_100672064 | Ga0307409_1006720641 | 218 |
| 124 | 3300048904 | Ga0496101_0349859 | Ga0496101_0349859_293_949 | 218 |
| 125 | 3300048910 | Ga0496107_0020554 | Ga0496107_0020554_1126_1782 | 218 |
| 126 | 3300048924 | Ga0496121_0007595 | Ga0496121_0007595_708_1364 | 218 |
| 127 | 3300048929 | Ga0496126_0083444 | Ga0496126_0083444_449_1105 | 218 |
| 128 | 3300049572 | Ga0501036_0316621 | Ga0501036_0316621_74_730 | 218 |
| 129 | 3300049573 | Ga0501037_0342717 | Ga0501037_0342717_259_942 | 218 |
| 130 | 3300049575 | Ga0501039_0222771 | Ga0501039_0222771_16_672 | 218 |
| 131 | 3300049575 | Ga0501039_0408474 | Ga0501039_0408474_158_814 | 218 |
| 132 | 3300049577 | Ga0501041_0209276 | Ga0501041_0209276_473_1129 | 218 |
| 133 | 3300049578 | Ga0501042_0139813 | Ga0501042_0139813_270_926 | 218 |
| 134 | 3300049578 | Ga0501042_0214694 | Ga0501042_0214694_94_750 | 218 |
| 135 | 3300049580 | Ga0501046_0050039 | Ga0501046_0050039_2348_3004 | 218 |
| 136 | 3300049586 | Ga0501070_0202656 | Ga0501070_0202656_464_1147 | 218 |
| 137 | 3300049591 | Ga0501075_0502285 | Ga0501075_0502285_26_682 | 218 |
| 138 | 3300049593 | Ga0501077_0043383 | Ga0501077_0043383_1018_1674 | 218 |
| 139 | 3300049741 | Ga0501079_0089215 | Ga0501079_0089215_686_1342 | 218 |
| 140 | 3300049743 | Ga0501081_0058620 | Ga0501081_0058620_71_727 | 218 |
| 141 | 3300049822 | Ga0501035_0116360 | Ga0501035_0116360_1624_2307 | 218 |
| 142 | 3300049824 | Ga0501045_0089336 | Ga0501045_0089336_1025_1681 | 218 |
| 143 | 3300050507 | nmdc:mga05p37_179825_c1 | nmdc:mga05p37_179825_c1_727_1389 | 218 |
| 144 | 3300050507 | nmdc:mga05p37_226937_c1 | nmdc:mga05p37_226937_c1_612_1268 | 218 |
| 145 | 3300050508 | nmdc:mga09592_95076_c1 | nmdc:mga09592_95076_c1_531_1187 | 218 |
| 146 | 3300050509 | nmdc:mga0qj67_293_c1 | nmdc:mga0qj67_293_c1_6384_7040 | 218 |
| 147 | 3300050509 | nmdc:mga0qj67_416871_c1 | nmdc:mga0qj67_416871_c1_48_710 | 218 |
| 148 | 3300050509 | nmdc:mga0qj67_71578_c1 | nmdc:mga0qj67_71578_c1_1913_2569 | 218 |
| 149 | 3300050510 | nmdc:mga06r32_175566_c1 | nmdc:mga06r32_175566_c1_109_765 | 218 |
| 150 | 3300050510 | nmdc:mga06r32_533531_c1 | nmdc:mga06r32_533531_c1_200_856 | 218 |
| 151 | 3300050511 | nmdc:mga08y16_183082_c1 | nmdc:mga08y16_183082_c1_1296_1952 | 218 |
| 152 | 3300054114 | Ga0501084_0232555 | Ga0501084_0232555_575_1231 | 218 |
| 153 | 3300061734 | Ga0530510_0227052 | Ga0530510_0227052_58_714 | 218 |
| 154 | 3300005328 | Ga0070676_10206780 | Ga0070676_102067802 | 219 |
| 155 | 3300005347 | Ga0070668_100025461 | Ga0070668_1000254612 | 219 |
| 156 | 3300005347 | Ga0070668_100223558 | Ga0070668_1002235581 | 219 |
| 157 | 3300005366 | Ga0070659_100363727 | Ga0070659_1003637272 | 219 |
| 158 | 3300005440 | Ga0070705_100013550 | Ga0070705_1000135504 | 219 |
| 159 | 3300006042 | Ga0075368_10023161 | Ga0075368_100231612 | 219 |
| 160 | 3300006048 | Ga0075363_100003600 | Ga0075363_1000036007 | 219 |
| 161 | 3300006178 | Ga0075367_10009204 | Ga0075367_100092043 | 219 |
| 162 | 3300006880 | Ga0075429_100257420 | Ga0075429_1002574202 | 219 |
| 163 | 3300009147 | Ga0114129_10195539 | Ga0114129_101955392 | 219 |
| 164 | 3300025921 | Ga0207652_10116264 | Ga0207652_101162642 | 219 |
| 165 | 3300025972 | Ga0207668_10469522 | Ga0207668_104695222 | 219 |
| 166 | 3300026035 | Ga0207703_10276280 | Ga0207703_102762802 | 219 |
| 167 | 3300027866 | Ga0209813_10014000 | Ga0209813_100140002 | 219 |
| 168 | 3300028380 | Ga0268265_10010728 | Ga0268265_100107284 | 219 |
| 169 | 3300048907 | Ga0496104_0008027 | Ga0496104_0008027_5676_6335 | 219 |
| 170 | 3300048908 | Ga0496105_0051098 | Ga0496105_0051098_1670_2329 | 219 |
| 171 | 3300048911 | Ga0496108_0005291 | Ga0496108_0005291_6332_6991 | 219 |
| 172 | 3300048912 | Ga0496109_0028757 | Ga0496109_0028757_1128_1787 | 219 |
| 173 | 3300048913 | Ga0496110_0060879 | Ga0496110_0060879_1957_2616 | 219 |
| 174 | 3300048915 | Ga0496112_0309977 | Ga0496112_0309977_667_1326 | 219 |
| 175 | 3300048916 | Ga0496113_0006375 | Ga0496113_0006375_607_1266 | 219 |
| 176 | 3300049570 | Ga0501033_0096491 | Ga0501033_0096491_1139_1798 | 219 |
| 177 | 3300049571 | Ga0501034_0031238 | Ga0501034_0031238_811_1470 | 219 |
| 178 | 3300049572 | Ga0501036_0419213 | Ga0501036_0419213_236_895 | 219 |
| 179 | 3300049581 | Ga0501047_0013713 | Ga0501047_0013713_6504_7163 | 219 |
| 180 | 3300049582 | Ga0501048_0011117 | Ga0501048_0011117_5064_5738 | 219 |
| 181 | 3300049822 | Ga0501035_0053845 | Ga0501035_0053845_2903_3562 | 219 |
| 182 | 3300049823 | Ga0501044_0016875 | Ga0501044_0016875_4390_5049 | 219 |
| 183 | 3300050490 | nmdc:mga03n38_17105_c1 | nmdc:mga03n38_17105_c1_842_1513 | 219 |
| 184 | 3300050494 | nmdc:mga06z11_1992_c1 | nmdc:mga06z11_1992_c1_3907_4578 | 219 |
| 185 | 3300050495 | nmdc:mga04h51_5597_c1 | nmdc:mga04h51_5597_c1_1589_2260 | 219 |
| 186 | 3300050507 | nmdc:mga05p37_197996_c1 | nmdc:mga05p37_197996_c1_1528_2187 | 219 |
| 187 | 3300050508 | nmdc:mga09592_438015_c1 | nmdc:mga09592_438015_c1_205_864 | 219 |
| 188 | 3300050510 | nmdc:mga06r32_173124_c1 | nmdc:mga06r32_173124_c1_432_1091 | 219 |
| 189 | 3300053153 | Ga0500616_0027897 | Ga0500616_0027897_944_1609 | 219 |
| 190 | 3300003911 | JGI25405J52794_10029314 | JGI25405J52794_100293142 | 220 |
| 191 | 3300005341 | Ga0070691_10014062 | Ga0070691_100140622 | 220 |
| 192 | 3300005353 | Ga0070669_100146726 | Ga0070669_1001467262 | 220 |
| 193 | 3300005441 | Ga0070700_100008573 | Ga0070700_1000085736 | 220 |
| 194 | 3300005719 | Ga0068861_100192336 | Ga0068861_1001923361 | 220 |
| 195 | 3300005841 | Ga0068863_100118892 | Ga0068863_1001188922 | 220 |
| 196 | 3300005937 | Ga0081455_10001600 | Ga0081455_1000160024 | 220 |
| 197 | 3300005983 | Ga0081540_1002271 | Ga0081540_100227117 | 220 |
| 198 | 3300005983 | Ga0081540_1040628 | Ga0081540_10406284 | 220 |
| 199 | 3300005983 | Ga0081540_1121463 | Ga0081540_11214632 | 220 |
| 200 | 3300005985 | Ga0081539_10028445 | Ga0081539_100284454 | 220 |
| 201 | 3300006051 | Ga0075364_10024925 | Ga0075364_100249252 | 220 |
| 202 | 3300006178 | Ga0075367_10019901 | Ga0075367_100199013 | 220 |
| 203 | 3300006178 | Ga0075367_10077317 | Ga0075367_100773172 | 220 |
| 204 | 3300006844 | Ga0075428_100503397 | Ga0075428_1005033972 | 220 |
| 205 | 3300006846 | Ga0075430_100292259 | Ga0075430_1002922592 | 220 |
| 206 | 3300006847 | Ga0075431_100001007 | Ga0075431_1000010073 | 220 |
| 207 | 3300006847 | Ga0075431_100289633 | Ga0075431_1002896332 | 220 |
| 208 | 3300006852 | Ga0075433_10014493 | Ga0075433_100144938 | 220 |
| 209 | 3300006852 | Ga0075433_10173900 | Ga0075433_101739002 | 220 |
| 210 | 3300006871 | Ga0075434_100002734 | Ga0075434_1000027348 | 220 |
| 211 | 3300006871 | Ga0075434_100188992 | Ga0075434_1001889922 | 220 |
| 212 | 3300006880 | Ga0075429_100033729 | Ga0075429_1000337293 | 220 |
| 213 | 3300006880 | Ga0075429_100143811 | Ga0075429_1001438112 | 220 |
| 214 | 3300006914 | Ga0075436_100115023 | Ga0075436_1001150233 | 220 |
| 215 | 3300007076 | Ga0075435_100006275 | Ga0075435_10000627511 | 220 |
| 216 | 3300007076 | Ga0075435_100038567 | Ga0075435_1000385675 | 220 |
| 217 | 3300007076 | Ga0075435_100363360 | Ga0075435_1003633602 | 220 |
| 218 | 3300009094 | Ga0111539_10006991 | Ga0111539_1000699120 | 220 |
| 219 | 3300009094 | Ga0111539_10033078 | Ga0111539_100330786 | 220 |
| 220 | 3300009094 | Ga0111539_10202437 | Ga0111539_102024371 | 220 |
| 221 | 3300009094 | Ga0111539_10323600 | Ga0111539_103236003 | 220 |
| 222 | 3300009094 | Ga0111539_10615922 | Ga0111539_106159222 | 220 |
| 223 | 3300009098 | Ga0105245_10032391 | Ga0105245_100323913 | 220 |
| 224 | 3300009098 | Ga0105245_10841468 | Ga0105245_108414682 | 220 |
| 225 | 3300009101 | Ga0105247_10274473 | Ga0105247_102744732 | 220 |
| 226 | 3300009147 | Ga0114129_10090617 | Ga0114129_100906175 | 220 |
| 227 | 3300013306 | Ga0163162_10168103 | Ga0163162_101681032 | 220 |
| 228 | 3300013308 | Ga0157375_10401809 | Ga0157375_104018091 | 220 |
| 229 | 3300014968 | Ga0157379_10064957 | Ga0157379_100649575 | 220 |
| 230 | 3300025900 | Ga0207710_10132148 | Ga0207710_101321482 | 220 |
| 231 | 3300025923 | Ga0207681_10129313 | Ga0207681_101293132 | 220 |
| 232 | 3300025927 | Ga0207687_10041635 | Ga0207687_100416352 | 220 |
| 233 | 3300026075 | Ga0207708_10022899 | Ga0207708_100228995 | 220 |
| 234 | 3300026118 | Ga0207675_100187365 | Ga0207675_1001873653 | 220 |
| 235 | 3300026118 | Ga0207675_100248595 | Ga0207675_1002485952 | 220 |
| 236 | 3300027907 | Ga0207428_10146528 | Ga0207428_101465282 | 220 |
| 237 | 3300035092 | Ga0373952_0012524 | Ga0373952_0012524_735_1397 | 220 |
| 238 | 3300035114 | Ga0373939_0054500 | Ga0373939_0054500_80_748 | 220 |
| 239 | 3300035241 | Ga0373961_0004287 | Ga0373961_0004287_1099_1761 | 220 |
| 240 | 3300035242 | Ga0373962_0120489 | Ga0373962_0120489_107_775 | 220 |
| 241 | 3300035691 | Ga0373931_0005278 | Ga0373931_0005278_24_692 | 220 |
| 242 | 3300035691 | Ga0373931_0134939 | Ga0373931_0134939_484_1146 | 220 |
| 243 | 3300035691 | Ga0373931_0241362 | Ga0373931_0241362_200_862 | 220 |
| 244 | 3300035695 | Ga0373927_0553193 | Ga0373927_0553193_24_686 | 220 |
| 245 | 3300036401 | Ga0373937_0232264 | Ga0373937_0232264_139_801 | 220 |
| 246 | 3300039437 | Ga0436365_1230432 | Ga0436365_1230432_189_860 | 220 |
| 247 | 3300046455 | Ga0495603_0208455 | Ga0495603_0208455_325_987 | 220 |
| 248 | 3300046529 | Ga0495652_0361004 | Ga0495652_0361004_171_833 | 220 |
| 249 | 3300048904 | Ga0496101_0200844 | Ga0496101_0200844_53_715 | 220 |
| 250 | 3300048905 | Ga0496102_0072925 | Ga0496102_0072925_1427_2089 | 220 |
| 251 | 3300048905 | Ga0496102_0156168 | Ga0496102_0156168_591_1253 | 220 |
| 252 | 3300048907 | Ga0496104_0006775 | Ga0496104_0006775_273_935 | 220 |
| 253 | 3300048908 | Ga0496105_0063554 | Ga0496105_0063554_565_1227 | 220 |
| 254 | 3300048909 | Ga0496106_0013644 | Ga0496106_0013644_822_1484 | 220 |
| 255 | 3300048909 | Ga0496106_0224131 | Ga0496106_0224131_355_1017 | 220 |
| 256 | 3300048912 | Ga0496109_0071193 | Ga0496109_0071193_117_779 | 220 |
| 257 | 3300048913 | Ga0496110_0075854 | Ga0496110_0075854_1295_1957 | 220 |
| 258 | 3300048914 | Ga0496111_0020116 | Ga0496111_0020116_2345_3007 | 220 |
| 259 | 3300048914 | Ga0496111_0031626 | Ga0496111_0031626_1826_2488 | 220 |
| 260 | 3300048915 | Ga0496112_0096255 | Ga0496112_0096255_1214_1876 | 220 |
| 261 | 3300048916 | Ga0496113_0097265 | Ga0496113_0097265_548_1210 | 220 |
| 262 | 3300048916 | Ga0496113_0219010 | Ga0496113_0219010_111_773 | 220 |
| 263 | 3300048917 | Ga0496114_0255447 | Ga0496114_0255447_764_1426 | 220 |
| 264 | 3300048918 | Ga0496115_0073867 | Ga0496115_0073867_1592_2254 | 220 |
| 265 | 3300049572 | Ga0501036_0129631 | Ga0501036_0129631_740_1402 | 220 |
| 266 | 3300049572 | Ga0501036_0829028 | Ga0501036_0829028_16_678 | 220 |
| 267 | 3300049576 | Ga0501040_0197462 | Ga0501040_0197462_289_951 | 220 |
| 268 | 3300049577 | Ga0501041_0033691 | Ga0501041_0033691_1995_2657 | 220 |
| 269 | 3300049577 | Ga0501041_0060622 | Ga0501041_0060622_69_731 | 220 |
| 270 | 3300049580 | Ga0501046_0241873 | Ga0501046_0241873_505_1167 | 220 |
| 271 | 3300049581 | Ga0501047_0231376 | Ga0501047_0231376_167_829 | 220 |
| 272 | 3300049583 | Ga0501067_0072485 | Ga0501067_0072485_484_1146 | 220 |
| 273 | 3300049586 | Ga0501070_0050738 | Ga0501070_0050738_272_934 | 220 |
| 274 | 3300049587 | Ga0501071_0058608 | Ga0501071_0058608_1429_2091 | 220 |
| 275 | 3300049588 | Ga0501072_0219047 | Ga0501072_0219047_279_941 | 220 |
| 276 | 3300049590 | Ga0501074_0278363 | Ga0501074_0278363_276_938 | 220 |
| 277 | 3300049591 | Ga0501075_0017149 | Ga0501075_0017149_563_1225 | 220 |
| 278 | 3300049592 | Ga0501076_0084534 | Ga0501076_0084534_234_896 | 220 |
| 279 | 3300049593 | Ga0501077_0043060 | Ga0501077_0043060_1031_1693 | 220 |
| 280 | 3300049593 | Ga0501077_0121276 | Ga0501077_0121276_370_1032 | 220 |
| 281 | 3300049741 | Ga0501079_0087883 | Ga0501079_0087883_383_1045 | 220 |
| 282 | 3300049741 | Ga0501079_0242577 | Ga0501079_0242577_510_1172 | 220 |
| 283 | 3300049742 | Ga0501080_0133762 | Ga0501080_0133762_960_1622 | 220 |
| 284 | 3300049743 | Ga0501081_0010949 | Ga0501081_0010949_4184_4846 | 220 |
| 285 | 3300049743 | Ga0501081_0406827 | Ga0501081_0406827_238_900 | 220 |
| 286 | 3300049743 | Ga0501081_0495616 | Ga0501081_0495616_122_784 | 220 |
| 287 | 3300049744 | Ga0501083_0380086 | Ga0501083_0380086_71_733 | 220 |
| 288 | 3300049823 | Ga0501044_0168752 | Ga0501044_0168752_844_1506 | 220 |
| 289 | 3300049824 | Ga0501045_0539878 | Ga0501045_0539878_41_703 | 220 |
| 290 | 3300050491 | nmdc:mga00v17_8619_c1 | nmdc:mga00v17_8619_c1_2944_3606 | 220 |
| 291 | 3300050494 | nmdc:mga06z11_12730_c1 | nmdc:mga06z11_12730_c1_2666_3328 | 220 |
| 292 | 3300050495 | nmdc:mga04h51_43278_c1 | nmdc:mga04h51_43278_c1_52_714 | 220 |
| 293 | 3300050507 | nmdc:mga05p37_260352_c1 | nmdc:mga05p37_260352_c1_1380_2042 | 220 |
| 294 | 3300050508 | nmdc:mga09592_21943_c1 | nmdc:mga09592_21943_c1_2423_3085 | 220 |
| 295 | 3300050508 | nmdc:mga09592_682438_c1 | nmdc:mga09592_682438_c1_187_849 | 220 |
| 296 | 3300050509 | nmdc:mga0qj67_10579_c1 | nmdc:mga0qj67_10579_c1_5996_6658 | 220 |
| 297 | 3300050509 | nmdc:mga0qj67_93295_c1 | nmdc:mga0qj67_93295_c1_781_1443 | 220 |
| 298 | 3300050510 | nmdc:mga06r32_24317_c1 | nmdc:mga06r32_24317_c1_4898_5560 | 220 |
| 299 | 3300050510 | nmdc:mga06r32_555093_c1 | nmdc:mga06r32_555093_c1_193_855 | 220 |
| 300 | 3300050510 | nmdc:mga06r32_7918_c1 | nmdc:mga06r32_7918_c1_2828_3490 | 220 |
| 301 | 3300050511 | nmdc:mga08y16_121960_c1 | nmdc:mga08y16_121960_c1_280_948 | 220 |
| 302 | 3300050511 | nmdc:mga08y16_99217_c1 | nmdc:mga08y16_99217_c1_1941_2603 | 220 |
| 303 | 3300050512 | nmdc:mga0n895_111887_c1 | nmdc:mga0n895_111887_c1_1187_1849 | 220 |
| 304 | 3300050512 | nmdc:mga0n895_14262_c1 | nmdc:mga0n895_14262_c1_5012_5680 | 220 |
| 305 | 3300050513 | nmdc:mga0rr50_116432_c1 | nmdc:mga0rr50_116432_c1_1126_1800 | 220 |
| 306 | 3300050513 | nmdc:mga0rr50_14197_c1 | nmdc:mga0rr50_14197_c1_4524_5192 | 220 |
| 307 | 3300050514 | nmdc:mga08x19_110076_c1 | nmdc:mga08x19_110076_c1_145_819 | 220 |
| 308 | 3300050515 | nmdc:mga0a205_1647_c1 | nmdc:mga0a205_1647_c1_8219_8887 | 220 |
| 309 | 3300050515 | nmdc:mga0a205_376697_c1 | nmdc:mga0a205_376697_c1_113_775 | 220 |
| 310 | 3300050515 | nmdc:mga0a205_639867_c1 | nmdc:mga0a205_639867_c1_96_758 | 220 |
| 311 | 3300054114 | Ga0501084_0009341 | Ga0501084_0009341_3086_3748 | 220 |
| 312 | 3300060353 | Ga0501082_0026911 | Ga0501082_0026911_44_706 | 220 |
| 313 | 3300060353 | Ga0501082_0518219 | Ga0501082_0518219_41_703 | 220 |
| 314 | 3300060353 | Ga0501082_0679695 | Ga0501082_0679695_45_707 | 220 |
| 315 | 3300061734 | Ga0530510_0060387 | Ga0530510_0060387_1226_1888 | 220 |
| 316 | 3300061734 | Ga0530510_0301091 | Ga0530510_0301091_494_1156 | 220 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1fva-assembly2.cif.gz_B | crystal structure of bovine methionine sulfoxide reductase | 0.9745 | 12 | 211 |
| 6agv-assembly1.cif.gz_A | crystal structure of apo mouse msra | 0.9732 | 9 | 199 |
| 6agv-assembly1.cif.gz_A | crystal structure of apo mouse msra | 0.9682 | 9 | 199 |
| 1ff3-assembly3.cif.gz_C | structure of the peptide methionine sulfoxide reductase from escherichia coli | 0.967 | 11 | 194 |
| 1fva-assembly2.cif.gz_B | crystal structure of bovine methionine sulfoxide reductase | 0.9603 | 12 | 211 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A084_1_166_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.959 | 44 | 198 | 3.30.1060.10 |
| af_Q551H3_1_147_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9563 | 46 | 195 | 3.30.1060.10 |
| 3e0mA01 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9457 | 46 | 203 | 3.30.1060.10 |
| af_Q551H3_1_147_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9374 | 46 | 195 | 3.30.1060.10 |
| af_A4HTE0_2_175_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9367 | 44 | 202 | 3.30.1060.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G0KCH0-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) | 0.9856 | 35 | 185 |
GO:0005737
GO:0008113 GO:0034599 GO:0036456 |
| AF-A0A450UUA4-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) | 0.9849 | 48 | 210 |
GO:0005737
GO:0008113 GO:0034599 GO:0036211 GO:0036456 |
| AF-A0A3C1N8T3-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) | 0.9838 | 45 | 210 |
GO:0005737
GO:0008113 GO:0034599 GO:0036456 |
| AF-A0A381NS22-F1-model_v4 | peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) | 0.9831 | 9 | 212 |
GO:0005737
GO:0008113 GO:0034599 GO:0036456 |
| AF-E1VQ90-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) | 0.9826 | 10 | 209 |
GO:0005737
GO:0008113 GO:0034599 GO:0036211 GO:0036456 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar