F403598

General Info

Members Datasets Scaffolds Average Seq Length
316 188 306 218

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10028445|Ga0081539_100284454
Length 242
Sequence MLYVPGGAHYIKGICPNTTGRPMLFSRKKLEMPTPETALKGRAEPIPTAKSHFLNKRALKGPYPDGLETAIFGLGCFWGAERKFWEIGDGIWVTAVGYAGGGTPNPTYEEVCSGRTGHNEVVLVVFDPKKVSYEELLKTFWESHDPTQGMRQGNDVGTQYRSGIYAFSPAQRAAAEASKAAYQKVLAANGYGPITTEILDAPPFYFAEDYHQQYLAKVPHGYCGLGGTGLSCPVGVGVKAGV

Samples

Sample ID Description Type Environment
1 2671180195 Frankia sp. CcI49 Isolate Nodule
2 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
3 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
4 2773857922 Frankia sp. CcI49 Isolate Nodule
5 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
6 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
7 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
8 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
95 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
96 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
97 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
101 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
102 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
103 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
104 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
109 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
179 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
180 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
181 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
182 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
183 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
187 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
188 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.57
Metatranscriptomes 1.27
Isolates 3.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.38
Nodule 0.95
Rhizoplane 10.76
Rhizosphere 80.38
Stem 0
Stem Tuber 0
Unclassified 2.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10029314 3300003911 Bacteria 1138
2 Ga0070676_10206780 3300005328 Bacteria 1289
3 Ga0070690_100209876 3300005330 Bacteria 1359
4 Ga0068869_100135815 3300005334 Bacteria 1895
5 Ga0068869_100525546 3300005334 Bacteria 991
6 Ga0070680_100005401 3300005336 Bacteria 9673
7 Ga0070680_100011093 3300005336 Bacteria 6965
8 Ga0070691_10014062 3300005341 Bacteria 3670
9 Ga0070668_100025461 3300005347 Bacteria 4485
10 Ga0070668_100223558 3300005347 Bacteria 1554
11 Ga0070669_100146726 3300005353 Bacteria 1824
12 Ga0070659_100363727 3300005366 Bacteria 1216
13 Ga0070703_10140104 3300005406 Bacteria 898
14 Ga0070701_10002688 3300005438 Bacteria 6895
15 Ga0070705_100000110 3300005440 Bacteria 46763
16 Ga0070705_100013550 3300005440 Bacteria 4174
17 Ga0070700_100005181 3300005441 Bacteria 6887
18 Ga0070700_100008573 3300005441 Bacteria 5568
19 Ga0070694_100000271 3300005444 Bacteria 27422
20 Ga0070708_100053259 3300005445 Bacteria 3590
21 Ga0070663_100013406 3300005455 Bacteria 5227
22 Ga0070681_10011531 3300005458 Bacteria 8749
23 Ga0070706_100033816 3300005467 Bacteria 4720
24 Ga0070699_100000653 3300005518 Bacteria 32414
25 Ga0070697_100710686 3300005536 Bacteria 887
26 Ga0070672_100023540 3300005543 Bacteria 4542
27 Ga0070695_100001347 3300005545 Bacteria 13614
28 Ga0070696_100000720 3300005546 Bacteria 21146
29 Ga0070696_100319762 3300005546 Bacteria 1194
30 Ga0070693_100049499 3300005547 Bacteria 2398
31 Ga0070704_100002027 3300005549 Bacteria 11229
32 Ga0068857_100124753 3300005577 Bacteria 2320
33 Ga0070702_100110123 3300005615 Bacteria 1706
34 Ga0068859_100000897 3300005617 Bacteria 30326
35 Ga0068861_100192336 3300005719 Bacteria 1707
36 Ga0068863_100118892 3300005841 Bacteria 2519
37 Ga0068863_100120516 3300005841 Bacteria 2501
38 Ga0068860_100160042 3300005843 Bacteria 2171
39 Ga0068862_100084776 3300005844 Bacteria 2753
40 Ga0081455_10001600 3300005937 Bacteria 27663
41 Ga0081540_1002271 3300005983 Bacteria 15795
42 Ga0081540_1040628 3300005983 Bacteria 2422
43 Ga0081540_1121463 3300005983 Bacteria 1083
44 Ga0081539_10028445 3300005985 Bacteria 3515
45 Ga0075368_10023161 3300006042 Bacteria 2369
46 Ga0075363_100003600 3300006048 Bacteria 6633
47 Ga0075364_10024925 3300006051 Bacteria 3803
48 Ga0075367_10009204 3300006178 Bacteria 5153
49 Ga0075367_10019901 3300006178 Bacteria 3729
50 Ga0075367_10077317 3300006178 Bacteria 2009
51 Ga0075428_100094957 3300006844 Bacteria 3250
52 Ga0075428_100250628 3300006844 Bacteria 1908
53 Ga0075428_100503397 3300006844 Bacteria 1296
54 Ga0075428_100581689 3300006844 Bacteria 1196
55 Ga0075430_100001086 3300006846 Bacteria 21581
56 Ga0075430_100003847 3300006846 Bacteria 12638
57 Ga0075430_100292259 3300006846 Bacteria 1348
58 Ga0075431_100001007 3300006847 Bacteria 25062
59 Ga0075431_100003740 3300006847 Bacteria 14780
60 Ga0075431_100289633 3300006847 Bacteria 1657
61 Ga0075433_10014493 3300006852 Bacteria 6442
62 Ga0075433_10120378 3300006852 Bacteria 2330
63 Ga0075433_10173900 3300006852 Bacteria 1916
64 Ga0075433_10287343 3300006852 Bacteria 1457
65 Ga0075434_100002734 3300006871 Bacteria 15582
66 Ga0075434_100188992 3300006871 Bacteria 2080
67 Ga0075429_100033729 3300006880 Bacteria 4448
68 Ga0075429_100143811 3300006880 Bacteria 2088
69 Ga0075429_100257420 3300006880 Bacteria 1528
70 Ga0075436_100115023 3300006914 Bacteria 1879
71 Ga0097620_100000897 3300006931 Bacteria 30326
72 Ga0075435_100006275 3300007076 Bacteria 8392
73 Ga0075435_100038567 3300007076 Bacteria 3809
74 Ga0075435_100363360 3300007076 Bacteria 1242
75 Ga0111539_10006991 3300009094 Bacteria 14476
76 Ga0111539_10033078 3300009094 Bacteria 6278
77 Ga0111539_10202437 3300009094 Bacteria 2315
78 Ga0111539_10323600 3300009094 Bacteria 1794
79 Ga0111539_10615922 3300009094 Bacteria 1264
80 Ga0111539_10646200 3300009094 Bacteria 1232
81 Ga0105245_10032391 3300009098 Bacteria 4627
82 Ga0105245_10841468 3300009098 Bacteria 957
83 Ga0105247_10274473 3300009101 Bacteria 1161
84 Ga0114129_10038575 3300009147 Bacteria 6737
85 Ga0114129_10090617 3300009147 Bacteria 4238
86 Ga0114129_10195539 3300009147 Bacteria 2743
87 Ga0114129_10241153 3300009147 Bacteria 2430
88 Ga0105246_10031744 3300011119 Bacteria 3497
89 Ga0163162_10168103 3300013306 Bacteria 2317
90 Ga0157375_10401809 3300013308 Bacteria 1537
91 Ga0157380_11033599 3300014326 Bacteria 857
92 Ga0157379_10064957 3300014968 Bacteria 3261
93 Ga0197907_11021076 3300020069 Bacteria 1288
94 Ga0206356_11007371 3300020070 Bacteria 2245
95 Ga0206354_10406870 3300020081 Bacteria 9875
96 Ga0206353_10284142 3300020082 Bacteria 2344
97 Ga0207653_10002066 3300025885 Bacteria 6396
98 Ga0207710_10132148 3300025900 Bacteria 1199
99 Ga0207705_10007752 3300025909 Bacteria 7888
100 Ga0207684_10078056 3300025910 Bacteria 2816
101 Ga0207707_10006735 3300025912 Bacteria 10030
102 Ga0207707_10050044 3300025912 Bacteria 3641
103 Ga0207660_10004218 3300025917 Bacteria 9361
104 Ga0207660_10008002 3300025917 Bacteria 6833
105 Ga0207652_10003668 3300025921 Bacteria 12635
106 Ga0207652_10116264 3300025921 Bacteria 2376
107 Ga0207681_10129313 3300025923 Bacteria 1865
108 Ga0207659_10262083 3300025926 Bacteria 1407
109 Ga0207687_10041635 3300025927 Bacteria 3155
110 Ga0207691_10033468 3300025940 Bacteria 4785
111 Ga0207689_10154039 3300025942 Bacteria 1895
112 Ga0207679_10337396 3300025945 Bacteria 1310
113 Ga0207712_10011557 3300025961 Bacteria 5628
114 Ga0207668_10405187 3300025972 Bacteria 1154
115 Ga0207668_10469522 3300025972 Bacteria 1077
116 Ga0207703_10276280 3300026035 Bacteria 1524
117 Ga0207708_10004787 3300026075 Bacteria 9967
118 Ga0207708_10022899 3300026075 Bacteria 4719
119 Ga0207641_10104109 3300026088 Bacteria 2505
120 Ga0207674_10002699 3300026116 Bacteria 22159
121 Ga0207675_100187365 3300026118 Bacteria 1984
122 Ga0207675_100248595 3300026118 Bacteria 1721
123 Ga0209813_10014000 3300027866 Bacteria 2152
124 Ga0207428_10146528 3300027907 Bacteria 1799
125 Ga0268265_10000395 3300028380 Bacteria 46647
126 Ga0268265_10010728 3300028380 Bacteria 6186
127 Ga0268264_10014161 3300028381 Bacteria 6559
128 Ga0265327_10003157 3300031251 Bacteria 16162
129 Ga0316575_10006417 3300031665 Bacteria 4227
130 Ga0316579_10008355 3300031691 Bacteria 4313
131 Ga0316579_10130079 3300031691 Bacteria 1212
132 Ga0316576_10019615 3300031727 Bacteria 4634
133 Ga0307410_10795503 3300031852 Bacteria 804
134 Ga0307409_100672064 3300031995 Bacteria 1032
135 Ga0373958_0015788 3300034819 Bacteria 1339
136 Ga0373952_0012524 3300035092 Bacteria 1670
137 Ga0373939_0054500 3300035114 Bacteria 1253
138 Ga0373961_0004287 3300035241 Bacteria 3453
139 Ga0373962_0120489 3300035242 Bacteria 836
140 Ga0373931_0005278 3300035691 Bacteria 5956
141 Ga0373931_0134939 3300035691 Bacteria 1424
142 Ga0373931_0241362 3300035691 Bacteria 1095
143 Ga0373927_0553193 3300035695 Bacteria 760
144 Ga0373937_0232264 3300036401 Bacteria 1737
145 Ga0373937_0420246 3300036401 Bacteria 1269
146 Ga0316582_0298083 3300036647 Bacteria 1107
147 Ga0316584_0005609 3300036712 Bacteria 8448
148 Ga0395900_0806980 3300037418 Bacteria 866
149 Ga0436365_1230432 3300039437 Bacteria 938
150 Ga0439450_012184 3300042008 Bacteria 1702
151 Ga0466959_0699001 3300045049 Bacteria 680
152 Ga0495603_0208455 3300046455 Bacteria 1129
153 Ga0495648_0035469 3300046524 Bacteria 3233
154 Ga0495652_0361004 3300046529 Bacteria 1038
155 Ga0495635_0182142 3300046663 Bacteria 1428
156 Ga0495680_0129282 3300047322 Bacteria 1857
157 Ga0496101_0200844 3300048904 Bacteria 1541
158 Ga0496101_0349859 3300048904 Bacteria 1161
159 Ga0496102_0004952 3300048905 Bacteria 11280
160 Ga0496102_0072925 3300048905 Bacteria 3156
161 Ga0496102_0156168 3300048905 Bacteria 2145
162 Ga0496103_0035266 3300048906 Bacteria 3062
163 Ga0496104_0006775 3300048907 Bacteria 10091
164 Ga0496104_0008027 3300048907 Bacteria 9361
165 Ga0496105_0051098 3300048908 Bacteria 3416
166 Ga0496105_0063554 3300048908 Bacteria 3045
167 Ga0496105_0659605 3300048908 Bacteria 806
168 Ga0496106_0013644 3300048909 Bacteria 5998
169 Ga0496106_0014063 3300048909 Bacteria 5913
170 Ga0496106_0224131 3300048909 Bacteria 1500
171 Ga0496107_0003141 3300048910 Bacteria 10984
172 Ga0496107_0020554 3300048910 Bacteria 4665
173 Ga0496108_0005291 3300048911 Bacteria 10416
174 Ga0496108_0264703 3300048911 Bacteria 1496
175 Ga0496109_0028757 3300048912 Bacteria 4976
176 Ga0496109_0062342 3300048912 Bacteria 3409
177 Ga0496109_0071193 3300048912 Bacteria 3192
178 Ga0496110_0060879 3300048913 Bacteria 3331
179 Ga0496110_0075854 3300048913 Bacteria 2988
180 Ga0496110_0570954 3300048913 Bacteria 1027
181 Ga0496111_0020116 3300048914 Bacteria 4643
182 Ga0496111_0031626 3300048914 Bacteria 3771
183 Ga0496111_0617978 3300048914 Bacteria 792
184 Ga0496112_0096255 3300048915 Bacteria 2931
185 Ga0496112_0309977 3300048915 Bacteria 1523
186 Ga0496113_0006375 3300048916 Bacteria 7468
187 Ga0496113_0097265 3300048916 Bacteria 2277
188 Ga0496113_0219010 3300048916 Bacteria 1517
189 Ga0496114_0255447 3300048917 Bacteria 1542
190 Ga0496115_0073867 3300048918 Bacteria 2768
191 Ga0496121_0007595 3300048924 Bacteria 13052
192 Ga0496126_0083444 3300048929 Bacteria 2820
193 Ga0501031_0134838 3300049568 Bacteria 1613
194 Ga0501033_0096491 3300049570 Bacteria 2160
195 Ga0501034_0031238 3300049571 Bacteria 5411
196 Ga0501034_0075989 3300049571 Bacteria 3366
197 Ga0501036_0129631 3300049572 Bacteria 2130
198 Ga0501036_0316621 3300049572 Bacteria 1304
199 Ga0501036_0419213 3300049572 Bacteria 1116
200 Ga0501036_0829028 3300049572 Bacteria 761
201 Ga0501037_0342717 3300049573 Bacteria 1032
202 Ga0501039_0078821 3300049575 Bacteria 2563
203 Ga0501039_0222771 3300049575 Bacteria 1483
204 Ga0501039_0408474 3300049575 Bacteria 1066
205 Ga0501040_0197462 3300049576 Bacteria 1428
206 Ga0501040_0354451 3300049576 Bacteria 1051
207 Ga0501041_0033691 3300049577 Bacteria 3100
208 Ga0501041_0060622 3300049577 Bacteria 2316
209 Ga0501041_0209276 3300049577 Bacteria 1223
210 Ga0501042_0139813 3300049578 Bacteria 1746
211 Ga0501042_0214694 3300049578 Bacteria 1388
212 Ga0501046_0050039 3300049580 Bacteria 3302
213 Ga0501046_0107062 3300049580 Bacteria 2139
214 Ga0501046_0241873 3300049580 Bacteria 1331
215 Ga0501047_0013713 3300049581 Bacteria 7694
216 Ga0501047_0080281 3300049581 Bacteria 3135
217 Ga0501047_0191530 3300049581 Bacteria 1908
218 Ga0501047_0231376 3300049581 Bacteria 1702
219 Ga0501048_0011117 3300049582 Bacteria 6711
220 Ga0501067_0015374 3300049583 Bacteria 4237
221 Ga0501067_0072485 3300049583 Bacteria 1908
222 Ga0501070_0050738 3300049586 Bacteria 3444
223 Ga0501070_0202656 3300049586 Bacteria 1629
224 Ga0501070_0528354 3300049586 Bacteria 946
225 Ga0501071_0058608 3300049587 Bacteria 2785
226 Ga0501072_0219047 3300049588 Bacteria 1517
227 Ga0501073_0030530 3300049589 Bacteria 3848
228 Ga0501074_0278363 3300049590 Bacteria 1190
229 Ga0501074_0713061 3300049590 Bacteria 708
230 Ga0501075_0017149 3300049591 Bacteria 5227
231 Ga0501075_0502285 3300049591 Bacteria 925
232 Ga0501076_0084534 3300049592 Bacteria 2549
233 Ga0501077_0043060 3300049593 Bacteria 2869
234 Ga0501077_0043383 3300049593 Bacteria 2859
235 Ga0501077_0121276 3300049593 Bacteria 1657
236 Ga0501079_0087883 3300049741 Bacteria 2406
237 Ga0501079_0089215 3300049741 Bacteria 2388
238 Ga0501079_0242577 3300049741 Bacteria 1408
239 Ga0501080_0133762 3300049742 Bacteria 2295
240 Ga0501080_0378009 3300049742 Bacteria 1277
241 Ga0501081_0010949 3300049743 Bacteria 5927
242 Ga0501081_0058620 3300049743 Bacteria 2665
243 Ga0501081_0406827 3300049743 Bacteria 1008
244 Ga0501081_0495616 3300049743 Bacteria 910
245 Ga0501083_0380086 3300049744 Bacteria 918
246 Ga0501035_0053845 3300049822 Bacteria 3597
247 Ga0501035_0116360 3300049822 Bacteria 2339
248 Ga0501044_0016875 3300049823 Bacteria 7834
249 Ga0501044_0106424 3300049823 Bacteria 2817
250 Ga0501044_0168752 3300049823 Bacteria 2161
251 Ga0501044_0219996 3300049823 Bacteria 1850
252 Ga0501045_0089336 3300049824 Bacteria 2276
253 Ga0501045_0539878 3300049824 Bacteria 865
254 nmdc:mga03n38_17105_c1 3300050490 Bacteria 2833
255 nmdc:mga00v17_8619_c1 3300050491 Bacteria 5491
256 nmdc:mga06z11_12730_c1 3300050494 Bacteria 3668
257 nmdc:mga06z11_1992_c1 3300050494 Bacteria 7729
258 nmdc:mga04h51_43278_c1 3300050495 Bacteria 1481
259 nmdc:mga04h51_5597_c1 3300050495 Bacteria 3209
260 nmdc:mga05p37_179825_c1 3300050507 Bacteria 2574
261 nmdc:mga05p37_197996_c1 3300050507 Bacteria 2435
262 nmdc:mga05p37_226937_c1 3300050507 Bacteria 2251
263 nmdc:mga05p37_260352_c1 3300050507 Bacteria 2076
264 nmdc:mga09592_21943_c1 3300050508 Bacteria 5266
265 nmdc:mga09592_438015_c1 3300050508 Bacteria 1128
266 nmdc:mga09592_682438_c1 3300050508 Bacteria 875
267 nmdc:mga09592_95076_c1 3300050508 Bacteria 2549
268 nmdc:mga0qj67_10579_c1 3300050509 Bacteria 6891
269 nmdc:mga0qj67_293_c1 3300050509 Bacteria 34938
270 nmdc:mga0qj67_416871_c1 3300050509 Bacteria 1083
271 nmdc:mga0qj67_71578_c1 3300050509 Bacteria 2768
272 nmdc:mga0qj67_93295_c1 3300050509 Bacteria 2420
273 nmdc:mga06r32_173124_c1 3300050510 Bacteria 2143
274 nmdc:mga06r32_175566_c1 3300050510 Bacteria 2127
275 nmdc:mga06r32_24317_c1 3300050510 Bacteria 5621
276 nmdc:mga06r32_533531_c1 3300050510 Bacteria 1149
277 nmdc:mga06r32_555093_c1 3300050510 Bacteria 1122
278 nmdc:mga06r32_7918_c1 3300050510 Bacteria 9554
279 nmdc:mga08y16_121960_c1 3300050511 Bacteria 2713
280 nmdc:mga08y16_183082_c1 3300050511 Bacteria 2174
281 nmdc:mga08y16_446791_c1 3300050511 Bacteria 1319
282 nmdc:mga08y16_99217_c1 3300050511 Bacteria 3032
283 nmdc:mga0n895_111887_c1 3300050512 Bacteria 2747
284 nmdc:mga0n895_14262_c1 3300050512 Bacteria 7211
285 nmdc:mga0rr50_116432_c1 3300050513 Bacteria 2122
286 nmdc:mga0rr50_14197_c1 3300050513 Bacteria 5216
287 nmdc:mga08x19_110076_c1 3300050514 Bacteria 1836
288 nmdc:mga0a205_1647_c1 3300050515 Bacteria 19196
289 nmdc:mga0a205_376697_c1 3300050515 Bacteria 1285
290 nmdc:mga0a205_639867_c1 3300050515 Bacteria 915
291 Ga0495601_0255869 3300053077 Bacteria 1143
292 Ga0495612_0115473 3300053078 Bacteria 1152
293 Ga0495595_0252247 3300053084 Bacteria 883
294 Ga0500595_052535 3300053119 Bacteria 1257
295 Ga0500652_000043 3300053131 Bacteria 64726
296 Ga0500616_0027897 3300053153 Bacteria 3115
297 Ga0500636_0103134 3300053177 Bacteria 1619
298 Ga0501084_0009341 3300054114 Bacteria 8114
299 Ga0501084_0232555 3300054114 Bacteria 1556
300 Ga0501082_0026911 3300060353 Bacteria 4955
301 Ga0501082_0518219 3300060353 Bacteria 1042
302 Ga0501082_0679695 3300060353 Bacteria 901
303 Ga0530510_0060387 3300061734 Bacteria 2743
304 Ga0530510_0227052 3300061734 Bacteria 1388
305 Ga0530510_0301091 3300061734 Bacteria 1200
306 Ga0530510_0386365 3300061734 Bacteria 1054

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100525546 Ga0068869_1005255461 196
2 3300042008 Ga0439450_012184 Ga0439450_012184_950_1570 200
3 3300045049 Ga0466959_0699001 Ga0466959_0699001_18_641 205
4 iso_pu_bacteria 2990088156 2990092647 205
5 3300049586 Ga0501070_0528354 Ga0501070_0528354_160_786 207
6 3300049589 Ga0501073_0030530 Ga0501073_0030530_1108_1734 207
7 iso_pu_bacteria 2862705112 2862708577 207
8 iso_pu_bacteria 2990044586 2990048298 207
9 iso_pu_bacteria 8008485437 8008491335 207
10 iso_pu_bacteria 8025524527 8025530665 207
11 3300005330 Ga0070690_100209876 Ga0070690_1002098762 209
12 3300005334 Ga0068869_100135815 Ga0068869_1001358151 209
13 3300005336 Ga0070680_100011093 Ga0070680_1000110934 209
14 3300005406 Ga0070703_10140104 Ga0070703_101401042 209
15 3300005438 Ga0070701_10002688 Ga0070701_100026888 209
16 3300005441 Ga0070700_100005181 Ga0070700_1000051813 209
17 3300005445 Ga0070708_100053259 Ga0070708_1000532594 209
18 3300005455 Ga0070663_100013406 Ga0070663_1000134062 209
19 3300005545 Ga0070695_100001347 Ga0070695_10000134712 209
20 3300005547 Ga0070693_100049499 Ga0070693_1000494994 209
21 3300005577 Ga0068857_100124753 Ga0068857_1001247534 209
22 3300005615 Ga0070702_100110123 Ga0070702_1001101232 209
23 3300005617 Ga0068859_100000897 Ga0068859_1000008972 209
24 3300005841 Ga0068863_100120516 Ga0068863_1001205164 209
25 3300005843 Ga0068860_100160042 Ga0068860_1001600422 209
26 3300005844 Ga0068862_100084776 Ga0068862_1000847762 209
27 3300006844 Ga0075428_100250628 Ga0075428_1002506282 209
28 3300006844 Ga0075428_100581689 Ga0075428_1005816892 209
29 3300006852 Ga0075433_10287343 Ga0075433_102873432 209
30 3300006931 Ga0097620_100000897 Ga0097620_10000089735 209
31 3300011119 Ga0105246_10031744 Ga0105246_100317444 209
32 3300025885 Ga0207653_10002066 Ga0207653_100020662 209
33 3300025912 Ga0207707_10050044 Ga0207707_100500444 209
34 3300025917 Ga0207660_10008002 Ga0207660_100080024 209
35 3300025942 Ga0207689_10154039 Ga0207689_101540392 209
36 3300025945 Ga0207679_10337396 Ga0207679_103373962 209
37 3300025961 Ga0207712_10011557 Ga0207712_100115574 209
38 3300026075 Ga0207708_10004787 Ga0207708_100047873 209
39 3300026088 Ga0207641_10104109 Ga0207641_101041092 209
40 3300026116 Ga0207674_10002699 Ga0207674_1000269915 209
41 3300028380 Ga0268265_10000395 Ga0268265_1000039514 209
42 3300034819 Ga0373958_0015788 Ga0373958_0015788_158_787 209
43 3300048905 Ga0496102_0004952 Ga0496102_0004952_9051_9680 209
44 3300048906 Ga0496103_0035266 Ga0496103_0035266_1693_2322 209
45 3300048909 Ga0496106_0014063 Ga0496106_0014063_3381_4010 209
46 3300048910 Ga0496107_0003141 Ga0496107_0003141_6341_6970 209
47 3300006846 Ga0075430_100003847 Ga0075430_1000038474 211
48 3300006847 Ga0075431_100003740 Ga0075431_1000037404 211
49 3300006852 Ga0075433_10120378 Ga0075433_101203784 211
50 3300046663 Ga0495635_0182142 Ga0495635_0182142_208_843 211
51 3300049590 Ga0501074_0713061 Ga0501074_0713061_20_655 211
52 3300053077 Ga0495601_0255869 Ga0495601_0255869_230_865 211
53 3300053078 Ga0495612_0115473 Ga0495612_0115473_200_835 211
54 3300061734 Ga0530510_0386365 Ga0530510_0386365_10_645 211
55 iso_pu_bacteria 2684623035 2686533874 211
56 iso_pu_bacteria 2687453743 2689995311 211
57 iso_pu_bacteria 2895880812 2895886494 211
58 3300031665 Ga0316575_10006417 Ga0316575_100064172 212
59 3300031691 Ga0316579_10008355 Ga0316579_100083552 212
60 3300031727 Ga0316576_10019615 Ga0316576_100196152 212
61 3300036647 Ga0316582_0298083 Ga0316582_0298083_296_1009 212
62 3300036712 Ga0316584_0005609 Ga0316584_0005609_2658_3371 212
63 3300049568 Ga0501031_0134838 Ga0501031_0134838_845_1510 212
64 3300005546 Ga0070696_100319762 Ga0070696_1003197622 213
65 3300005467 Ga0070706_100033816 Ga0070706_1000338162 214
66 3300025910 Ga0207684_10078056 Ga0207684_100780562 214
67 3300036401 Ga0373937_0420246 Ga0373937_0420246_428_1075 214
68 3300005336 Ga0070680_100005401 Ga0070680_1000054014 215
69 3300005458 Ga0070681_10011531 Ga0070681_100115318 215
70 3300005536 Ga0070697_100710686 Ga0070697_1007106862 215
71 3300005543 Ga0070672_100023540 Ga0070672_1000235405 215
72 3300009094 Ga0111539_10646200 Ga0111539_106462002 215
73 3300020069 Ga0197907_11021076 Ga0197907_110210762 215
74 3300020070 Ga0206356_11007371 Ga0206356_110073712 215
75 3300020081 Ga0206354_10406870 Ga0206354_104068702 215
76 3300020082 Ga0206353_10284142 Ga0206353_102841422 215
77 3300025909 Ga0207705_10007752 Ga0207705_100077529 215
78 3300025912 Ga0207707_10006735 Ga0207707_100067352 215
79 3300025917 Ga0207660_10004218 Ga0207660_100042186 215
80 3300025921 Ga0207652_10003668 Ga0207652_1000366812 215
81 3300025926 Ga0207659_10262083 Ga0207659_102620832 215
82 3300025940 Ga0207691_10033468 Ga0207691_100334685 215
83 3300037418 Ga0395900_0806980 Ga0395900_0806980_170_820 215
84 3300046524 Ga0495648_0035469 Ga0495648_0035469_312_974 215
85 3300047322 Ga0495680_0129282 Ga0495680_0129282_893_1543 215
86 3300048908 Ga0496105_0659605 Ga0496105_0659605_47_703 215
87 3300048911 Ga0496108_0264703 Ga0496108_0264703_163_819 215
88 3300048912 Ga0496109_0062342 Ga0496109_0062342_901_1557 215
89 3300048913 Ga0496110_0570954 Ga0496110_0570954_201_857 215
90 3300048914 Ga0496111_0617978 Ga0496111_0617978_28_684 215
91 3300049571 Ga0501034_0075989 Ga0501034_0075989_654_1304 215
92 3300049576 Ga0501040_0354451 Ga0501040_0354451_222_872 215
93 3300049580 Ga0501046_0107062 Ga0501046_0107062_835_1485 215
94 3300049581 Ga0501047_0080281 Ga0501047_0080281_912_1562 215
95 3300049581 Ga0501047_0191530 Ga0501047_0191530_422_1072 215
96 3300049583 Ga0501067_0015374 Ga0501067_0015374_2511_3161 215
97 3300049742 Ga0501080_0378009 Ga0501080_0378009_550_1200 215
98 3300049823 Ga0501044_0106424 Ga0501044_0106424_1170_1820 215
99 3300049823 Ga0501044_0219996 Ga0501044_0219996_972_1628 215
100 3300050511 nmdc:mga08y16_446791_c1 nmdc:mga08y16_446791_c1_351_1004 215
101 3300053084 Ga0495595_0252247 Ga0495595_0252247_42_692 215
102 iso_pu_bacteria 2671180195 2671837298 215
103 iso_pu_bacteria 2773857922 2774855454 215
104 3300006844 Ga0075428_100094957 Ga0075428_1000949572 216
105 3300009147 Ga0114129_10038575 Ga0114129_100385754 216
106 3300031251 Ga0265327_10003157 Ga0265327_1000315714 216
107 3300025972 Ga0207668_10405187 Ga0207668_104051872 217
108 3300049575 Ga0501039_0078821 Ga0501039_0078821_36_710 217
109 3300053119 Ga0500595_052535 Ga0500595_052535_251_904 217
110 3300053131 Ga0500652_000043 Ga0500652_000043_62388_63041 217
111 3300053177 Ga0500636_0103134 Ga0500636_0103134_587_1240 217
112 3300005440 Ga0070705_100000110 Ga0070705_10000011015 218
113 3300005444 Ga0070694_100000271 Ga0070694_10000027113 218
114 3300005518 Ga0070699_100000653 Ga0070699_10000065316 218
115 3300005546 Ga0070696_100000720 Ga0070696_10000072016 218
116 3300005549 Ga0070704_100002027 Ga0070704_10000202712 218
117 3300006846 Ga0075430_100001086 Ga0075430_1000010863 218
118 3300009147 Ga0114129_10241153 Ga0114129_102411532 218
119 3300014326 Ga0157380_11033599 Ga0157380_110335991 218
120 3300028381 Ga0268264_10014161 Ga0268264_100141611 218
121 3300031691 Ga0316579_10130079 Ga0316579_101300791 218
122 3300031852 Ga0307410_10795503 Ga0307410_107955031 218
123 3300031995 Ga0307409_100672064 Ga0307409_1006720641 218
124 3300048904 Ga0496101_0349859 Ga0496101_0349859_293_949 218
125 3300048910 Ga0496107_0020554 Ga0496107_0020554_1126_1782 218
126 3300048924 Ga0496121_0007595 Ga0496121_0007595_708_1364 218
127 3300048929 Ga0496126_0083444 Ga0496126_0083444_449_1105 218
128 3300049572 Ga0501036_0316621 Ga0501036_0316621_74_730 218
129 3300049573 Ga0501037_0342717 Ga0501037_0342717_259_942 218
130 3300049575 Ga0501039_0222771 Ga0501039_0222771_16_672 218
131 3300049575 Ga0501039_0408474 Ga0501039_0408474_158_814 218
132 3300049577 Ga0501041_0209276 Ga0501041_0209276_473_1129 218
133 3300049578 Ga0501042_0139813 Ga0501042_0139813_270_926 218
134 3300049578 Ga0501042_0214694 Ga0501042_0214694_94_750 218
135 3300049580 Ga0501046_0050039 Ga0501046_0050039_2348_3004 218
136 3300049586 Ga0501070_0202656 Ga0501070_0202656_464_1147 218
137 3300049591 Ga0501075_0502285 Ga0501075_0502285_26_682 218
138 3300049593 Ga0501077_0043383 Ga0501077_0043383_1018_1674 218
139 3300049741 Ga0501079_0089215 Ga0501079_0089215_686_1342 218
140 3300049743 Ga0501081_0058620 Ga0501081_0058620_71_727 218
141 3300049822 Ga0501035_0116360 Ga0501035_0116360_1624_2307 218
142 3300049824 Ga0501045_0089336 Ga0501045_0089336_1025_1681 218
143 3300050507 nmdc:mga05p37_179825_c1 nmdc:mga05p37_179825_c1_727_1389 218
144 3300050507 nmdc:mga05p37_226937_c1 nmdc:mga05p37_226937_c1_612_1268 218
145 3300050508 nmdc:mga09592_95076_c1 nmdc:mga09592_95076_c1_531_1187 218
146 3300050509 nmdc:mga0qj67_293_c1 nmdc:mga0qj67_293_c1_6384_7040 218
147 3300050509 nmdc:mga0qj67_416871_c1 nmdc:mga0qj67_416871_c1_48_710 218
148 3300050509 nmdc:mga0qj67_71578_c1 nmdc:mga0qj67_71578_c1_1913_2569 218
149 3300050510 nmdc:mga06r32_175566_c1 nmdc:mga06r32_175566_c1_109_765 218
150 3300050510 nmdc:mga06r32_533531_c1 nmdc:mga06r32_533531_c1_200_856 218
151 3300050511 nmdc:mga08y16_183082_c1 nmdc:mga08y16_183082_c1_1296_1952 218
152 3300054114 Ga0501084_0232555 Ga0501084_0232555_575_1231 218
153 3300061734 Ga0530510_0227052 Ga0530510_0227052_58_714 218
154 3300005328 Ga0070676_10206780 Ga0070676_102067802 219
155 3300005347 Ga0070668_100025461 Ga0070668_1000254612 219
156 3300005347 Ga0070668_100223558 Ga0070668_1002235581 219
157 3300005366 Ga0070659_100363727 Ga0070659_1003637272 219
158 3300005440 Ga0070705_100013550 Ga0070705_1000135504 219
159 3300006042 Ga0075368_10023161 Ga0075368_100231612 219
160 3300006048 Ga0075363_100003600 Ga0075363_1000036007 219
161 3300006178 Ga0075367_10009204 Ga0075367_100092043 219
162 3300006880 Ga0075429_100257420 Ga0075429_1002574202 219
163 3300009147 Ga0114129_10195539 Ga0114129_101955392 219
164 3300025921 Ga0207652_10116264 Ga0207652_101162642 219
165 3300025972 Ga0207668_10469522 Ga0207668_104695222 219
166 3300026035 Ga0207703_10276280 Ga0207703_102762802 219
167 3300027866 Ga0209813_10014000 Ga0209813_100140002 219
168 3300028380 Ga0268265_10010728 Ga0268265_100107284 219
169 3300048907 Ga0496104_0008027 Ga0496104_0008027_5676_6335 219
170 3300048908 Ga0496105_0051098 Ga0496105_0051098_1670_2329 219
171 3300048911 Ga0496108_0005291 Ga0496108_0005291_6332_6991 219
172 3300048912 Ga0496109_0028757 Ga0496109_0028757_1128_1787 219
173 3300048913 Ga0496110_0060879 Ga0496110_0060879_1957_2616 219
174 3300048915 Ga0496112_0309977 Ga0496112_0309977_667_1326 219
175 3300048916 Ga0496113_0006375 Ga0496113_0006375_607_1266 219
176 3300049570 Ga0501033_0096491 Ga0501033_0096491_1139_1798 219
177 3300049571 Ga0501034_0031238 Ga0501034_0031238_811_1470 219
178 3300049572 Ga0501036_0419213 Ga0501036_0419213_236_895 219
179 3300049581 Ga0501047_0013713 Ga0501047_0013713_6504_7163 219
180 3300049582 Ga0501048_0011117 Ga0501048_0011117_5064_5738 219
181 3300049822 Ga0501035_0053845 Ga0501035_0053845_2903_3562 219
182 3300049823 Ga0501044_0016875 Ga0501044_0016875_4390_5049 219
183 3300050490 nmdc:mga03n38_17105_c1 nmdc:mga03n38_17105_c1_842_1513 219
184 3300050494 nmdc:mga06z11_1992_c1 nmdc:mga06z11_1992_c1_3907_4578 219
185 3300050495 nmdc:mga04h51_5597_c1 nmdc:mga04h51_5597_c1_1589_2260 219
186 3300050507 nmdc:mga05p37_197996_c1 nmdc:mga05p37_197996_c1_1528_2187 219
187 3300050508 nmdc:mga09592_438015_c1 nmdc:mga09592_438015_c1_205_864 219
188 3300050510 nmdc:mga06r32_173124_c1 nmdc:mga06r32_173124_c1_432_1091 219
189 3300053153 Ga0500616_0027897 Ga0500616_0027897_944_1609 219
190 3300003911 JGI25405J52794_10029314 JGI25405J52794_100293142 220
191 3300005341 Ga0070691_10014062 Ga0070691_100140622 220
192 3300005353 Ga0070669_100146726 Ga0070669_1001467262 220
193 3300005441 Ga0070700_100008573 Ga0070700_1000085736 220
194 3300005719 Ga0068861_100192336 Ga0068861_1001923361 220
195 3300005841 Ga0068863_100118892 Ga0068863_1001188922 220
196 3300005937 Ga0081455_10001600 Ga0081455_1000160024 220
197 3300005983 Ga0081540_1002271 Ga0081540_100227117 220
198 3300005983 Ga0081540_1040628 Ga0081540_10406284 220
199 3300005983 Ga0081540_1121463 Ga0081540_11214632 220
200 3300005985 Ga0081539_10028445 Ga0081539_100284454 220
201 3300006051 Ga0075364_10024925 Ga0075364_100249252 220
202 3300006178 Ga0075367_10019901 Ga0075367_100199013 220
203 3300006178 Ga0075367_10077317 Ga0075367_100773172 220
204 3300006844 Ga0075428_100503397 Ga0075428_1005033972 220
205 3300006846 Ga0075430_100292259 Ga0075430_1002922592 220
206 3300006847 Ga0075431_100001007 Ga0075431_1000010073 220
207 3300006847 Ga0075431_100289633 Ga0075431_1002896332 220
208 3300006852 Ga0075433_10014493 Ga0075433_100144938 220
209 3300006852 Ga0075433_10173900 Ga0075433_101739002 220
210 3300006871 Ga0075434_100002734 Ga0075434_1000027348 220
211 3300006871 Ga0075434_100188992 Ga0075434_1001889922 220
212 3300006880 Ga0075429_100033729 Ga0075429_1000337293 220
213 3300006880 Ga0075429_100143811 Ga0075429_1001438112 220
214 3300006914 Ga0075436_100115023 Ga0075436_1001150233 220
215 3300007076 Ga0075435_100006275 Ga0075435_10000627511 220
216 3300007076 Ga0075435_100038567 Ga0075435_1000385675 220
217 3300007076 Ga0075435_100363360 Ga0075435_1003633602 220
218 3300009094 Ga0111539_10006991 Ga0111539_1000699120 220
219 3300009094 Ga0111539_10033078 Ga0111539_100330786 220
220 3300009094 Ga0111539_10202437 Ga0111539_102024371 220
221 3300009094 Ga0111539_10323600 Ga0111539_103236003 220
222 3300009094 Ga0111539_10615922 Ga0111539_106159222 220
223 3300009098 Ga0105245_10032391 Ga0105245_100323913 220
224 3300009098 Ga0105245_10841468 Ga0105245_108414682 220
225 3300009101 Ga0105247_10274473 Ga0105247_102744732 220
226 3300009147 Ga0114129_10090617 Ga0114129_100906175 220
227 3300013306 Ga0163162_10168103 Ga0163162_101681032 220
228 3300013308 Ga0157375_10401809 Ga0157375_104018091 220
229 3300014968 Ga0157379_10064957 Ga0157379_100649575 220
230 3300025900 Ga0207710_10132148 Ga0207710_101321482 220
231 3300025923 Ga0207681_10129313 Ga0207681_101293132 220
232 3300025927 Ga0207687_10041635 Ga0207687_100416352 220
233 3300026075 Ga0207708_10022899 Ga0207708_100228995 220
234 3300026118 Ga0207675_100187365 Ga0207675_1001873653 220
235 3300026118 Ga0207675_100248595 Ga0207675_1002485952 220
236 3300027907 Ga0207428_10146528 Ga0207428_101465282 220
237 3300035092 Ga0373952_0012524 Ga0373952_0012524_735_1397 220
238 3300035114 Ga0373939_0054500 Ga0373939_0054500_80_748 220
239 3300035241 Ga0373961_0004287 Ga0373961_0004287_1099_1761 220
240 3300035242 Ga0373962_0120489 Ga0373962_0120489_107_775 220
241 3300035691 Ga0373931_0005278 Ga0373931_0005278_24_692 220
242 3300035691 Ga0373931_0134939 Ga0373931_0134939_484_1146 220
243 3300035691 Ga0373931_0241362 Ga0373931_0241362_200_862 220
244 3300035695 Ga0373927_0553193 Ga0373927_0553193_24_686 220
245 3300036401 Ga0373937_0232264 Ga0373937_0232264_139_801 220
246 3300039437 Ga0436365_1230432 Ga0436365_1230432_189_860 220
247 3300046455 Ga0495603_0208455 Ga0495603_0208455_325_987 220
248 3300046529 Ga0495652_0361004 Ga0495652_0361004_171_833 220
249 3300048904 Ga0496101_0200844 Ga0496101_0200844_53_715 220
250 3300048905 Ga0496102_0072925 Ga0496102_0072925_1427_2089 220
251 3300048905 Ga0496102_0156168 Ga0496102_0156168_591_1253 220
252 3300048907 Ga0496104_0006775 Ga0496104_0006775_273_935 220
253 3300048908 Ga0496105_0063554 Ga0496105_0063554_565_1227 220
254 3300048909 Ga0496106_0013644 Ga0496106_0013644_822_1484 220
255 3300048909 Ga0496106_0224131 Ga0496106_0224131_355_1017 220
256 3300048912 Ga0496109_0071193 Ga0496109_0071193_117_779 220
257 3300048913 Ga0496110_0075854 Ga0496110_0075854_1295_1957 220
258 3300048914 Ga0496111_0020116 Ga0496111_0020116_2345_3007 220
259 3300048914 Ga0496111_0031626 Ga0496111_0031626_1826_2488 220
260 3300048915 Ga0496112_0096255 Ga0496112_0096255_1214_1876 220
261 3300048916 Ga0496113_0097265 Ga0496113_0097265_548_1210 220
262 3300048916 Ga0496113_0219010 Ga0496113_0219010_111_773 220
263 3300048917 Ga0496114_0255447 Ga0496114_0255447_764_1426 220
264 3300048918 Ga0496115_0073867 Ga0496115_0073867_1592_2254 220
265 3300049572 Ga0501036_0129631 Ga0501036_0129631_740_1402 220
266 3300049572 Ga0501036_0829028 Ga0501036_0829028_16_678 220
267 3300049576 Ga0501040_0197462 Ga0501040_0197462_289_951 220
268 3300049577 Ga0501041_0033691 Ga0501041_0033691_1995_2657 220
269 3300049577 Ga0501041_0060622 Ga0501041_0060622_69_731 220
270 3300049580 Ga0501046_0241873 Ga0501046_0241873_505_1167 220
271 3300049581 Ga0501047_0231376 Ga0501047_0231376_167_829 220
272 3300049583 Ga0501067_0072485 Ga0501067_0072485_484_1146 220
273 3300049586 Ga0501070_0050738 Ga0501070_0050738_272_934 220
274 3300049587 Ga0501071_0058608 Ga0501071_0058608_1429_2091 220
275 3300049588 Ga0501072_0219047 Ga0501072_0219047_279_941 220
276 3300049590 Ga0501074_0278363 Ga0501074_0278363_276_938 220
277 3300049591 Ga0501075_0017149 Ga0501075_0017149_563_1225 220
278 3300049592 Ga0501076_0084534 Ga0501076_0084534_234_896 220
279 3300049593 Ga0501077_0043060 Ga0501077_0043060_1031_1693 220
280 3300049593 Ga0501077_0121276 Ga0501077_0121276_370_1032 220
281 3300049741 Ga0501079_0087883 Ga0501079_0087883_383_1045 220
282 3300049741 Ga0501079_0242577 Ga0501079_0242577_510_1172 220
283 3300049742 Ga0501080_0133762 Ga0501080_0133762_960_1622 220
284 3300049743 Ga0501081_0010949 Ga0501081_0010949_4184_4846 220
285 3300049743 Ga0501081_0406827 Ga0501081_0406827_238_900 220
286 3300049743 Ga0501081_0495616 Ga0501081_0495616_122_784 220
287 3300049744 Ga0501083_0380086 Ga0501083_0380086_71_733 220
288 3300049823 Ga0501044_0168752 Ga0501044_0168752_844_1506 220
289 3300049824 Ga0501045_0539878 Ga0501045_0539878_41_703 220
290 3300050491 nmdc:mga00v17_8619_c1 nmdc:mga00v17_8619_c1_2944_3606 220
291 3300050494 nmdc:mga06z11_12730_c1 nmdc:mga06z11_12730_c1_2666_3328 220
292 3300050495 nmdc:mga04h51_43278_c1 nmdc:mga04h51_43278_c1_52_714 220
293 3300050507 nmdc:mga05p37_260352_c1 nmdc:mga05p37_260352_c1_1380_2042 220
294 3300050508 nmdc:mga09592_21943_c1 nmdc:mga09592_21943_c1_2423_3085 220
295 3300050508 nmdc:mga09592_682438_c1 nmdc:mga09592_682438_c1_187_849 220
296 3300050509 nmdc:mga0qj67_10579_c1 nmdc:mga0qj67_10579_c1_5996_6658 220
297 3300050509 nmdc:mga0qj67_93295_c1 nmdc:mga0qj67_93295_c1_781_1443 220
298 3300050510 nmdc:mga06r32_24317_c1 nmdc:mga06r32_24317_c1_4898_5560 220
299 3300050510 nmdc:mga06r32_555093_c1 nmdc:mga06r32_555093_c1_193_855 220
300 3300050510 nmdc:mga06r32_7918_c1 nmdc:mga06r32_7918_c1_2828_3490 220
301 3300050511 nmdc:mga08y16_121960_c1 nmdc:mga08y16_121960_c1_280_948 220
302 3300050511 nmdc:mga08y16_99217_c1 nmdc:mga08y16_99217_c1_1941_2603 220
303 3300050512 nmdc:mga0n895_111887_c1 nmdc:mga0n895_111887_c1_1187_1849 220
304 3300050512 nmdc:mga0n895_14262_c1 nmdc:mga0n895_14262_c1_5012_5680 220
305 3300050513 nmdc:mga0rr50_116432_c1 nmdc:mga0rr50_116432_c1_1126_1800 220
306 3300050513 nmdc:mga0rr50_14197_c1 nmdc:mga0rr50_14197_c1_4524_5192 220
307 3300050514 nmdc:mga08x19_110076_c1 nmdc:mga08x19_110076_c1_145_819 220
308 3300050515 nmdc:mga0a205_1647_c1 nmdc:mga0a205_1647_c1_8219_8887 220
309 3300050515 nmdc:mga0a205_376697_c1 nmdc:mga0a205_376697_c1_113_775 220
310 3300050515 nmdc:mga0a205_639867_c1 nmdc:mga0a205_639867_c1_96_758 220
311 3300054114 Ga0501084_0009341 Ga0501084_0009341_3086_3748 220
312 3300060353 Ga0501082_0026911 Ga0501082_0026911_44_706 220
313 3300060353 Ga0501082_0518219 Ga0501082_0518219_41_703 220
314 3300060353 Ga0501082_0679695 Ga0501082_0679695_45_707 220
315 3300061734 Ga0530510_0060387 Ga0530510_0060387_1226_1888 220
316 3300061734 Ga0530510_0301091 Ga0530510_0301091_494_1156 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

69

224

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fva-assembly2.cif.gz_B crystal structure of bovine methionine sulfoxide reductase 0.9745 12 211
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9732 9 199
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9682 9 199
1ff3-assembly3.cif.gz_C structure of the peptide methionine sulfoxide reductase from escherichia coli 0.967 11 194
1fva-assembly2.cif.gz_B crystal structure of bovine methionine sulfoxide reductase 0.9603 12 211
ID Description Score Start End Superfamily
af_P0A084_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.959 44 198 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9563 46 195 3.30.1060.10
3e0mA01 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9457 46 203 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9374 46 195 3.30.1060.10
af_A4HTE0_2_175_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9367 44 202 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A1G0KCH0-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.9856 35 185 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A450UUA4-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9849 48 210 GO:0005737
GO:0008113
GO:0034599
GO:0036211
GO:0036456
AF-A0A3C1N8T3-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.9838 45 210 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A381NS22-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9831 9 212 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-E1VQ90-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9826 10 209 GO:0005737
GO:0008113
GO:0034599
GO:0036211
GO:0036456

Feature Viewer

pLDDT pTM Quality
89.16 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map