F403574

General Info

Members Datasets Scaffolds Average Seq Length
316 156 316 234

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100011535|Ga0070697_1000115356
Length 273
Sequence VNCFVSGMAALRFGEEYSQKVMTSSLSTAGIRSVLLDIEGTTTPIAFVHDVLFSYARSWVREYLAEHFDSAELHADLARLRDEHAADLKQNLQPPALVDGSRDDRIDSIVAYVNWLMDHDRKSTGLKSLQGKIWRDGYLDGTLKAQLFPDVAPALERWRRADLKISIFSSGSSLAQKLLFAHTEAGDLTKFIGNYFDTTVGLKTDAESYRQIAAALCLPGNEVLFISDVVNELDAASTAGMQTLLCVRPGNPPQGYRERYQIIQSFNEISLSE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
134 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
146 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
147 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.63
Rhizosphere 99.05
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_784511 2162886007 Bacteria 2624
2 MRS1b_contig_7155089 2162886011 Bacteria 2609
3 MBSR1b_contig_1070090 2162886012 Bacteria 1746
4 JGI24751J29686_10000032 3300002459 Bacteria 87712
5 rootL2_10030281 3300003322 Unclassified 1300
6 Ga0065714_10002189 3300005288 Bacteria 128055
7 Ga0065704_10003530 3300005289 Bacteria 7016
8 Ga0065712_10003533 3300005290 Bacteria 5591
9 Ga0065712_10067733 3300005290 Bacteria 118568
10 Ga0065712_10078834 3300005290 Unclassified 3294
11 Ga0065715_10003708 3300005293 Bacteria 5318
12 Ga0065715_10089141 3300005293 Bacteria 13620
13 Ga0065715_10105455 3300005293 Bacteria 2876
14 Ga0065707_10083493 3300005295 Bacteria 8959
15 Ga0065707_10158078 3300005295 Bacteria 1584
16 Ga0065707_10234803 3300005295 Unclassified 1176
17 Ga0065707_10328278 3300005295 Bacteria 948
18 Ga0070676_10002841 3300005328 Bacteria 8946
19 Ga0070690_100010954 3300005330 Bacteria 5292
20 Ga0070690_100075434 3300005330 Bacteria 2198
21 Ga0070690_100550932 3300005330 Bacteria 869
22 Ga0070670_100000071 3300005331 Bacteria 102454
23 Ga0070670_100244599 3300005331 Bacteria 1562
24 Ga0068869_100109990 3300005334 Bacteria 2095
25 Ga0068869_100216998 3300005334 Unclassified 1514
26 Ga0068869_100288929 3300005334 Bacteria 1321
27 Ga0070680_100020912 3300005336 Bacteria 5195
28 Ga0070682_100009642 3300005337 Bacteria 5466
29 Ga0070682_100087221 3300005337 Unclassified 2034
30 Ga0070687_100069926 3300005343 Unclassified 1881
31 Ga0070687_100118713 3300005343 Unclassified 1509
32 Ga0070687_100168745 3300005343 Bacteria 1301
33 Ga0070692_10024084 3300005345 Bacteria 2989
34 Ga0070692_10084403 3300005345 Unclassified 1716
35 Ga0070692_10149866 3300005345 Unclassified 1328
36 Ga0070669_100085375 3300005353 Bacteria 2357
37 Ga0070705_100025594 3300005440 Bacteria 3201
38 Ga0070705_100141450 3300005440 Bacteria 1584
39 Ga0070700_100000118 3300005441 Bacteria 49489
40 Ga0070700_100244805 3300005441 Bacteria 1283
41 Ga0070700_100291739 3300005441 Bacteria 1187
42 Ga0070694_100002598 3300005444 Bacteria 10674
43 Ga0070694_100019737 3300005444 Unclassified 4289
44 Ga0070694_100098352 3300005444 Bacteria 2066
45 Ga0070694_100125872 3300005444 Unclassified 1845
46 Ga0070708_100254141 3300005445 Unclassified 1651
47 Ga0070681_10034051 3300005458 Bacteria 5115
48 Ga0068867_100107721 3300005459 Bacteria 2136
49 Ga0070685_10190670 3300005466 Unclassified 1326
50 Ga0070706_100002870 3300005467 Bacteria 17170
51 Ga0070707_100140087 3300005468 Unclassified 2354
52 Ga0070707_100272794 3300005468 Bacteria 1644
53 Ga0070698_100002938 3300005471 Bacteria 18748
54 Ga0070698_100004473 3300005471 Bacteria 15365
55 Ga0070698_100378462 3300005471 Bacteria 1348
56 Ga0070698_100496500 3300005471 Bacteria 1158
57 Ga0070699_100010566 3300005518 Bacteria 7991
58 Ga0070699_100033600 3300005518 Bacteria 4431
59 Ga0070699_100233032 3300005518 Unclassified 1642
60 Ga0070699_100259536 3300005518 Bacteria 1554
61 Ga0070697_100011535 3300005536 Bacteria 6905
62 Ga0068853_100264376 3300005539 Unclassified 1583
63 Ga0070672_100449070 3300005543 Bacteria 1110
64 Ga0070686_100066305 3300005544 Bacteria 2348
65 Ga0070686_100383004 3300005544 Bacteria 1065
66 Ga0070695_100205409 3300005545 Unclassified 1410
67 Ga0070695_100298345 3300005545 Bacteria 1190
68 Ga0070695_100538104 3300005545 Bacteria 909
69 Ga0070696_100003027 3300005546 Bacteria 11157
70 Ga0070696_100004142 3300005546 Bacteria 9665
71 Ga0070696_100056268 3300005546 Bacteria 2743
72 Ga0070696_100109941 3300005546 Bacteria 1984
73 Ga0070696_100356562 3300005546 Unclassified 1134
74 Ga0070693_100004094 3300005547 Bacteria 6864
75 Ga0070693_100040774 3300005547 Bacteria 2608
76 Ga0070693_100125743 3300005547 Unclassified 1596
77 Ga0070704_100005991 3300005549 Bacteria 7129
78 Ga0070704_100022334 3300005549 Bacteria 4115
79 Ga0070704_100058661 3300005549 Unclassified 2742
80 Ga0070704_100077320 3300005549 Bacteria 2438
81 Ga0070704_100085402 3300005549 Bacteria 2336
82 Ga0068857_100055428 3300005577 Bacteria 3518
83 Ga0068857_100126468 3300005577 Bacteria 2303
84 Ga0068854_100179952 3300005578 Bacteria 1651
85 Ga0068854_100186941 3300005578 Bacteria 1621
86 Ga0068854_100493732 3300005578 Bacteria 1030
87 Ga0068854_100843510 3300005578 Unclassified 802
88 Ga0070702_100083238 3300005615 Bacteria 1921
89 Ga0070702_100091848 3300005615 Unclassified 1843
90 Ga0070702_100339440 3300005615 Unclassified 1054
91 Ga0068852_100172959 3300005616 Unclassified 2026
92 Ga0068859_100012408 3300005617 Bacteria 8572
93 Ga0068859_100015003 3300005617 Bacteria 7776
94 Ga0068859_100024440 3300005617 Bacteria 6061
95 Ga0068859_100033963 3300005617 Bacteria 5121
96 Ga0068859_100099729 3300005617 Bacteria 2960
97 Ga0068859_100126512 3300005617 Bacteria 2624
98 Ga0068859_100141586 3300005617 Bacteria 2479
99 Ga0068859_100149969 3300005617 Bacteria 2407
100 Ga0068859_100183979 3300005617 Bacteria 2173
101 Ga0068864_100364514 3300005618 Bacteria 1366
102 Ga0068864_100533678 3300005618 Bacteria 1132
103 Ga0068861_100127440 3300005719 Bacteria 2062
104 Ga0068861_100134703 3300005719 Bacteria 2009
105 Ga0068851_10000692 3300005834 Bacteria 14366
106 Ga0068870_10168249 3300005840 Unclassified 1306
107 Ga0068870_10211743 3300005840 Unclassified 1181
108 Ga0068863_100165526 3300005841 Bacteria 2120
109 Ga0068863_100456319 3300005841 Bacteria 1255
110 Ga0068863_100567148 3300005841 Bacteria 1122
111 Ga0068858_100055172 3300005842 Unclassified 3673
112 Ga0068858_100127230 3300005842 Bacteria 2387
113 Ga0068858_100411573 3300005842 Bacteria 1300
114 Ga0068858_100836820 3300005842 Unclassified 898
115 Ga0068860_100059702 3300005843 Bacteria 3625
116 Ga0068860_100065366 3300005843 Bacteria 3454
117 Ga0068860_100164910 3300005843 Bacteria 2138
118 Ga0068862_100193192 3300005844 Bacteria 1833
119 Ga0068862_100311648 3300005844 Bacteria 1450
120 Ga0070716_100000009 3300006173 Bacteria 173295
121 Ga0097621_100001839 3300006237 Bacteria 14544
122 Ga0068871_100008876 3300006358 Bacteria 7248
123 Ga0075430_100277571 3300006846 Unclassified 1386
124 Ga0075431_100335414 3300006847 Unclassified 1522
125 Ga0075433_10025467 3300006852 Bacteria 5001
126 Ga0075433_10093744 3300006852 Bacteria 2657
127 Ga0075433_10301883 3300006852 Unclassified 1418
128 Ga0075434_100088915 3300006871 Bacteria 3091
129 Ga0075429_100006434 3300006880 Bacteria 10172
130 Ga0097620_100012408 3300006931 Bacteria 8572
131 Ga0097620_100015003 3300006931 Bacteria 7776
132 Ga0097620_100024441 3300006931 Bacteria 6061
133 Ga0097620_100033967 3300006931 Bacteria 5121
134 Ga0097620_100099727 3300006931 Bacteria 2960
135 Ga0097620_100126509 3300006931 Bacteria 2624
136 Ga0097620_100141584 3300006931 Bacteria 2479
137 Ga0097620_100149959 3300006931 Bacteria 2407
138 Ga0097620_100183985 3300006931 Bacteria 2173
139 Ga0105251_10052693 3300009011 Bacteria 1936
140 Ga0105251_10131190 3300009011 Bacteria 1135
141 Ga0105250_10099739 3300009092 Bacteria 1185
142 Ga0105240_10422552 3300009093 Bacteria 1497
143 Ga0111539_10002546 3300009094 Bacteria 24141
144 Ga0111539_10005527 3300009094 Bacteria 16347
145 Ga0111539_10030262 3300009094 Bacteria 6583
146 Ga0111539_10053674 3300009094 Bacteria 4798
147 Ga0111539_11002507 3300009094 Unclassified 971
148 Ga0105247_10004753 3300009101 Bacteria 8647
149 Ga0105247_10014184 3300009101 Bacteria 4781
150 Ga0105247_10207055 3300009101 Bacteria 1321
151 Ga0114129_10010169 3300009147 Bacteria 13414
152 Ga0114129_10085059 3300009147 Bacteria 4388
153 Ga0114129_10194649 3300009147 Bacteria 2750
154 Ga0114129_10361661 3300009147 Unclassified 1920
155 Ga0105243_10156492 3300009148 Unclassified 1960
156 Ga0105241_10090954 3300009174 Unclassified 2407
157 Ga0105248_10007908 3300009177 Bacteria 11684
158 Ga0105248_10016729 3300009177 Bacteria 8075
159 Ga0105248_10087405 3300009177 Bacteria 3508
160 Ga0105248_10489388 3300009177 Bacteria 1387
161 Ga0105248_10514955 3300009177 Unclassified 1349
162 Ga0105237_10006137 3300009545 Bacteria 13433
163 Ga0105237_10017173 3300009545 Bacteria 7506
164 Ga0105238_10009259 3300009551 Bacteria 9856
165 Ga0105238_10025409 3300009551 Bacteria 6038
166 Ga0105249_10019254 3300009553 Bacteria 6087
167 Ga0105249_10030262 3300009553 Bacteria 4894
168 Ga0105249_10039142 3300009553 Bacteria 4305
169 Ga0105249_10061889 3300009553 Bacteria 3435
170 Ga0105249_10244098 3300009553 Unclassified 1777
171 Ga0105249_10883691 3300009553 Unclassified 960
172 Ga0105239_10087545 3300010375 Unclassified 3434
173 Ga0105239_10999746 3300010375 Unclassified 962
174 Ga0105239_11234320 3300010375 Bacteria 862
175 Ga0105246_10012918 3300011119 Bacteria 5224
176 Ga0157373_10178496 3300013100 Bacteria 1495
177 Ga0157373_10234141 3300013100 Bacteria 1297
178 Ga0157378_10135057 3300013297 Unclassified 2287
179 Ga0157378_10226719 3300013297 Bacteria 1779
180 Ga0163162_11497999 3300013306 Bacteria 768
181 Ga0157372_10017101 3300013307 Bacteria 7784
182 Ga0157375_10007033 3300013308 Bacteria 9829
183 Ga0163163_10000062 3300014325 Bacteria 119109
184 Ga0157380_10037134 3300014326 Bacteria 3773
185 Ga0157380_10062593 3300014326 Bacteria 2981
186 Ga0157380_10689551 3300014326 Bacteria 1025
187 Ga0157379_10021256 3300014968 Bacteria 5743
188 Ga0157379_10031160 3300014968 Bacteria 4750
189 Ga0157379_10329507 3300014968 Bacteria 1395
190 Ga0157376_10856940 3300014969 Unclassified 924
191 Ga0207656_10000416 3300025321 Bacteria 14366
192 Ga0207653_10053101 3300025885 Bacteria 1353
193 Ga0207710_10003849 3300025900 Bacteria 6634
194 Ga0207710_10107050 3300025900 Bacteria 1324
195 Ga0207647_10060869 3300025904 Bacteria 2306
196 Ga0207699_10000002 3300025906 Bacteria 662194
197 Ga0207699_10491410 3300025906 Bacteria 885
198 Ga0207645_10056447 3300025907 Bacteria 2507
199 Ga0207643_10078901 3300025908 Bacteria 1905
200 Ga0207684_10025518 3300025910 Bacteria 5037
201 Ga0207684_10093261 3300025910 Unclassified 2567
202 Ga0207654_10100359 3300025911 Unclassified 1782
203 Ga0207654_10141010 3300025911 Unclassified 1537
204 Ga0207707_10006240 3300025912 Bacteria 10414
205 Ga0207695_10247053 3300025913 Bacteria 1684
206 Ga0207695_10603172 3300025913 Bacteria 979
207 Ga0207671_10003255 3300025914 Bacteria 16336
208 Ga0207671_10064427 3300025914 Bacteria 2725
209 Ga0207660_10037153 3300025917 Bacteria 3392
210 Ga0207662_10017239 3300025918 Bacteria 4083
211 Ga0207662_10097329 3300025918 Bacteria 1819
212 Ga0207662_10106182 3300025918 Bacteria 1746
213 Ga0207652_10193130 3300025921 Bacteria 1831
214 Ga0207646_10117574 3300025922 Unclassified 2388
215 Ga0207646_10145455 3300025922 Unclassified 2136
216 Ga0207646_10230411 3300025922 Bacteria 1673
217 Ga0207694_10008928 3300025924 Bacteria 7567
218 Ga0207694_10093564 3300025924 Unclassified 2374
219 Ga0207650_10000006 3300025925 Bacteria 544730
220 Ga0207709_10050194 3300025935 Unclassified 2550
221 Ga0207709_10495678 3300025935 Bacteria 952
222 Ga0207670_10305086 3300025936 Bacteria 1248
223 Ga0207670_10672201 3300025936 Unclassified 855
224 Ga0207665_10000001 3300025939 Bacteria 279842
225 Ga0207711_10011345 3300025941 Bacteria 7402
226 Ga0207711_10028793 3300025941 Bacteria 4678
227 Ga0207711_10031074 3300025941 Bacteria 4506
228 Ga0207711_10313036 3300025941 Bacteria 1449
229 Ga0207689_10093790 3300025942 Bacteria 2466
230 Ga0207679_10137936 3300025945 Bacteria 1967
231 Ga0207651_10090585 3300025960 Bacteria 2236
232 Ga0207651_10307927 3300025960 Bacteria 1320
233 Ga0207651_10665296 3300025960 Bacteria 915
234 Ga0207712_10030464 3300025961 Unclassified 3628
235 Ga0207712_10263442 3300025961 Bacteria 1399
236 Ga0207640_10071280 3300025981 Bacteria 2340
237 Ga0207640_10163274 3300025981 Bacteria 1651
238 Ga0207640_10219667 3300025981 Bacteria 1454
239 Ga0207703_10027423 3300026035 Bacteria 4486
240 Ga0207703_10053597 3300026035 Bacteria 3279
241 Ga0207703_10085321 3300026035 Unclassified 2642
242 Ga0207703_10531713 3300026035 Bacteria 1107
243 Ga0207708_10000037 3300026075 Bacteria 137489
244 Ga0207708_10012783 3300026075 Bacteria 6261
245 Ga0207708_10015749 3300026075 Bacteria 5673
246 Ga0207641_10043404 3300026088 Unclassified 3776
247 Ga0207641_10189976 3300026088 Unclassified 1887
248 Ga0207641_10346587 3300026088 Bacteria 1415
249 Ga0207648_10060606 3300026089 Unclassified 3300
250 Ga0207648_10197045 3300026089 Bacteria 1786
251 Ga0207648_10245028 3300026089 Bacteria 1597
252 Ga0207676_10272443 3300026095 Bacteria 1533
253 Ga0207676_10365375 3300026095 Unclassified 1339
254 Ga0207676_10466635 3300026095 Bacteria 1193
255 Ga0207676_10699563 3300026095 Unclassified 982
256 Ga0207674_10059126 3300026116 Unclassified 3880
257 Ga0207674_10449836 3300026116 Unclassified 1245
258 Ga0207674_10690771 3300026116 Bacteria 985
259 Ga0207675_100032470 3300026118 Bacteria 4863
260 Ga0207675_100078883 3300026118 Bacteria 3085
261 Ga0207428_10004829 3300027907 Bacteria 12725
262 Ga0207428_10010127 3300027907 Bacteria 8431
263 Ga0268265_10594320 3300028380 Bacteria 1057
264 Ga0268264_10179645 3300028381 Bacteria 1921
265 Ga0268264_10259760 3300028381 Bacteria 1617
266 Ga0268264_10336590 3300028381 Unclassified 1432
267 Ga0307408_100153511 3300031548 Bacteria 1820
268 Ga0307413_10017504 3300031824 Bacteria 3734
269 Ga0307410_10000199 3300031852 Bacteria 22521
270 Ga0307406_10056999 3300031901 Bacteria 2505
271 Ga0307406_10365261 3300031901 Unclassified 1133
272 Ga0307409_100001157 3300031995 Bacteria 12567
273 Ga0307416_100001886 3300032002 Bacteria 11701
274 Ga0307414_10050477 3300032004 Bacteria 2882
275 Ga0307414_10131410 3300032004 Bacteria 1944
276 Ga0307414_10463539 3300032004 Bacteria 1114
277 Ga0307411_10072934 3300032005 Bacteria 2333
278 Ga0307411_10319741 3300032005 Bacteria 1253
279 Ga0307415_100011451 3300032126 Bacteria 5077
280 Ga0373951_0017236 3300035091 Bacteria 1633
281 Ga0373951_0065403 3300035091 Unclassified 917
282 Ga0373941_0039497 3300035115 Bacteria 1451
283 Ga0395898_0170744 3300037466 Bacteria 2079
284 Ga0439460_0001797 3300042461 Bacteria 5104
285 Ga0439440_0036008 3300042993 Unclassified 1189
286 Ga0451576_0276709 3300045051 Bacteria 1755
287 Ga0495580_0006118 3300046472 Bacteria 9843
288 Ga0495621_0049724 3300046539 Bacteria 1496
289 Ga0496107_0049698 3300048910 Unclassified 3023
290 Ga0496113_0134152 3300048916 Unclassified 1944
291 Ga0501038_0000750 3300049574 Bacteria 28938
292 Ga0501040_0179458 3300049576 Unclassified 1501
293 Ga0501040_0316574 3300049576 Bacteria 1116
294 Ga0501046_0055919 3300049580 Bacteria 3099
295 Ga0501074_0117045 3300049590 Bacteria 1907
296 Ga0501075_0283942 3300049591 Unclassified 1261
297 Ga0501227_104772 3300049665 Unclassified 754
298 Ga0501221_011121 3300049704 Unclassified 1614
299 Ga0501234_027347 3300049707 Unclassified 917
300 Ga0501079_0046222 3300049741 Bacteria 3359
301 Ga0501079_0167543 3300049741 Unclassified 1713
302 Ga0501080_0562379 3300049742 Bacteria 1015
303 Ga0501081_0122051 3300049743 Bacteria 1857
304 Ga0501268_012202 3300049765 Bacteria 1370
305 nmdc:mga05p37_35567_c1 3300050507 Bacteria 6108
306 nmdc:mga05p37_430376_c1 3300050507 Unclassified 1533
307 nmdc:mga08y16_23282_c1 3300050511 Bacteria 6541
308 nmdc:mga08y16_233354_c1 3300050511 Bacteria 1903
309 nmdc:mga08y16_40359_c1 3300050511 Bacteria 4893
310 nmdc:mga08y16_40716_c1 3300050511 Unclassified 4869
311 nmdc:mga08x19_103642_c1 3300050514 Bacteria 1890
312 nmdc:mga0a205_120597_c1 3300050515 Bacteria 2522
313 nmdc:mga0a205_14188_c1 3300050515 Bacteria 7432
314 nmdc:mga0a205_195945_c1 3300050515 Bacteria 1911
315 nmdc:mga0a205_47396_c1 3300050515 Unclassified 4146
316 Ga0501084_0046158 3300054114 Bacteria 3649

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0055919 Ga0501046_0055919_2457_3059 189
2 3300005440 Ga0070705_100025594 Ga0070705_1000255943 193
3 3300005471 Ga0070698_100378462 Ga0070698_1003784622 193
4 3300005546 Ga0070696_100003027 Ga0070696_1000030275 193
5 3300005549 Ga0070704_100005991 Ga0070704_1000059915 193
6 3300031548 Ga0307408_100153511 Ga0307408_1001535112 207
7 3300031824 Ga0307413_10017504 Ga0307413_100175045 207
8 3300031852 Ga0307410_10000199 Ga0307410_1000019910 207
9 3300031901 Ga0307406_10365261 Ga0307406_103652612 207
10 3300031995 Ga0307409_100001157 Ga0307409_10000115711 207
11 3300032002 Ga0307416_100001886 Ga0307416_1000018864 207
12 3300032004 Ga0307414_10131410 Ga0307414_101314102 207
13 3300032005 Ga0307411_10072934 Ga0307411_100729343 207
14 3300032126 Ga0307415_100011451 Ga0307415_1000114514 207
15 3300050511 nmdc:mga08y16_40716_c1 nmdc:mga08y16_40716_c1_33_659 208
16 3300005334 Ga0068869_100216998 Ga0068869_1002169982 217
17 3300005440 Ga0070705_100141450 Ga0070705_1001414502 217
18 3300005840 Ga0068870_10211743 Ga0068870_102117432 217
19 3300025908 Ga0207643_10078901 Ga0207643_100789012 217
20 3300025936 Ga0207670_10672201 Ga0207670_106722012 217
21 3300028380 Ga0268265_10594320 Ga0268265_105943201 217
22 3300009174 Ga0105241_10090954 Ga0105241_100909543 218
23 3300025911 Ga0207654_10100359 Ga0207654_101003593 218
24 3300005468 Ga0070707_100140087 Ga0070707_1001400872 221
25 3300005549 Ga0070704_100085402 Ga0070704_1000854022 221
26 3300005615 Ga0070702_100339440 Ga0070702_1003394402 221
27 3300005617 Ga0068859_100033963 Ga0068859_1000339632 221
28 3300006931 Ga0097620_100033967 Ga0097620_1000339674 221
29 3300009177 Ga0105248_10087405 Ga0105248_100874052 221
30 3300025922 Ga0207646_10117574 Ga0207646_101175743 221
31 3300025941 Ga0207711_10031074 Ga0207711_100310744 221
32 3300025961 Ga0207712_10030464 Ga0207712_100304642 221
33 3300002459 JGI24751J29686_10000032 JGI24751J29686_1000003217 222
34 3300005290 Ga0065712_10003533 Ga0065712_100035331 222
35 3300005293 Ga0065715_10003708 Ga0065715_100037083 222
36 3300005331 Ga0070670_100000071 Ga0070670_10000007184 222
37 3300005353 Ga0070669_100085375 Ga0070669_1000853752 222
38 3300005547 Ga0070693_100125743 Ga0070693_1001257432 222
39 3300005549 Ga0070704_100077320 Ga0070704_1000773202 222
40 3300005578 Ga0068854_100179952 Ga0068854_1001799522 222
41 3300005616 Ga0068852_100172959 Ga0068852_1001729592 222
42 3300005617 Ga0068859_100141586 Ga0068859_1001415862 222
43 3300005842 Ga0068858_100127230 Ga0068858_1001272302 222
44 3300006931 Ga0097620_100141584 Ga0097620_1001415842 222
45 3300009101 Ga0105247_10004753 Ga0105247_100047534 222
46 3300013306 Ga0163162_11497999 Ga0163162_114979991 222
47 3300014325 Ga0163163_10000062 Ga0163163_1000006270 222
48 3300025900 Ga0207710_10003849 Ga0207710_100038493 222
49 3300025925 Ga0207650_10000006 Ga0207650_10000006222 222
50 3300025981 Ga0207640_10163274 Ga0207640_101632742 222
51 3300026075 Ga0207708_10012783 Ga0207708_100127835 222
52 3300028381 Ga0268264_10336590 Ga0268264_103365902 222
53 3300005295 Ga0065707_10328278 Ga0065707_103282781 223
54 3300009092 Ga0105250_10099739 Ga0105250_100997392 223
55 3300009553 Ga0105249_10019254 Ga0105249_100192543 223
56 3300010375 Ga0105239_10999746 Ga0105239_109997462 223
57 3300026116 Ga0207674_10690771 Ga0207674_106907711 223
58 3300005330 Ga0070690_100550932 Ga0070690_1005509321 224
59 3300005337 Ga0070682_100009642 Ga0070682_1000096424 224
60 3300005343 Ga0070687_100069926 Ga0070687_1000699262 224
61 3300005345 Ga0070692_10084403 Ga0070692_100844033 224
62 3300005441 Ga0070700_100291739 Ga0070700_1002917391 224
63 3300005444 Ga0070694_100002598 Ga0070694_1000025983 224
64 3300005518 Ga0070699_100233032 Ga0070699_1002330323 224
65 3300005518 Ga0070699_100259536 Ga0070699_1002595362 224
66 3300005547 Ga0070693_100004094 Ga0070693_1000040945 224
67 3300005549 Ga0070704_100058661 Ga0070704_1000586613 224
68 3300005577 Ga0068857_100055428 Ga0068857_1000554283 224
69 3300005578 Ga0068854_100843510 Ga0068854_1008435101 224
70 3300005615 Ga0070702_100091848 Ga0070702_1000918482 224
71 3300005617 Ga0068859_100099729 Ga0068859_1000997295 224
72 3300005617 Ga0068859_100126512 Ga0068859_1001265122 224
73 3300005617 Ga0068859_100149969 Ga0068859_1001499693 224
74 3300005719 Ga0068861_100134703 Ga0068861_1001347032 224
75 3300005834 Ga0068851_10000692 Ga0068851_100006924 224
76 3300005842 Ga0068858_100055172 Ga0068858_1000551722 224
77 3300005843 Ga0068860_100065366 Ga0068860_1000653662 224
78 3300005843 Ga0068860_100164910 Ga0068860_1001649102 224
79 3300005844 Ga0068862_100311648 Ga0068862_1003116482 224
80 3300006931 Ga0097620_100099727 Ga0097620_1000997275 224
81 3300006931 Ga0097620_100126509 Ga0097620_1001265092 224
82 3300006931 Ga0097620_100149959 Ga0097620_1001499592 224
83 3300009148 Ga0105243_10156492 Ga0105243_101564922 224
84 3300009545 Ga0105237_10006137 Ga0105237_1000613713 224
85 3300009551 Ga0105238_10025409 Ga0105238_100254093 224
86 3300009553 Ga0105249_10030262 Ga0105249_100302624 224
87 3300010375 Ga0105239_11234320 Ga0105239_112343201 224
88 3300013297 Ga0157378_10135057 Ga0157378_101350574 224
89 3300013307 Ga0157372_10017101 Ga0157372_100171016 224
90 3300014326 Ga0157380_10037134 Ga0157380_100371342 224
91 3300014968 Ga0157379_10031160 Ga0157379_100311604 224
92 3300025321 Ga0207656_10000416 Ga0207656_1000041613 224
93 3300025913 Ga0207695_10247053 Ga0207695_102470532 224
94 3300025913 Ga0207695_10603172 Ga0207695_106031722 224
95 3300025914 Ga0207671_10003255 Ga0207671_1000325513 224
96 3300025918 Ga0207662_10017239 Ga0207662_100172394 224
97 3300025924 Ga0207694_10008928 Ga0207694_100089285 224
98 3300025935 Ga0207709_10050194 Ga0207709_100501942 224
99 3300025935 Ga0207709_10495678 Ga0207709_104956782 224
100 3300025981 Ga0207640_10071280 Ga0207640_100712802 224
101 3300025981 Ga0207640_10219667 Ga0207640_102196672 224
102 3300026035 Ga0207703_10531713 Ga0207703_105317132 224
103 3300026089 Ga0207648_10245028 Ga0207648_102450282 224
104 3300026095 Ga0207676_10365375 Ga0207676_103653752 224
105 3300026118 Ga0207675_100078883 Ga0207675_1000788834 224
106 3300028381 Ga0268264_10179645 Ga0268264_101796452 224
107 3300028381 Ga0268264_10259760 Ga0268264_102597602 224
108 3300042461 Ga0439460_0001797 Ga0439460_0001797_1253_2002 224
109 3300042993 Ga0439440_0036008 Ga0439440_0036008_220_972 224
110 3300046472 Ga0495580_0006118 Ga0495580_0006118_32_790 224
111 3300048916 Ga0496113_0134152 Ga0496113_0134152_569_1249 224
112 3300005441 Ga0070700_100000118 Ga0070700_10000011837 225
113 3300005617 Ga0068859_100012408 Ga0068859_1000124084 225
114 3300005841 Ga0068863_100165526 Ga0068863_1001655262 225
115 3300006931 Ga0097620_100012408 Ga0097620_1000124084 225
116 3300009101 Ga0105247_10207055 Ga0105247_102070552 225
117 3300009177 Ga0105248_10007908 Ga0105248_100079087 225
118 3300025900 Ga0207710_10107050 Ga0207710_101070502 225
119 3300025941 Ga0207711_10011345 Ga0207711_100113459 225
120 3300025960 Ga0207651_10307927 Ga0207651_103079272 225
121 3300026075 Ga0207708_10000037 Ga0207708_1000003755 225
122 3300026088 Ga0207641_10189976 Ga0207641_101899762 225
123 3300005345 Ga0070692_10024084 Ga0070692_100240842 226
124 3300005545 Ga0070695_100298345 Ga0070695_1002983452 226
125 3300005546 Ga0070696_100004142 Ga0070696_1000041424 226
126 3300009094 Ga0111539_10053674 Ga0111539_100536745 226
127 3300009147 Ga0114129_10085059 Ga0114129_100850592 226
128 3300026116 Ga0207674_10449836 Ga0207674_104498362 226
129 3300049665 Ga0501227_104772 Ga0501227_104772_42_728 226
130 3300049704 Ga0501221_011121 Ga0501221_011121_38_724 226
131 3300049765 Ga0501268_012202 Ga0501268_012202_304_990 226
132 3300050511 nmdc:mga08y16_233354_c1 nmdc:mga08y16_233354_c1_194_880 226
133 3300005547 Ga0070693_100040774 Ga0070693_1000407743 227
134 3300005842 Ga0068858_100836820 Ga0068858_1008368201 227
135 3300009177 Ga0105248_10489388 Ga0105248_104893882 227
136 3300009177 Ga0105248_10514955 Ga0105248_105149552 227
137 3300010375 Ga0105239_10087545 Ga0105239_100875452 227
138 3300013100 Ga0157373_10234141 Ga0157373_102341412 227
139 3300025941 Ga0207711_10313036 Ga0207711_103130362 227
140 3300026035 Ga0207703_10027423 Ga0207703_100274232 227
141 3300035115 Ga0373941_0039497 Ga0373941_0039497_284_970 227
142 3300005458 Ga0070681_10034051 Ga0070681_100340513 228
143 3300005549 Ga0070704_100022334 Ga0070704_1000223344 228
144 3300009093 Ga0105240_10422552 Ga0105240_104225522 228
145 3300009545 Ga0105237_10017173 Ga0105237_100171735 228
146 3300025906 Ga0207699_10491410 Ga0207699_104914102 228
147 3300025912 Ga0207707_10006240 Ga0207707_100062407 228
148 3300025914 Ga0207671_10064427 Ga0207671_100644272 228
149 3300032004 Ga0307414_10463539 Ga0307414_104635392 228
150 3300032005 Ga0307411_10319741 Ga0307411_103197411 228
151 3300046539 Ga0495621_0049724 Ga0495621_0049724_126_863 228
152 3300049590 Ga0501074_0117045 Ga0501074_0117045_79_798 228
153 3300049741 Ga0501079_0167543 Ga0501079_0167543_555_1274 228
154 3300050515 nmdc:mga0a205_120597_c1 nmdc:mga0a205_120597_c1_1222_1926 228
155 3300054114 Ga0501084_0046158 Ga0501084_0046158_2520_3239 228
156 3300037466 Ga0395898_0170744 Ga0395898_0170744_68_781 229
157 3300050514 nmdc:mga08x19_103642_c1 nmdc:mga08x19_103642_c1_1069_1785 229
158 3300003322 rootL2_10030281 rootL2_100302812 230
159 3300005290 Ga0065712_10078834 Ga0065712_100788344 230
160 3300005328 Ga0070676_10002841 Ga0070676_100028412 230
161 3300005330 Ga0070690_100075434 Ga0070690_1000754342 230
162 3300005334 Ga0068869_100288929 Ga0068869_1002889292 230
163 3300005336 Ga0070680_100020912 Ga0070680_1000209127 230
164 3300005444 Ga0070694_100098352 Ga0070694_1000983523 230
165 3300005459 Ga0068867_100107721 Ga0068867_1001077212 230
166 3300005543 Ga0070672_100449070 Ga0070672_1004490702 230
167 3300005546 Ga0070696_100109941 Ga0070696_1001099411 230
168 3300005578 Ga0068854_100186941 Ga0068854_1001869413 230
169 3300005578 Ga0068854_100493732 Ga0068854_1004937321 230
170 3300005617 Ga0068859_100015003 Ga0068859_10001500310 230
171 3300005617 Ga0068859_100183979 Ga0068859_1001839792 230
172 3300006846 Ga0075430_100277571 Ga0075430_1002775712 230
173 3300006847 Ga0075431_100335414 Ga0075431_1003354142 230
174 3300006852 Ga0075433_10025467 Ga0075433_100254674 230
175 3300006880 Ga0075429_100006434 Ga0075429_1000064344 230
176 3300006931 Ga0097620_100015003 Ga0097620_10001500310 230
177 3300006931 Ga0097620_100183985 Ga0097620_1001839852 230
178 3300009094 Ga0111539_11002507 Ga0111539_110025071 230
179 3300009147 Ga0114129_10194649 Ga0114129_101946493 230
180 3300009147 Ga0114129_10361661 Ga0114129_103616612 230
181 3300013297 Ga0157378_10226719 Ga0157378_102267191 230
182 3300014326 Ga0157380_10062593 Ga0157380_100625933 230
183 3300025885 Ga0207653_10053101 Ga0207653_100531012 230
184 3300025907 Ga0207645_10056447 Ga0207645_100564472 230
185 3300025917 Ga0207660_10037153 Ga0207660_100371533 230
186 3300025918 Ga0207662_10097329 Ga0207662_100973292 230
187 3300025936 Ga0207670_10305086 Ga0207670_103050861 230
188 3300025945 Ga0207679_10137936 Ga0207679_101379363 230
189 3300025960 Ga0207651_10090585 Ga0207651_100905853 230
190 3300026089 Ga0207648_10197045 Ga0207648_101970452 230
191 3300035091 Ga0373951_0017236 Ga0373951_0017236_490_1194 230
192 3300050507 nmdc:mga05p37_430376_c1 nmdc:mga05p37_430376_c1_239_961 230
193 3300050515 nmdc:mga0a205_14188_c1 nmdc:mga0a205_14188_c1_6635_7336 230
194 2162886011 MRS1b_contig_7155089 MRS1b_0379.00003110 231
195 2162886012 MBSR1b_contig_1070090 MBSR1b_0687.00003920 231
196 3300005288 Ga0065714_10002189 Ga0065714_1000218995 231
197 3300005290 Ga0065712_10067733 Ga0065712_1006773387 231
198 3300005293 Ga0065715_10089141 Ga0065715_100891415 231
199 3300009553 Ga0105249_10244098 Ga0105249_102440981 231
200 3300013308 Ga0157375_10007033 Ga0157375_100070339 231
201 3300026089 Ga0207648_10060606 Ga0207648_100606064 231
202 3300031901 Ga0307406_10056999 Ga0307406_100569992 231
203 3300032004 Ga0307414_10050477 Ga0307414_100504772 231
204 3300048910 Ga0496107_0049698 Ga0496107_0049698_808_1521 231
205 3300005331 Ga0070670_100244599 Ga0070670_1002445992 232
206 3300005618 Ga0068864_100533678 Ga0068864_1005336782 232
207 3300005840 Ga0068870_10168249 Ga0068870_101682492 232
208 3300005841 Ga0068863_100456319 Ga0068863_1004563191 232
209 3300006852 Ga0075433_10093744 Ga0075433_100937442 232
210 3300009011 Ga0105251_10052693 Ga0105251_100526932 232
211 3300009011 Ga0105251_10131190 Ga0105251_101311902 232
212 3300009094 Ga0111539_10005527 Ga0111539_1000552717 232
213 3300009553 Ga0105249_10883691 Ga0105249_108836912 232
214 3300011119 Ga0105246_10012918 Ga0105246_100129183 232
215 3300014969 Ga0157376_10856940 Ga0157376_108569401 232
216 3300025911 Ga0207654_10141010 Ga0207654_101410102 232
217 3300026088 Ga0207641_10043404 Ga0207641_100434042 232
218 3300026095 Ga0207676_10272443 Ga0207676_102724432 232
219 3300026095 Ga0207676_10699563 Ga0207676_106995631 232
220 3300049576 Ga0501040_0316574 Ga0501040_0316574_243_968 232
221 3300049707 Ga0501234_027347 Ga0501234_027347_153_872 232
222 3300049741 Ga0501079_0046222 Ga0501079_0046222_2332_3057 232
223 3300049743 Ga0501081_0122051 Ga0501081_0122051_560_1285 232
224 3300050511 nmdc:mga08y16_40359_c1 nmdc:mga08y16_40359_c1_121_846 232
225 3300050515 nmdc:mga0a205_195945_c1 nmdc:mga0a205_195945_c1_932_1630 232
226 3300005343 Ga0070687_100118713 Ga0070687_1001187131 233
227 3300005466 Ga0070685_10190670 Ga0070685_101906702 233
228 3300005471 Ga0070698_100002938 Ga0070698_1000029388 233
229 3300005544 Ga0070686_100383004 Ga0070686_1003830041 233
230 3300006173 Ga0070716_100000009 Ga0070716_100000009137 233
231 3300009101 Ga0105247_10014184 Ga0105247_100141846 233
232 3300025906 Ga0207699_10000002 Ga0207699_10000002500 233
233 3300025939 Ga0207665_10000001 Ga0207665_100000013 233
234 3300026035 Ga0207703_10085321 Ga0207703_100853212 233
235 3300026095 Ga0207676_10466635 Ga0207676_104666352 233
236 2162886007 SwRhRL2b_contig_784511 SwRhRL2b_0462.00002590 234
237 3300005289 Ga0065704_10003530 Ga0065704_100035302 234
238 3300005293 Ga0065715_10105455 Ga0065715_101054554 234
239 3300005295 Ga0065707_10083493 Ga0065707_100834932 234
240 3300005295 Ga0065707_10158078 Ga0065707_101580782 234
241 3300005295 Ga0065707_10234803 Ga0065707_102348032 234
242 3300005330 Ga0070690_100010954 Ga0070690_1000109542 234
243 3300005334 Ga0068869_100109990 Ga0068869_1001099902 234
244 3300005337 Ga0070682_100087221 Ga0070682_1000872213 234
245 3300005343 Ga0070687_100168745 Ga0070687_1001687451 234
246 3300005345 Ga0070692_10149866 Ga0070692_101498662 234
247 3300005441 Ga0070700_100244805 Ga0070700_1002448052 234
248 3300005444 Ga0070694_100019737 Ga0070694_1000197374 234
249 3300005444 Ga0070694_100125872 Ga0070694_1001258721 234
250 3300005445 Ga0070708_100254141 Ga0070708_1002541411 234
251 3300005467 Ga0070706_100002870 Ga0070706_10000287012 234
252 3300005468 Ga0070707_100272794 Ga0070707_1002727942 234
253 3300005471 Ga0070698_100004473 Ga0070698_1000044734 234
254 3300005471 Ga0070698_100496500 Ga0070698_1004965002 234
255 3300005518 Ga0070699_100010566 Ga0070699_1000105665 234
256 3300005518 Ga0070699_100033600 Ga0070699_1000336006 234
257 3300005536 Ga0070697_100011535 Ga0070697_1000115356 234
258 3300005539 Ga0068853_100264376 Ga0068853_1002643762 234
259 3300005544 Ga0070686_100066305 Ga0070686_1000663052 234
260 3300005545 Ga0070695_100205409 Ga0070695_1002054092 234
261 3300005545 Ga0070695_100538104 Ga0070695_1005381042 234
262 3300005546 Ga0070696_100056268 Ga0070696_1000562681 234
263 3300005546 Ga0070696_100356562 Ga0070696_1003565622 234
264 3300005577 Ga0068857_100126468 Ga0068857_1001264682 234
265 3300005615 Ga0070702_100083238 Ga0070702_1000832383 234
266 3300005617 Ga0068859_100024440 Ga0068859_1000244402 234
267 3300005618 Ga0068864_100364514 Ga0068864_1003645142 234
268 3300005719 Ga0068861_100127440 Ga0068861_1001274403 234
269 3300005841 Ga0068863_100567148 Ga0068863_1005671481 234
270 3300005842 Ga0068858_100411573 Ga0068858_1004115732 234
271 3300005843 Ga0068860_100059702 Ga0068860_1000597021 234
272 3300005844 Ga0068862_100193192 Ga0068862_1001931923 234
273 3300006237 Ga0097621_100001839 Ga0097621_1000018395 234
274 3300006358 Ga0068871_100008876 Ga0068871_1000088766 234
275 3300006852 Ga0075433_10301883 Ga0075433_103018832 234
276 3300006871 Ga0075434_100088915 Ga0075434_1000889152 234
277 3300006931 Ga0097620_100024441 Ga0097620_1000244412 234
278 3300009094 Ga0111539_10002546 Ga0111539_1000254611 234
279 3300009094 Ga0111539_10030262 Ga0111539_100302626 234
280 3300009147 Ga0114129_10010169 Ga0114129_100101696 234
281 3300009177 Ga0105248_10016729 Ga0105248_100167296 234
282 3300009551 Ga0105238_10009259 Ga0105238_100092593 234
283 3300009553 Ga0105249_10039142 Ga0105249_100391424 234
284 3300009553 Ga0105249_10061889 Ga0105249_100618893 234
285 3300013100 Ga0157373_10178496 Ga0157373_101784961 234
286 3300014326 Ga0157380_10689551 Ga0157380_106895512 234
287 3300014968 Ga0157379_10021256 Ga0157379_100212562 234
288 3300014968 Ga0157379_10329507 Ga0157379_103295072 234
289 3300025904 Ga0207647_10060869 Ga0207647_100608693 234
290 3300025910 Ga0207684_10025518 Ga0207684_100255186 234
291 3300025910 Ga0207684_10093261 Ga0207684_100932611 234
292 3300025918 Ga0207662_10106182 Ga0207662_101061823 234
293 3300025921 Ga0207652_10193130 Ga0207652_101931302 234
294 3300025922 Ga0207646_10145455 Ga0207646_101454552 234
295 3300025922 Ga0207646_10230411 Ga0207646_102304112 234
296 3300025924 Ga0207694_10093564 Ga0207694_100935643 234
297 3300025941 Ga0207711_10028793 Ga0207711_100287933 234
298 3300025942 Ga0207689_10093790 Ga0207689_100937902 234
299 3300025960 Ga0207651_10665296 Ga0207651_106652961 234
300 3300025961 Ga0207712_10263442 Ga0207712_102634422 234
301 3300026035 Ga0207703_10053597 Ga0207703_100535972 234
302 3300026075 Ga0207708_10015749 Ga0207708_100157497 234
303 3300026088 Ga0207641_10346587 Ga0207641_103465872 234
304 3300026116 Ga0207674_10059126 Ga0207674_100591264 234
305 3300026118 Ga0207675_100032470 Ga0207675_1000324707 234
306 3300027907 Ga0207428_10004829 Ga0207428_1000482912 234
307 3300027907 Ga0207428_10010127 Ga0207428_100101272 234
308 3300035091 Ga0373951_0065403 Ga0373951_0065403_22_726 234
309 3300045051 Ga0451576_0276709 Ga0451576_0276709_863_1612 234
310 3300049574 Ga0501038_0000750 Ga0501038_0000750_22416_23147 234
311 3300049576 Ga0501040_0179458 Ga0501040_0179458_636_1388 234
312 3300049591 Ga0501075_0283942 Ga0501075_0283942_104_856 234
313 3300049742 Ga0501080_0562379 Ga0501080_0562379_179_931 234
314 3300050507 nmdc:mga05p37_35567_c1 nmdc:mga05p37_35567_c1_4937_5689 234
315 3300050511 nmdc:mga08y16_23282_c1 nmdc:mga08y16_23282_c1_4960_5709 234
316 3300050515 nmdc:mga0a205_47396_c1 nmdc:mga0a205_47396_c1_524_1228 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

114

246

0.9

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

31

240

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yns-assembly1.cif.gz_A crystal structure of human enolase-phosphatase e1 and its complex with a substrate analog 0.9288 5 233
1zs9-assembly1.cif.gz_A crystal structure of human enolase-phosphatase e1 0.9256 5 233
1yns-assembly1.cif.gz_A crystal structure of human enolase-phosphatase e1 and its complex with a substrate analog 0.9061 5 233
1zs9-assembly1.cif.gz_A crystal structure of human enolase-phosphatase e1 0.9029 5 233
2g80-assembly3.cif.gz_C crystal structure of utr4 protein (unknown transcript 4 protein) (yel038w) from saccharomyces cerevisiae at 2.28 a resolution 0.8188 7 234
ID Description Score Start End Superfamily
af_Q21012_126_245_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9845 115 231 3.40.50.1000
af_Q9VN95_123_242_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9843 115 231 3.40.50.1000
af_Q55FM6_122_259_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9778 102 234 3.40.50.1000
af_Q5PPH0_119_252_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9738 104 234 3.40.50.1000
af_B7EWK0_179_307_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9587 106 234 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2E7EQQ6-F1-model_v4 Acireductone synthase 0.9876 108 234 GO:0000287
GO:0019509
GO:0043874
AF-A0A482RVJ4-F1-model_v4 deleted 0.9819 106 234
AF-A0A132A2J7-F1-model_v4 Enolase-phosphatase E-1-like protein 1 0.9811 99 212 GO:0019509
GO:0043874
AF-A0A2E7EQQ6-F1-model_v4 Acireductone synthase 0.9799 108 234 GO:0000287
GO:0019509
GO:0043874
AF-A0A6V7HQE1-F1-model_v4 Enolase-phosphatase E1 0.9737 112 234 GO:0000287
GO:0005634
GO:0005737
GO:0019509
GO:0043874

Feature Viewer

pLDDT pTM Quality
94.49 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map