F403574
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 316 | 156 | 316 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300005536|Ga0070697_100011535|Ga0070697_1000115356 |
| Length | 273 |
| Sequence | VNCFVSGMAALRFGEEYSQKVMTSSLSTAGIRSVLLDIEGTTTPIAFVHDVLFSYARSWVREYLAEHFDSAELHADLARLRDEHAADLKQNLQPPALVDGSRDDRIDSIVAYVNWLMDHDRKSTGLKSLQGKIWRDGYLDGTLKAQLFPDVAPALERWRRADLKISIFSSGSSLAQKLLFAHTEAGDLTKFIGNYFDTTVGLKTDAESYRQIAAALCLPGNEVLFISDVVNELDAASTAGMQTLLCVRPGNPPQGYRERYQIIQSFNEISLSE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 122 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 123 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 124 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 125 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 126 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 127 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 128 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 129 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 130 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 131 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 133 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 134 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 135 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 136 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 139 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 140 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 146 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 147 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 148 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 152 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.63 |
| Rhizosphere | 99.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_784511 | 2162886007 | Bacteria | 2624 |
| 2 | MRS1b_contig_7155089 | 2162886011 | Bacteria | 2609 |
| 3 | MBSR1b_contig_1070090 | 2162886012 | Bacteria | 1746 |
| 4 | JGI24751J29686_10000032 | 3300002459 | Bacteria | 87712 |
| 5 | rootL2_10030281 | 3300003322 | Unclassified | 1300 |
| 6 | Ga0065714_10002189 | 3300005288 | Bacteria | 128055 |
| 7 | Ga0065704_10003530 | 3300005289 | Bacteria | 7016 |
| 8 | Ga0065712_10003533 | 3300005290 | Bacteria | 5591 |
| 9 | Ga0065712_10067733 | 3300005290 | Bacteria | 118568 |
| 10 | Ga0065712_10078834 | 3300005290 | Unclassified | 3294 |
| 11 | Ga0065715_10003708 | 3300005293 | Bacteria | 5318 |
| 12 | Ga0065715_10089141 | 3300005293 | Bacteria | 13620 |
| 13 | Ga0065715_10105455 | 3300005293 | Bacteria | 2876 |
| 14 | Ga0065707_10083493 | 3300005295 | Bacteria | 8959 |
| 15 | Ga0065707_10158078 | 3300005295 | Bacteria | 1584 |
| 16 | Ga0065707_10234803 | 3300005295 | Unclassified | 1176 |
| 17 | Ga0065707_10328278 | 3300005295 | Bacteria | 948 |
| 18 | Ga0070676_10002841 | 3300005328 | Bacteria | 8946 |
| 19 | Ga0070690_100010954 | 3300005330 | Bacteria | 5292 |
| 20 | Ga0070690_100075434 | 3300005330 | Bacteria | 2198 |
| 21 | Ga0070690_100550932 | 3300005330 | Bacteria | 869 |
| 22 | Ga0070670_100000071 | 3300005331 | Bacteria | 102454 |
| 23 | Ga0070670_100244599 | 3300005331 | Bacteria | 1562 |
| 24 | Ga0068869_100109990 | 3300005334 | Bacteria | 2095 |
| 25 | Ga0068869_100216998 | 3300005334 | Unclassified | 1514 |
| 26 | Ga0068869_100288929 | 3300005334 | Bacteria | 1321 |
| 27 | Ga0070680_100020912 | 3300005336 | Bacteria | 5195 |
| 28 | Ga0070682_100009642 | 3300005337 | Bacteria | 5466 |
| 29 | Ga0070682_100087221 | 3300005337 | Unclassified | 2034 |
| 30 | Ga0070687_100069926 | 3300005343 | Unclassified | 1881 |
| 31 | Ga0070687_100118713 | 3300005343 | Unclassified | 1509 |
| 32 | Ga0070687_100168745 | 3300005343 | Bacteria | 1301 |
| 33 | Ga0070692_10024084 | 3300005345 | Bacteria | 2989 |
| 34 | Ga0070692_10084403 | 3300005345 | Unclassified | 1716 |
| 35 | Ga0070692_10149866 | 3300005345 | Unclassified | 1328 |
| 36 | Ga0070669_100085375 | 3300005353 | Bacteria | 2357 |
| 37 | Ga0070705_100025594 | 3300005440 | Bacteria | 3201 |
| 38 | Ga0070705_100141450 | 3300005440 | Bacteria | 1584 |
| 39 | Ga0070700_100000118 | 3300005441 | Bacteria | 49489 |
| 40 | Ga0070700_100244805 | 3300005441 | Bacteria | 1283 |
| 41 | Ga0070700_100291739 | 3300005441 | Bacteria | 1187 |
| 42 | Ga0070694_100002598 | 3300005444 | Bacteria | 10674 |
| 43 | Ga0070694_100019737 | 3300005444 | Unclassified | 4289 |
| 44 | Ga0070694_100098352 | 3300005444 | Bacteria | 2066 |
| 45 | Ga0070694_100125872 | 3300005444 | Unclassified | 1845 |
| 46 | Ga0070708_100254141 | 3300005445 | Unclassified | 1651 |
| 47 | Ga0070681_10034051 | 3300005458 | Bacteria | 5115 |
| 48 | Ga0068867_100107721 | 3300005459 | Bacteria | 2136 |
| 49 | Ga0070685_10190670 | 3300005466 | Unclassified | 1326 |
| 50 | Ga0070706_100002870 | 3300005467 | Bacteria | 17170 |
| 51 | Ga0070707_100140087 | 3300005468 | Unclassified | 2354 |
| 52 | Ga0070707_100272794 | 3300005468 | Bacteria | 1644 |
| 53 | Ga0070698_100002938 | 3300005471 | Bacteria | 18748 |
| 54 | Ga0070698_100004473 | 3300005471 | Bacteria | 15365 |
| 55 | Ga0070698_100378462 | 3300005471 | Bacteria | 1348 |
| 56 | Ga0070698_100496500 | 3300005471 | Bacteria | 1158 |
| 57 | Ga0070699_100010566 | 3300005518 | Bacteria | 7991 |
| 58 | Ga0070699_100033600 | 3300005518 | Bacteria | 4431 |
| 59 | Ga0070699_100233032 | 3300005518 | Unclassified | 1642 |
| 60 | Ga0070699_100259536 | 3300005518 | Bacteria | 1554 |
| 61 | Ga0070697_100011535 | 3300005536 | Bacteria | 6905 |
| 62 | Ga0068853_100264376 | 3300005539 | Unclassified | 1583 |
| 63 | Ga0070672_100449070 | 3300005543 | Bacteria | 1110 |
| 64 | Ga0070686_100066305 | 3300005544 | Bacteria | 2348 |
| 65 | Ga0070686_100383004 | 3300005544 | Bacteria | 1065 |
| 66 | Ga0070695_100205409 | 3300005545 | Unclassified | 1410 |
| 67 | Ga0070695_100298345 | 3300005545 | Bacteria | 1190 |
| 68 | Ga0070695_100538104 | 3300005545 | Bacteria | 909 |
| 69 | Ga0070696_100003027 | 3300005546 | Bacteria | 11157 |
| 70 | Ga0070696_100004142 | 3300005546 | Bacteria | 9665 |
| 71 | Ga0070696_100056268 | 3300005546 | Bacteria | 2743 |
| 72 | Ga0070696_100109941 | 3300005546 | Bacteria | 1984 |
| 73 | Ga0070696_100356562 | 3300005546 | Unclassified | 1134 |
| 74 | Ga0070693_100004094 | 3300005547 | Bacteria | 6864 |
| 75 | Ga0070693_100040774 | 3300005547 | Bacteria | 2608 |
| 76 | Ga0070693_100125743 | 3300005547 | Unclassified | 1596 |
| 77 | Ga0070704_100005991 | 3300005549 | Bacteria | 7129 |
| 78 | Ga0070704_100022334 | 3300005549 | Bacteria | 4115 |
| 79 | Ga0070704_100058661 | 3300005549 | Unclassified | 2742 |
| 80 | Ga0070704_100077320 | 3300005549 | Bacteria | 2438 |
| 81 | Ga0070704_100085402 | 3300005549 | Bacteria | 2336 |
| 82 | Ga0068857_100055428 | 3300005577 | Bacteria | 3518 |
| 83 | Ga0068857_100126468 | 3300005577 | Bacteria | 2303 |
| 84 | Ga0068854_100179952 | 3300005578 | Bacteria | 1651 |
| 85 | Ga0068854_100186941 | 3300005578 | Bacteria | 1621 |
| 86 | Ga0068854_100493732 | 3300005578 | Bacteria | 1030 |
| 87 | Ga0068854_100843510 | 3300005578 | Unclassified | 802 |
| 88 | Ga0070702_100083238 | 3300005615 | Bacteria | 1921 |
| 89 | Ga0070702_100091848 | 3300005615 | Unclassified | 1843 |
| 90 | Ga0070702_100339440 | 3300005615 | Unclassified | 1054 |
| 91 | Ga0068852_100172959 | 3300005616 | Unclassified | 2026 |
| 92 | Ga0068859_100012408 | 3300005617 | Bacteria | 8572 |
| 93 | Ga0068859_100015003 | 3300005617 | Bacteria | 7776 |
| 94 | Ga0068859_100024440 | 3300005617 | Bacteria | 6061 |
| 95 | Ga0068859_100033963 | 3300005617 | Bacteria | 5121 |
| 96 | Ga0068859_100099729 | 3300005617 | Bacteria | 2960 |
| 97 | Ga0068859_100126512 | 3300005617 | Bacteria | 2624 |
| 98 | Ga0068859_100141586 | 3300005617 | Bacteria | 2479 |
| 99 | Ga0068859_100149969 | 3300005617 | Bacteria | 2407 |
| 100 | Ga0068859_100183979 | 3300005617 | Bacteria | 2173 |
| 101 | Ga0068864_100364514 | 3300005618 | Bacteria | 1366 |
| 102 | Ga0068864_100533678 | 3300005618 | Bacteria | 1132 |
| 103 | Ga0068861_100127440 | 3300005719 | Bacteria | 2062 |
| 104 | Ga0068861_100134703 | 3300005719 | Bacteria | 2009 |
| 105 | Ga0068851_10000692 | 3300005834 | Bacteria | 14366 |
| 106 | Ga0068870_10168249 | 3300005840 | Unclassified | 1306 |
| 107 | Ga0068870_10211743 | 3300005840 | Unclassified | 1181 |
| 108 | Ga0068863_100165526 | 3300005841 | Bacteria | 2120 |
| 109 | Ga0068863_100456319 | 3300005841 | Bacteria | 1255 |
| 110 | Ga0068863_100567148 | 3300005841 | Bacteria | 1122 |
| 111 | Ga0068858_100055172 | 3300005842 | Unclassified | 3673 |
| 112 | Ga0068858_100127230 | 3300005842 | Bacteria | 2387 |
| 113 | Ga0068858_100411573 | 3300005842 | Bacteria | 1300 |
| 114 | Ga0068858_100836820 | 3300005842 | Unclassified | 898 |
| 115 | Ga0068860_100059702 | 3300005843 | Bacteria | 3625 |
| 116 | Ga0068860_100065366 | 3300005843 | Bacteria | 3454 |
| 117 | Ga0068860_100164910 | 3300005843 | Bacteria | 2138 |
| 118 | Ga0068862_100193192 | 3300005844 | Bacteria | 1833 |
| 119 | Ga0068862_100311648 | 3300005844 | Bacteria | 1450 |
| 120 | Ga0070716_100000009 | 3300006173 | Bacteria | 173295 |
| 121 | Ga0097621_100001839 | 3300006237 | Bacteria | 14544 |
| 122 | Ga0068871_100008876 | 3300006358 | Bacteria | 7248 |
| 123 | Ga0075430_100277571 | 3300006846 | Unclassified | 1386 |
| 124 | Ga0075431_100335414 | 3300006847 | Unclassified | 1522 |
| 125 | Ga0075433_10025467 | 3300006852 | Bacteria | 5001 |
| 126 | Ga0075433_10093744 | 3300006852 | Bacteria | 2657 |
| 127 | Ga0075433_10301883 | 3300006852 | Unclassified | 1418 |
| 128 | Ga0075434_100088915 | 3300006871 | Bacteria | 3091 |
| 129 | Ga0075429_100006434 | 3300006880 | Bacteria | 10172 |
| 130 | Ga0097620_100012408 | 3300006931 | Bacteria | 8572 |
| 131 | Ga0097620_100015003 | 3300006931 | Bacteria | 7776 |
| 132 | Ga0097620_100024441 | 3300006931 | Bacteria | 6061 |
| 133 | Ga0097620_100033967 | 3300006931 | Bacteria | 5121 |
| 134 | Ga0097620_100099727 | 3300006931 | Bacteria | 2960 |
| 135 | Ga0097620_100126509 | 3300006931 | Bacteria | 2624 |
| 136 | Ga0097620_100141584 | 3300006931 | Bacteria | 2479 |
| 137 | Ga0097620_100149959 | 3300006931 | Bacteria | 2407 |
| 138 | Ga0097620_100183985 | 3300006931 | Bacteria | 2173 |
| 139 | Ga0105251_10052693 | 3300009011 | Bacteria | 1936 |
| 140 | Ga0105251_10131190 | 3300009011 | Bacteria | 1135 |
| 141 | Ga0105250_10099739 | 3300009092 | Bacteria | 1185 |
| 142 | Ga0105240_10422552 | 3300009093 | Bacteria | 1497 |
| 143 | Ga0111539_10002546 | 3300009094 | Bacteria | 24141 |
| 144 | Ga0111539_10005527 | 3300009094 | Bacteria | 16347 |
| 145 | Ga0111539_10030262 | 3300009094 | Bacteria | 6583 |
| 146 | Ga0111539_10053674 | 3300009094 | Bacteria | 4798 |
| 147 | Ga0111539_11002507 | 3300009094 | Unclassified | 971 |
| 148 | Ga0105247_10004753 | 3300009101 | Bacteria | 8647 |
| 149 | Ga0105247_10014184 | 3300009101 | Bacteria | 4781 |
| 150 | Ga0105247_10207055 | 3300009101 | Bacteria | 1321 |
| 151 | Ga0114129_10010169 | 3300009147 | Bacteria | 13414 |
| 152 | Ga0114129_10085059 | 3300009147 | Bacteria | 4388 |
| 153 | Ga0114129_10194649 | 3300009147 | Bacteria | 2750 |
| 154 | Ga0114129_10361661 | 3300009147 | Unclassified | 1920 |
| 155 | Ga0105243_10156492 | 3300009148 | Unclassified | 1960 |
| 156 | Ga0105241_10090954 | 3300009174 | Unclassified | 2407 |
| 157 | Ga0105248_10007908 | 3300009177 | Bacteria | 11684 |
| 158 | Ga0105248_10016729 | 3300009177 | Bacteria | 8075 |
| 159 | Ga0105248_10087405 | 3300009177 | Bacteria | 3508 |
| 160 | Ga0105248_10489388 | 3300009177 | Bacteria | 1387 |
| 161 | Ga0105248_10514955 | 3300009177 | Unclassified | 1349 |
| 162 | Ga0105237_10006137 | 3300009545 | Bacteria | 13433 |
| 163 | Ga0105237_10017173 | 3300009545 | Bacteria | 7506 |
| 164 | Ga0105238_10009259 | 3300009551 | Bacteria | 9856 |
| 165 | Ga0105238_10025409 | 3300009551 | Bacteria | 6038 |
| 166 | Ga0105249_10019254 | 3300009553 | Bacteria | 6087 |
| 167 | Ga0105249_10030262 | 3300009553 | Bacteria | 4894 |
| 168 | Ga0105249_10039142 | 3300009553 | Bacteria | 4305 |
| 169 | Ga0105249_10061889 | 3300009553 | Bacteria | 3435 |
| 170 | Ga0105249_10244098 | 3300009553 | Unclassified | 1777 |
| 171 | Ga0105249_10883691 | 3300009553 | Unclassified | 960 |
| 172 | Ga0105239_10087545 | 3300010375 | Unclassified | 3434 |
| 173 | Ga0105239_10999746 | 3300010375 | Unclassified | 962 |
| 174 | Ga0105239_11234320 | 3300010375 | Bacteria | 862 |
| 175 | Ga0105246_10012918 | 3300011119 | Bacteria | 5224 |
| 176 | Ga0157373_10178496 | 3300013100 | Bacteria | 1495 |
| 177 | Ga0157373_10234141 | 3300013100 | Bacteria | 1297 |
| 178 | Ga0157378_10135057 | 3300013297 | Unclassified | 2287 |
| 179 | Ga0157378_10226719 | 3300013297 | Bacteria | 1779 |
| 180 | Ga0163162_11497999 | 3300013306 | Bacteria | 768 |
| 181 | Ga0157372_10017101 | 3300013307 | Bacteria | 7784 |
| 182 | Ga0157375_10007033 | 3300013308 | Bacteria | 9829 |
| 183 | Ga0163163_10000062 | 3300014325 | Bacteria | 119109 |
| 184 | Ga0157380_10037134 | 3300014326 | Bacteria | 3773 |
| 185 | Ga0157380_10062593 | 3300014326 | Bacteria | 2981 |
| 186 | Ga0157380_10689551 | 3300014326 | Bacteria | 1025 |
| 187 | Ga0157379_10021256 | 3300014968 | Bacteria | 5743 |
| 188 | Ga0157379_10031160 | 3300014968 | Bacteria | 4750 |
| 189 | Ga0157379_10329507 | 3300014968 | Bacteria | 1395 |
| 190 | Ga0157376_10856940 | 3300014969 | Unclassified | 924 |
| 191 | Ga0207656_10000416 | 3300025321 | Bacteria | 14366 |
| 192 | Ga0207653_10053101 | 3300025885 | Bacteria | 1353 |
| 193 | Ga0207710_10003849 | 3300025900 | Bacteria | 6634 |
| 194 | Ga0207710_10107050 | 3300025900 | Bacteria | 1324 |
| 195 | Ga0207647_10060869 | 3300025904 | Bacteria | 2306 |
| 196 | Ga0207699_10000002 | 3300025906 | Bacteria | 662194 |
| 197 | Ga0207699_10491410 | 3300025906 | Bacteria | 885 |
| 198 | Ga0207645_10056447 | 3300025907 | Bacteria | 2507 |
| 199 | Ga0207643_10078901 | 3300025908 | Bacteria | 1905 |
| 200 | Ga0207684_10025518 | 3300025910 | Bacteria | 5037 |
| 201 | Ga0207684_10093261 | 3300025910 | Unclassified | 2567 |
| 202 | Ga0207654_10100359 | 3300025911 | Unclassified | 1782 |
| 203 | Ga0207654_10141010 | 3300025911 | Unclassified | 1537 |
| 204 | Ga0207707_10006240 | 3300025912 | Bacteria | 10414 |
| 205 | Ga0207695_10247053 | 3300025913 | Bacteria | 1684 |
| 206 | Ga0207695_10603172 | 3300025913 | Bacteria | 979 |
| 207 | Ga0207671_10003255 | 3300025914 | Bacteria | 16336 |
| 208 | Ga0207671_10064427 | 3300025914 | Bacteria | 2725 |
| 209 | Ga0207660_10037153 | 3300025917 | Bacteria | 3392 |
| 210 | Ga0207662_10017239 | 3300025918 | Bacteria | 4083 |
| 211 | Ga0207662_10097329 | 3300025918 | Bacteria | 1819 |
| 212 | Ga0207662_10106182 | 3300025918 | Bacteria | 1746 |
| 213 | Ga0207652_10193130 | 3300025921 | Bacteria | 1831 |
| 214 | Ga0207646_10117574 | 3300025922 | Unclassified | 2388 |
| 215 | Ga0207646_10145455 | 3300025922 | Unclassified | 2136 |
| 216 | Ga0207646_10230411 | 3300025922 | Bacteria | 1673 |
| 217 | Ga0207694_10008928 | 3300025924 | Bacteria | 7567 |
| 218 | Ga0207694_10093564 | 3300025924 | Unclassified | 2374 |
| 219 | Ga0207650_10000006 | 3300025925 | Bacteria | 544730 |
| 220 | Ga0207709_10050194 | 3300025935 | Unclassified | 2550 |
| 221 | Ga0207709_10495678 | 3300025935 | Bacteria | 952 |
| 222 | Ga0207670_10305086 | 3300025936 | Bacteria | 1248 |
| 223 | Ga0207670_10672201 | 3300025936 | Unclassified | 855 |
| 224 | Ga0207665_10000001 | 3300025939 | Bacteria | 279842 |
| 225 | Ga0207711_10011345 | 3300025941 | Bacteria | 7402 |
| 226 | Ga0207711_10028793 | 3300025941 | Bacteria | 4678 |
| 227 | Ga0207711_10031074 | 3300025941 | Bacteria | 4506 |
| 228 | Ga0207711_10313036 | 3300025941 | Bacteria | 1449 |
| 229 | Ga0207689_10093790 | 3300025942 | Bacteria | 2466 |
| 230 | Ga0207679_10137936 | 3300025945 | Bacteria | 1967 |
| 231 | Ga0207651_10090585 | 3300025960 | Bacteria | 2236 |
| 232 | Ga0207651_10307927 | 3300025960 | Bacteria | 1320 |
| 233 | Ga0207651_10665296 | 3300025960 | Bacteria | 915 |
| 234 | Ga0207712_10030464 | 3300025961 | Unclassified | 3628 |
| 235 | Ga0207712_10263442 | 3300025961 | Bacteria | 1399 |
| 236 | Ga0207640_10071280 | 3300025981 | Bacteria | 2340 |
| 237 | Ga0207640_10163274 | 3300025981 | Bacteria | 1651 |
| 238 | Ga0207640_10219667 | 3300025981 | Bacteria | 1454 |
| 239 | Ga0207703_10027423 | 3300026035 | Bacteria | 4486 |
| 240 | Ga0207703_10053597 | 3300026035 | Bacteria | 3279 |
| 241 | Ga0207703_10085321 | 3300026035 | Unclassified | 2642 |
| 242 | Ga0207703_10531713 | 3300026035 | Bacteria | 1107 |
| 243 | Ga0207708_10000037 | 3300026075 | Bacteria | 137489 |
| 244 | Ga0207708_10012783 | 3300026075 | Bacteria | 6261 |
| 245 | Ga0207708_10015749 | 3300026075 | Bacteria | 5673 |
| 246 | Ga0207641_10043404 | 3300026088 | Unclassified | 3776 |
| 247 | Ga0207641_10189976 | 3300026088 | Unclassified | 1887 |
| 248 | Ga0207641_10346587 | 3300026088 | Bacteria | 1415 |
| 249 | Ga0207648_10060606 | 3300026089 | Unclassified | 3300 |
| 250 | Ga0207648_10197045 | 3300026089 | Bacteria | 1786 |
| 251 | Ga0207648_10245028 | 3300026089 | Bacteria | 1597 |
| 252 | Ga0207676_10272443 | 3300026095 | Bacteria | 1533 |
| 253 | Ga0207676_10365375 | 3300026095 | Unclassified | 1339 |
| 254 | Ga0207676_10466635 | 3300026095 | Bacteria | 1193 |
| 255 | Ga0207676_10699563 | 3300026095 | Unclassified | 982 |
| 256 | Ga0207674_10059126 | 3300026116 | Unclassified | 3880 |
| 257 | Ga0207674_10449836 | 3300026116 | Unclassified | 1245 |
| 258 | Ga0207674_10690771 | 3300026116 | Bacteria | 985 |
| 259 | Ga0207675_100032470 | 3300026118 | Bacteria | 4863 |
| 260 | Ga0207675_100078883 | 3300026118 | Bacteria | 3085 |
| 261 | Ga0207428_10004829 | 3300027907 | Bacteria | 12725 |
| 262 | Ga0207428_10010127 | 3300027907 | Bacteria | 8431 |
| 263 | Ga0268265_10594320 | 3300028380 | Bacteria | 1057 |
| 264 | Ga0268264_10179645 | 3300028381 | Bacteria | 1921 |
| 265 | Ga0268264_10259760 | 3300028381 | Bacteria | 1617 |
| 266 | Ga0268264_10336590 | 3300028381 | Unclassified | 1432 |
| 267 | Ga0307408_100153511 | 3300031548 | Bacteria | 1820 |
| 268 | Ga0307413_10017504 | 3300031824 | Bacteria | 3734 |
| 269 | Ga0307410_10000199 | 3300031852 | Bacteria | 22521 |
| 270 | Ga0307406_10056999 | 3300031901 | Bacteria | 2505 |
| 271 | Ga0307406_10365261 | 3300031901 | Unclassified | 1133 |
| 272 | Ga0307409_100001157 | 3300031995 | Bacteria | 12567 |
| 273 | Ga0307416_100001886 | 3300032002 | Bacteria | 11701 |
| 274 | Ga0307414_10050477 | 3300032004 | Bacteria | 2882 |
| 275 | Ga0307414_10131410 | 3300032004 | Bacteria | 1944 |
| 276 | Ga0307414_10463539 | 3300032004 | Bacteria | 1114 |
| 277 | Ga0307411_10072934 | 3300032005 | Bacteria | 2333 |
| 278 | Ga0307411_10319741 | 3300032005 | Bacteria | 1253 |
| 279 | Ga0307415_100011451 | 3300032126 | Bacteria | 5077 |
| 280 | Ga0373951_0017236 | 3300035091 | Bacteria | 1633 |
| 281 | Ga0373951_0065403 | 3300035091 | Unclassified | 917 |
| 282 | Ga0373941_0039497 | 3300035115 | Bacteria | 1451 |
| 283 | Ga0395898_0170744 | 3300037466 | Bacteria | 2079 |
| 284 | Ga0439460_0001797 | 3300042461 | Bacteria | 5104 |
| 285 | Ga0439440_0036008 | 3300042993 | Unclassified | 1189 |
| 286 | Ga0451576_0276709 | 3300045051 | Bacteria | 1755 |
| 287 | Ga0495580_0006118 | 3300046472 | Bacteria | 9843 |
| 288 | Ga0495621_0049724 | 3300046539 | Bacteria | 1496 |
| 289 | Ga0496107_0049698 | 3300048910 | Unclassified | 3023 |
| 290 | Ga0496113_0134152 | 3300048916 | Unclassified | 1944 |
| 291 | Ga0501038_0000750 | 3300049574 | Bacteria | 28938 |
| 292 | Ga0501040_0179458 | 3300049576 | Unclassified | 1501 |
| 293 | Ga0501040_0316574 | 3300049576 | Bacteria | 1116 |
| 294 | Ga0501046_0055919 | 3300049580 | Bacteria | 3099 |
| 295 | Ga0501074_0117045 | 3300049590 | Bacteria | 1907 |
| 296 | Ga0501075_0283942 | 3300049591 | Unclassified | 1261 |
| 297 | Ga0501227_104772 | 3300049665 | Unclassified | 754 |
| 298 | Ga0501221_011121 | 3300049704 | Unclassified | 1614 |
| 299 | Ga0501234_027347 | 3300049707 | Unclassified | 917 |
| 300 | Ga0501079_0046222 | 3300049741 | Bacteria | 3359 |
| 301 | Ga0501079_0167543 | 3300049741 | Unclassified | 1713 |
| 302 | Ga0501080_0562379 | 3300049742 | Bacteria | 1015 |
| 303 | Ga0501081_0122051 | 3300049743 | Bacteria | 1857 |
| 304 | Ga0501268_012202 | 3300049765 | Bacteria | 1370 |
| 305 | nmdc:mga05p37_35567_c1 | 3300050507 | Bacteria | 6108 |
| 306 | nmdc:mga05p37_430376_c1 | 3300050507 | Unclassified | 1533 |
| 307 | nmdc:mga08y16_23282_c1 | 3300050511 | Bacteria | 6541 |
| 308 | nmdc:mga08y16_233354_c1 | 3300050511 | Bacteria | 1903 |
| 309 | nmdc:mga08y16_40359_c1 | 3300050511 | Bacteria | 4893 |
| 310 | nmdc:mga08y16_40716_c1 | 3300050511 | Unclassified | 4869 |
| 311 | nmdc:mga08x19_103642_c1 | 3300050514 | Bacteria | 1890 |
| 312 | nmdc:mga0a205_120597_c1 | 3300050515 | Bacteria | 2522 |
| 313 | nmdc:mga0a205_14188_c1 | 3300050515 | Bacteria | 7432 |
| 314 | nmdc:mga0a205_195945_c1 | 3300050515 | Bacteria | 1911 |
| 315 | nmdc:mga0a205_47396_c1 | 3300050515 | Unclassified | 4146 |
| 316 | Ga0501084_0046158 | 3300054114 | Bacteria | 3649 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049580 | Ga0501046_0055919 | Ga0501046_0055919_2457_3059 | 189 |
| 2 | 3300005440 | Ga0070705_100025594 | Ga0070705_1000255943 | 193 |
| 3 | 3300005471 | Ga0070698_100378462 | Ga0070698_1003784622 | 193 |
| 4 | 3300005546 | Ga0070696_100003027 | Ga0070696_1000030275 | 193 |
| 5 | 3300005549 | Ga0070704_100005991 | Ga0070704_1000059915 | 193 |
| 6 | 3300031548 | Ga0307408_100153511 | Ga0307408_1001535112 | 207 |
| 7 | 3300031824 | Ga0307413_10017504 | Ga0307413_100175045 | 207 |
| 8 | 3300031852 | Ga0307410_10000199 | Ga0307410_1000019910 | 207 |
| 9 | 3300031901 | Ga0307406_10365261 | Ga0307406_103652612 | 207 |
| 10 | 3300031995 | Ga0307409_100001157 | Ga0307409_10000115711 | 207 |
| 11 | 3300032002 | Ga0307416_100001886 | Ga0307416_1000018864 | 207 |
| 12 | 3300032004 | Ga0307414_10131410 | Ga0307414_101314102 | 207 |
| 13 | 3300032005 | Ga0307411_10072934 | Ga0307411_100729343 | 207 |
| 14 | 3300032126 | Ga0307415_100011451 | Ga0307415_1000114514 | 207 |
| 15 | 3300050511 | nmdc:mga08y16_40716_c1 | nmdc:mga08y16_40716_c1_33_659 | 208 |
| 16 | 3300005334 | Ga0068869_100216998 | Ga0068869_1002169982 | 217 |
| 17 | 3300005440 | Ga0070705_100141450 | Ga0070705_1001414502 | 217 |
| 18 | 3300005840 | Ga0068870_10211743 | Ga0068870_102117432 | 217 |
| 19 | 3300025908 | Ga0207643_10078901 | Ga0207643_100789012 | 217 |
| 20 | 3300025936 | Ga0207670_10672201 | Ga0207670_106722012 | 217 |
| 21 | 3300028380 | Ga0268265_10594320 | Ga0268265_105943201 | 217 |
| 22 | 3300009174 | Ga0105241_10090954 | Ga0105241_100909543 | 218 |
| 23 | 3300025911 | Ga0207654_10100359 | Ga0207654_101003593 | 218 |
| 24 | 3300005468 | Ga0070707_100140087 | Ga0070707_1001400872 | 221 |
| 25 | 3300005549 | Ga0070704_100085402 | Ga0070704_1000854022 | 221 |
| 26 | 3300005615 | Ga0070702_100339440 | Ga0070702_1003394402 | 221 |
| 27 | 3300005617 | Ga0068859_100033963 | Ga0068859_1000339632 | 221 |
| 28 | 3300006931 | Ga0097620_100033967 | Ga0097620_1000339674 | 221 |
| 29 | 3300009177 | Ga0105248_10087405 | Ga0105248_100874052 | 221 |
| 30 | 3300025922 | Ga0207646_10117574 | Ga0207646_101175743 | 221 |
| 31 | 3300025941 | Ga0207711_10031074 | Ga0207711_100310744 | 221 |
| 32 | 3300025961 | Ga0207712_10030464 | Ga0207712_100304642 | 221 |
| 33 | 3300002459 | JGI24751J29686_10000032 | JGI24751J29686_1000003217 | 222 |
| 34 | 3300005290 | Ga0065712_10003533 | Ga0065712_100035331 | 222 |
| 35 | 3300005293 | Ga0065715_10003708 | Ga0065715_100037083 | 222 |
| 36 | 3300005331 | Ga0070670_100000071 | Ga0070670_10000007184 | 222 |
| 37 | 3300005353 | Ga0070669_100085375 | Ga0070669_1000853752 | 222 |
| 38 | 3300005547 | Ga0070693_100125743 | Ga0070693_1001257432 | 222 |
| 39 | 3300005549 | Ga0070704_100077320 | Ga0070704_1000773202 | 222 |
| 40 | 3300005578 | Ga0068854_100179952 | Ga0068854_1001799522 | 222 |
| 41 | 3300005616 | Ga0068852_100172959 | Ga0068852_1001729592 | 222 |
| 42 | 3300005617 | Ga0068859_100141586 | Ga0068859_1001415862 | 222 |
| 43 | 3300005842 | Ga0068858_100127230 | Ga0068858_1001272302 | 222 |
| 44 | 3300006931 | Ga0097620_100141584 | Ga0097620_1001415842 | 222 |
| 45 | 3300009101 | Ga0105247_10004753 | Ga0105247_100047534 | 222 |
| 46 | 3300013306 | Ga0163162_11497999 | Ga0163162_114979991 | 222 |
| 47 | 3300014325 | Ga0163163_10000062 | Ga0163163_1000006270 | 222 |
| 48 | 3300025900 | Ga0207710_10003849 | Ga0207710_100038493 | 222 |
| 49 | 3300025925 | Ga0207650_10000006 | Ga0207650_10000006222 | 222 |
| 50 | 3300025981 | Ga0207640_10163274 | Ga0207640_101632742 | 222 |
| 51 | 3300026075 | Ga0207708_10012783 | Ga0207708_100127835 | 222 |
| 52 | 3300028381 | Ga0268264_10336590 | Ga0268264_103365902 | 222 |
| 53 | 3300005295 | Ga0065707_10328278 | Ga0065707_103282781 | 223 |
| 54 | 3300009092 | Ga0105250_10099739 | Ga0105250_100997392 | 223 |
| 55 | 3300009553 | Ga0105249_10019254 | Ga0105249_100192543 | 223 |
| 56 | 3300010375 | Ga0105239_10999746 | Ga0105239_109997462 | 223 |
| 57 | 3300026116 | Ga0207674_10690771 | Ga0207674_106907711 | 223 |
| 58 | 3300005330 | Ga0070690_100550932 | Ga0070690_1005509321 | 224 |
| 59 | 3300005337 | Ga0070682_100009642 | Ga0070682_1000096424 | 224 |
| 60 | 3300005343 | Ga0070687_100069926 | Ga0070687_1000699262 | 224 |
| 61 | 3300005345 | Ga0070692_10084403 | Ga0070692_100844033 | 224 |
| 62 | 3300005441 | Ga0070700_100291739 | Ga0070700_1002917391 | 224 |
| 63 | 3300005444 | Ga0070694_100002598 | Ga0070694_1000025983 | 224 |
| 64 | 3300005518 | Ga0070699_100233032 | Ga0070699_1002330323 | 224 |
| 65 | 3300005518 | Ga0070699_100259536 | Ga0070699_1002595362 | 224 |
| 66 | 3300005547 | Ga0070693_100004094 | Ga0070693_1000040945 | 224 |
| 67 | 3300005549 | Ga0070704_100058661 | Ga0070704_1000586613 | 224 |
| 68 | 3300005577 | Ga0068857_100055428 | Ga0068857_1000554283 | 224 |
| 69 | 3300005578 | Ga0068854_100843510 | Ga0068854_1008435101 | 224 |
| 70 | 3300005615 | Ga0070702_100091848 | Ga0070702_1000918482 | 224 |
| 71 | 3300005617 | Ga0068859_100099729 | Ga0068859_1000997295 | 224 |
| 72 | 3300005617 | Ga0068859_100126512 | Ga0068859_1001265122 | 224 |
| 73 | 3300005617 | Ga0068859_100149969 | Ga0068859_1001499693 | 224 |
| 74 | 3300005719 | Ga0068861_100134703 | Ga0068861_1001347032 | 224 |
| 75 | 3300005834 | Ga0068851_10000692 | Ga0068851_100006924 | 224 |
| 76 | 3300005842 | Ga0068858_100055172 | Ga0068858_1000551722 | 224 |
| 77 | 3300005843 | Ga0068860_100065366 | Ga0068860_1000653662 | 224 |
| 78 | 3300005843 | Ga0068860_100164910 | Ga0068860_1001649102 | 224 |
| 79 | 3300005844 | Ga0068862_100311648 | Ga0068862_1003116482 | 224 |
| 80 | 3300006931 | Ga0097620_100099727 | Ga0097620_1000997275 | 224 |
| 81 | 3300006931 | Ga0097620_100126509 | Ga0097620_1001265092 | 224 |
| 82 | 3300006931 | Ga0097620_100149959 | Ga0097620_1001499592 | 224 |
| 83 | 3300009148 | Ga0105243_10156492 | Ga0105243_101564922 | 224 |
| 84 | 3300009545 | Ga0105237_10006137 | Ga0105237_1000613713 | 224 |
| 85 | 3300009551 | Ga0105238_10025409 | Ga0105238_100254093 | 224 |
| 86 | 3300009553 | Ga0105249_10030262 | Ga0105249_100302624 | 224 |
| 87 | 3300010375 | Ga0105239_11234320 | Ga0105239_112343201 | 224 |
| 88 | 3300013297 | Ga0157378_10135057 | Ga0157378_101350574 | 224 |
| 89 | 3300013307 | Ga0157372_10017101 | Ga0157372_100171016 | 224 |
| 90 | 3300014326 | Ga0157380_10037134 | Ga0157380_100371342 | 224 |
| 91 | 3300014968 | Ga0157379_10031160 | Ga0157379_100311604 | 224 |
| 92 | 3300025321 | Ga0207656_10000416 | Ga0207656_1000041613 | 224 |
| 93 | 3300025913 | Ga0207695_10247053 | Ga0207695_102470532 | 224 |
| 94 | 3300025913 | Ga0207695_10603172 | Ga0207695_106031722 | 224 |
| 95 | 3300025914 | Ga0207671_10003255 | Ga0207671_1000325513 | 224 |
| 96 | 3300025918 | Ga0207662_10017239 | Ga0207662_100172394 | 224 |
| 97 | 3300025924 | Ga0207694_10008928 | Ga0207694_100089285 | 224 |
| 98 | 3300025935 | Ga0207709_10050194 | Ga0207709_100501942 | 224 |
| 99 | 3300025935 | Ga0207709_10495678 | Ga0207709_104956782 | 224 |
| 100 | 3300025981 | Ga0207640_10071280 | Ga0207640_100712802 | 224 |
| 101 | 3300025981 | Ga0207640_10219667 | Ga0207640_102196672 | 224 |
| 102 | 3300026035 | Ga0207703_10531713 | Ga0207703_105317132 | 224 |
| 103 | 3300026089 | Ga0207648_10245028 | Ga0207648_102450282 | 224 |
| 104 | 3300026095 | Ga0207676_10365375 | Ga0207676_103653752 | 224 |
| 105 | 3300026118 | Ga0207675_100078883 | Ga0207675_1000788834 | 224 |
| 106 | 3300028381 | Ga0268264_10179645 | Ga0268264_101796452 | 224 |
| 107 | 3300028381 | Ga0268264_10259760 | Ga0268264_102597602 | 224 |
| 108 | 3300042461 | Ga0439460_0001797 | Ga0439460_0001797_1253_2002 | 224 |
| 109 | 3300042993 | Ga0439440_0036008 | Ga0439440_0036008_220_972 | 224 |
| 110 | 3300046472 | Ga0495580_0006118 | Ga0495580_0006118_32_790 | 224 |
| 111 | 3300048916 | Ga0496113_0134152 | Ga0496113_0134152_569_1249 | 224 |
| 112 | 3300005441 | Ga0070700_100000118 | Ga0070700_10000011837 | 225 |
| 113 | 3300005617 | Ga0068859_100012408 | Ga0068859_1000124084 | 225 |
| 114 | 3300005841 | Ga0068863_100165526 | Ga0068863_1001655262 | 225 |
| 115 | 3300006931 | Ga0097620_100012408 | Ga0097620_1000124084 | 225 |
| 116 | 3300009101 | Ga0105247_10207055 | Ga0105247_102070552 | 225 |
| 117 | 3300009177 | Ga0105248_10007908 | Ga0105248_100079087 | 225 |
| 118 | 3300025900 | Ga0207710_10107050 | Ga0207710_101070502 | 225 |
| 119 | 3300025941 | Ga0207711_10011345 | Ga0207711_100113459 | 225 |
| 120 | 3300025960 | Ga0207651_10307927 | Ga0207651_103079272 | 225 |
| 121 | 3300026075 | Ga0207708_10000037 | Ga0207708_1000003755 | 225 |
| 122 | 3300026088 | Ga0207641_10189976 | Ga0207641_101899762 | 225 |
| 123 | 3300005345 | Ga0070692_10024084 | Ga0070692_100240842 | 226 |
| 124 | 3300005545 | Ga0070695_100298345 | Ga0070695_1002983452 | 226 |
| 125 | 3300005546 | Ga0070696_100004142 | Ga0070696_1000041424 | 226 |
| 126 | 3300009094 | Ga0111539_10053674 | Ga0111539_100536745 | 226 |
| 127 | 3300009147 | Ga0114129_10085059 | Ga0114129_100850592 | 226 |
| 128 | 3300026116 | Ga0207674_10449836 | Ga0207674_104498362 | 226 |
| 129 | 3300049665 | Ga0501227_104772 | Ga0501227_104772_42_728 | 226 |
| 130 | 3300049704 | Ga0501221_011121 | Ga0501221_011121_38_724 | 226 |
| 131 | 3300049765 | Ga0501268_012202 | Ga0501268_012202_304_990 | 226 |
| 132 | 3300050511 | nmdc:mga08y16_233354_c1 | nmdc:mga08y16_233354_c1_194_880 | 226 |
| 133 | 3300005547 | Ga0070693_100040774 | Ga0070693_1000407743 | 227 |
| 134 | 3300005842 | Ga0068858_100836820 | Ga0068858_1008368201 | 227 |
| 135 | 3300009177 | Ga0105248_10489388 | Ga0105248_104893882 | 227 |
| 136 | 3300009177 | Ga0105248_10514955 | Ga0105248_105149552 | 227 |
| 137 | 3300010375 | Ga0105239_10087545 | Ga0105239_100875452 | 227 |
| 138 | 3300013100 | Ga0157373_10234141 | Ga0157373_102341412 | 227 |
| 139 | 3300025941 | Ga0207711_10313036 | Ga0207711_103130362 | 227 |
| 140 | 3300026035 | Ga0207703_10027423 | Ga0207703_100274232 | 227 |
| 141 | 3300035115 | Ga0373941_0039497 | Ga0373941_0039497_284_970 | 227 |
| 142 | 3300005458 | Ga0070681_10034051 | Ga0070681_100340513 | 228 |
| 143 | 3300005549 | Ga0070704_100022334 | Ga0070704_1000223344 | 228 |
| 144 | 3300009093 | Ga0105240_10422552 | Ga0105240_104225522 | 228 |
| 145 | 3300009545 | Ga0105237_10017173 | Ga0105237_100171735 | 228 |
| 146 | 3300025906 | Ga0207699_10491410 | Ga0207699_104914102 | 228 |
| 147 | 3300025912 | Ga0207707_10006240 | Ga0207707_100062407 | 228 |
| 148 | 3300025914 | Ga0207671_10064427 | Ga0207671_100644272 | 228 |
| 149 | 3300032004 | Ga0307414_10463539 | Ga0307414_104635392 | 228 |
| 150 | 3300032005 | Ga0307411_10319741 | Ga0307411_103197411 | 228 |
| 151 | 3300046539 | Ga0495621_0049724 | Ga0495621_0049724_126_863 | 228 |
| 152 | 3300049590 | Ga0501074_0117045 | Ga0501074_0117045_79_798 | 228 |
| 153 | 3300049741 | Ga0501079_0167543 | Ga0501079_0167543_555_1274 | 228 |
| 154 | 3300050515 | nmdc:mga0a205_120597_c1 | nmdc:mga0a205_120597_c1_1222_1926 | 228 |
| 155 | 3300054114 | Ga0501084_0046158 | Ga0501084_0046158_2520_3239 | 228 |
| 156 | 3300037466 | Ga0395898_0170744 | Ga0395898_0170744_68_781 | 229 |
| 157 | 3300050514 | nmdc:mga08x19_103642_c1 | nmdc:mga08x19_103642_c1_1069_1785 | 229 |
| 158 | 3300003322 | rootL2_10030281 | rootL2_100302812 | 230 |
| 159 | 3300005290 | Ga0065712_10078834 | Ga0065712_100788344 | 230 |
| 160 | 3300005328 | Ga0070676_10002841 | Ga0070676_100028412 | 230 |
| 161 | 3300005330 | Ga0070690_100075434 | Ga0070690_1000754342 | 230 |
| 162 | 3300005334 | Ga0068869_100288929 | Ga0068869_1002889292 | 230 |
| 163 | 3300005336 | Ga0070680_100020912 | Ga0070680_1000209127 | 230 |
| 164 | 3300005444 | Ga0070694_100098352 | Ga0070694_1000983523 | 230 |
| 165 | 3300005459 | Ga0068867_100107721 | Ga0068867_1001077212 | 230 |
| 166 | 3300005543 | Ga0070672_100449070 | Ga0070672_1004490702 | 230 |
| 167 | 3300005546 | Ga0070696_100109941 | Ga0070696_1001099411 | 230 |
| 168 | 3300005578 | Ga0068854_100186941 | Ga0068854_1001869413 | 230 |
| 169 | 3300005578 | Ga0068854_100493732 | Ga0068854_1004937321 | 230 |
| 170 | 3300005617 | Ga0068859_100015003 | Ga0068859_10001500310 | 230 |
| 171 | 3300005617 | Ga0068859_100183979 | Ga0068859_1001839792 | 230 |
| 172 | 3300006846 | Ga0075430_100277571 | Ga0075430_1002775712 | 230 |
| 173 | 3300006847 | Ga0075431_100335414 | Ga0075431_1003354142 | 230 |
| 174 | 3300006852 | Ga0075433_10025467 | Ga0075433_100254674 | 230 |
| 175 | 3300006880 | Ga0075429_100006434 | Ga0075429_1000064344 | 230 |
| 176 | 3300006931 | Ga0097620_100015003 | Ga0097620_10001500310 | 230 |
| 177 | 3300006931 | Ga0097620_100183985 | Ga0097620_1001839852 | 230 |
| 178 | 3300009094 | Ga0111539_11002507 | Ga0111539_110025071 | 230 |
| 179 | 3300009147 | Ga0114129_10194649 | Ga0114129_101946493 | 230 |
| 180 | 3300009147 | Ga0114129_10361661 | Ga0114129_103616612 | 230 |
| 181 | 3300013297 | Ga0157378_10226719 | Ga0157378_102267191 | 230 |
| 182 | 3300014326 | Ga0157380_10062593 | Ga0157380_100625933 | 230 |
| 183 | 3300025885 | Ga0207653_10053101 | Ga0207653_100531012 | 230 |
| 184 | 3300025907 | Ga0207645_10056447 | Ga0207645_100564472 | 230 |
| 185 | 3300025917 | Ga0207660_10037153 | Ga0207660_100371533 | 230 |
| 186 | 3300025918 | Ga0207662_10097329 | Ga0207662_100973292 | 230 |
| 187 | 3300025936 | Ga0207670_10305086 | Ga0207670_103050861 | 230 |
| 188 | 3300025945 | Ga0207679_10137936 | Ga0207679_101379363 | 230 |
| 189 | 3300025960 | Ga0207651_10090585 | Ga0207651_100905853 | 230 |
| 190 | 3300026089 | Ga0207648_10197045 | Ga0207648_101970452 | 230 |
| 191 | 3300035091 | Ga0373951_0017236 | Ga0373951_0017236_490_1194 | 230 |
| 192 | 3300050507 | nmdc:mga05p37_430376_c1 | nmdc:mga05p37_430376_c1_239_961 | 230 |
| 193 | 3300050515 | nmdc:mga0a205_14188_c1 | nmdc:mga0a205_14188_c1_6635_7336 | 230 |
| 194 | 2162886011 | MRS1b_contig_7155089 | MRS1b_0379.00003110 | 231 |
| 195 | 2162886012 | MBSR1b_contig_1070090 | MBSR1b_0687.00003920 | 231 |
| 196 | 3300005288 | Ga0065714_10002189 | Ga0065714_1000218995 | 231 |
| 197 | 3300005290 | Ga0065712_10067733 | Ga0065712_1006773387 | 231 |
| 198 | 3300005293 | Ga0065715_10089141 | Ga0065715_100891415 | 231 |
| 199 | 3300009553 | Ga0105249_10244098 | Ga0105249_102440981 | 231 |
| 200 | 3300013308 | Ga0157375_10007033 | Ga0157375_100070339 | 231 |
| 201 | 3300026089 | Ga0207648_10060606 | Ga0207648_100606064 | 231 |
| 202 | 3300031901 | Ga0307406_10056999 | Ga0307406_100569992 | 231 |
| 203 | 3300032004 | Ga0307414_10050477 | Ga0307414_100504772 | 231 |
| 204 | 3300048910 | Ga0496107_0049698 | Ga0496107_0049698_808_1521 | 231 |
| 205 | 3300005331 | Ga0070670_100244599 | Ga0070670_1002445992 | 232 |
| 206 | 3300005618 | Ga0068864_100533678 | Ga0068864_1005336782 | 232 |
| 207 | 3300005840 | Ga0068870_10168249 | Ga0068870_101682492 | 232 |
| 208 | 3300005841 | Ga0068863_100456319 | Ga0068863_1004563191 | 232 |
| 209 | 3300006852 | Ga0075433_10093744 | Ga0075433_100937442 | 232 |
| 210 | 3300009011 | Ga0105251_10052693 | Ga0105251_100526932 | 232 |
| 211 | 3300009011 | Ga0105251_10131190 | Ga0105251_101311902 | 232 |
| 212 | 3300009094 | Ga0111539_10005527 | Ga0111539_1000552717 | 232 |
| 213 | 3300009553 | Ga0105249_10883691 | Ga0105249_108836912 | 232 |
| 214 | 3300011119 | Ga0105246_10012918 | Ga0105246_100129183 | 232 |
| 215 | 3300014969 | Ga0157376_10856940 | Ga0157376_108569401 | 232 |
| 216 | 3300025911 | Ga0207654_10141010 | Ga0207654_101410102 | 232 |
| 217 | 3300026088 | Ga0207641_10043404 | Ga0207641_100434042 | 232 |
| 218 | 3300026095 | Ga0207676_10272443 | Ga0207676_102724432 | 232 |
| 219 | 3300026095 | Ga0207676_10699563 | Ga0207676_106995631 | 232 |
| 220 | 3300049576 | Ga0501040_0316574 | Ga0501040_0316574_243_968 | 232 |
| 221 | 3300049707 | Ga0501234_027347 | Ga0501234_027347_153_872 | 232 |
| 222 | 3300049741 | Ga0501079_0046222 | Ga0501079_0046222_2332_3057 | 232 |
| 223 | 3300049743 | Ga0501081_0122051 | Ga0501081_0122051_560_1285 | 232 |
| 224 | 3300050511 | nmdc:mga08y16_40359_c1 | nmdc:mga08y16_40359_c1_121_846 | 232 |
| 225 | 3300050515 | nmdc:mga0a205_195945_c1 | nmdc:mga0a205_195945_c1_932_1630 | 232 |
| 226 | 3300005343 | Ga0070687_100118713 | Ga0070687_1001187131 | 233 |
| 227 | 3300005466 | Ga0070685_10190670 | Ga0070685_101906702 | 233 |
| 228 | 3300005471 | Ga0070698_100002938 | Ga0070698_1000029388 | 233 |
| 229 | 3300005544 | Ga0070686_100383004 | Ga0070686_1003830041 | 233 |
| 230 | 3300006173 | Ga0070716_100000009 | Ga0070716_100000009137 | 233 |
| 231 | 3300009101 | Ga0105247_10014184 | Ga0105247_100141846 | 233 |
| 232 | 3300025906 | Ga0207699_10000002 | Ga0207699_10000002500 | 233 |
| 233 | 3300025939 | Ga0207665_10000001 | Ga0207665_100000013 | 233 |
| 234 | 3300026035 | Ga0207703_10085321 | Ga0207703_100853212 | 233 |
| 235 | 3300026095 | Ga0207676_10466635 | Ga0207676_104666352 | 233 |
| 236 | 2162886007 | SwRhRL2b_contig_784511 | SwRhRL2b_0462.00002590 | 234 |
| 237 | 3300005289 | Ga0065704_10003530 | Ga0065704_100035302 | 234 |
| 238 | 3300005293 | Ga0065715_10105455 | Ga0065715_101054554 | 234 |
| 239 | 3300005295 | Ga0065707_10083493 | Ga0065707_100834932 | 234 |
| 240 | 3300005295 | Ga0065707_10158078 | Ga0065707_101580782 | 234 |
| 241 | 3300005295 | Ga0065707_10234803 | Ga0065707_102348032 | 234 |
| 242 | 3300005330 | Ga0070690_100010954 | Ga0070690_1000109542 | 234 |
| 243 | 3300005334 | Ga0068869_100109990 | Ga0068869_1001099902 | 234 |
| 244 | 3300005337 | Ga0070682_100087221 | Ga0070682_1000872213 | 234 |
| 245 | 3300005343 | Ga0070687_100168745 | Ga0070687_1001687451 | 234 |
| 246 | 3300005345 | Ga0070692_10149866 | Ga0070692_101498662 | 234 |
| 247 | 3300005441 | Ga0070700_100244805 | Ga0070700_1002448052 | 234 |
| 248 | 3300005444 | Ga0070694_100019737 | Ga0070694_1000197374 | 234 |
| 249 | 3300005444 | Ga0070694_100125872 | Ga0070694_1001258721 | 234 |
| 250 | 3300005445 | Ga0070708_100254141 | Ga0070708_1002541411 | 234 |
| 251 | 3300005467 | Ga0070706_100002870 | Ga0070706_10000287012 | 234 |
| 252 | 3300005468 | Ga0070707_100272794 | Ga0070707_1002727942 | 234 |
| 253 | 3300005471 | Ga0070698_100004473 | Ga0070698_1000044734 | 234 |
| 254 | 3300005471 | Ga0070698_100496500 | Ga0070698_1004965002 | 234 |
| 255 | 3300005518 | Ga0070699_100010566 | Ga0070699_1000105665 | 234 |
| 256 | 3300005518 | Ga0070699_100033600 | Ga0070699_1000336006 | 234 |
| 257 | 3300005536 | Ga0070697_100011535 | Ga0070697_1000115356 | 234 |
| 258 | 3300005539 | Ga0068853_100264376 | Ga0068853_1002643762 | 234 |
| 259 | 3300005544 | Ga0070686_100066305 | Ga0070686_1000663052 | 234 |
| 260 | 3300005545 | Ga0070695_100205409 | Ga0070695_1002054092 | 234 |
| 261 | 3300005545 | Ga0070695_100538104 | Ga0070695_1005381042 | 234 |
| 262 | 3300005546 | Ga0070696_100056268 | Ga0070696_1000562681 | 234 |
| 263 | 3300005546 | Ga0070696_100356562 | Ga0070696_1003565622 | 234 |
| 264 | 3300005577 | Ga0068857_100126468 | Ga0068857_1001264682 | 234 |
| 265 | 3300005615 | Ga0070702_100083238 | Ga0070702_1000832383 | 234 |
| 266 | 3300005617 | Ga0068859_100024440 | Ga0068859_1000244402 | 234 |
| 267 | 3300005618 | Ga0068864_100364514 | Ga0068864_1003645142 | 234 |
| 268 | 3300005719 | Ga0068861_100127440 | Ga0068861_1001274403 | 234 |
| 269 | 3300005841 | Ga0068863_100567148 | Ga0068863_1005671481 | 234 |
| 270 | 3300005842 | Ga0068858_100411573 | Ga0068858_1004115732 | 234 |
| 271 | 3300005843 | Ga0068860_100059702 | Ga0068860_1000597021 | 234 |
| 272 | 3300005844 | Ga0068862_100193192 | Ga0068862_1001931923 | 234 |
| 273 | 3300006237 | Ga0097621_100001839 | Ga0097621_1000018395 | 234 |
| 274 | 3300006358 | Ga0068871_100008876 | Ga0068871_1000088766 | 234 |
| 275 | 3300006852 | Ga0075433_10301883 | Ga0075433_103018832 | 234 |
| 276 | 3300006871 | Ga0075434_100088915 | Ga0075434_1000889152 | 234 |
| 277 | 3300006931 | Ga0097620_100024441 | Ga0097620_1000244412 | 234 |
| 278 | 3300009094 | Ga0111539_10002546 | Ga0111539_1000254611 | 234 |
| 279 | 3300009094 | Ga0111539_10030262 | Ga0111539_100302626 | 234 |
| 280 | 3300009147 | Ga0114129_10010169 | Ga0114129_100101696 | 234 |
| 281 | 3300009177 | Ga0105248_10016729 | Ga0105248_100167296 | 234 |
| 282 | 3300009551 | Ga0105238_10009259 | Ga0105238_100092593 | 234 |
| 283 | 3300009553 | Ga0105249_10039142 | Ga0105249_100391424 | 234 |
| 284 | 3300009553 | Ga0105249_10061889 | Ga0105249_100618893 | 234 |
| 285 | 3300013100 | Ga0157373_10178496 | Ga0157373_101784961 | 234 |
| 286 | 3300014326 | Ga0157380_10689551 | Ga0157380_106895512 | 234 |
| 287 | 3300014968 | Ga0157379_10021256 | Ga0157379_100212562 | 234 |
| 288 | 3300014968 | Ga0157379_10329507 | Ga0157379_103295072 | 234 |
| 289 | 3300025904 | Ga0207647_10060869 | Ga0207647_100608693 | 234 |
| 290 | 3300025910 | Ga0207684_10025518 | Ga0207684_100255186 | 234 |
| 291 | 3300025910 | Ga0207684_10093261 | Ga0207684_100932611 | 234 |
| 292 | 3300025918 | Ga0207662_10106182 | Ga0207662_101061823 | 234 |
| 293 | 3300025921 | Ga0207652_10193130 | Ga0207652_101931302 | 234 |
| 294 | 3300025922 | Ga0207646_10145455 | Ga0207646_101454552 | 234 |
| 295 | 3300025922 | Ga0207646_10230411 | Ga0207646_102304112 | 234 |
| 296 | 3300025924 | Ga0207694_10093564 | Ga0207694_100935643 | 234 |
| 297 | 3300025941 | Ga0207711_10028793 | Ga0207711_100287933 | 234 |
| 298 | 3300025942 | Ga0207689_10093790 | Ga0207689_100937902 | 234 |
| 299 | 3300025960 | Ga0207651_10665296 | Ga0207651_106652961 | 234 |
| 300 | 3300025961 | Ga0207712_10263442 | Ga0207712_102634422 | 234 |
| 301 | 3300026035 | Ga0207703_10053597 | Ga0207703_100535972 | 234 |
| 302 | 3300026075 | Ga0207708_10015749 | Ga0207708_100157497 | 234 |
| 303 | 3300026088 | Ga0207641_10346587 | Ga0207641_103465872 | 234 |
| 304 | 3300026116 | Ga0207674_10059126 | Ga0207674_100591264 | 234 |
| 305 | 3300026118 | Ga0207675_100032470 | Ga0207675_1000324707 | 234 |
| 306 | 3300027907 | Ga0207428_10004829 | Ga0207428_1000482912 | 234 |
| 307 | 3300027907 | Ga0207428_10010127 | Ga0207428_100101272 | 234 |
| 308 | 3300035091 | Ga0373951_0065403 | Ga0373951_0065403_22_726 | 234 |
| 309 | 3300045051 | Ga0451576_0276709 | Ga0451576_0276709_863_1612 | 234 |
| 310 | 3300049574 | Ga0501038_0000750 | Ga0501038_0000750_22416_23147 | 234 |
| 311 | 3300049576 | Ga0501040_0179458 | Ga0501040_0179458_636_1388 | 234 |
| 312 | 3300049591 | Ga0501075_0283942 | Ga0501075_0283942_104_856 | 234 |
| 313 | 3300049742 | Ga0501080_0562379 | Ga0501080_0562379_179_931 | 234 |
| 314 | 3300050507 | nmdc:mga05p37_35567_c1 | nmdc:mga05p37_35567_c1_4937_5689 | 234 |
| 315 | 3300050511 | nmdc:mga08y16_23282_c1 | nmdc:mga08y16_23282_c1_4960_5709 | 234 |
| 316 | 3300050515 | nmdc:mga0a205_47396_c1 | nmdc:mga0a205_47396_c1_524_1228 | 234 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1yns-assembly1.cif.gz_A | crystal structure of human enolase-phosphatase e1 and its complex with a substrate analog | 0.9288 | 5 | 233 |
| 1zs9-assembly1.cif.gz_A | crystal structure of human enolase-phosphatase e1 | 0.9256 | 5 | 233 |
| 1yns-assembly1.cif.gz_A | crystal structure of human enolase-phosphatase e1 and its complex with a substrate analog | 0.9061 | 5 | 233 |
| 1zs9-assembly1.cif.gz_A | crystal structure of human enolase-phosphatase e1 | 0.9029 | 5 | 233 |
| 2g80-assembly3.cif.gz_C | crystal structure of utr4 protein (unknown transcript 4 protein) (yel038w) from saccharomyces cerevisiae at 2.28 a resolution | 0.8188 | 7 | 234 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q21012_126_245_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9845 | 115 | 231 | 3.40.50.1000 |
| af_Q9VN95_123_242_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9843 | 115 | 231 | 3.40.50.1000 |
| af_Q55FM6_122_259_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9778 | 102 | 234 | 3.40.50.1000 |
| af_Q5PPH0_119_252_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9738 | 104 | 234 | 3.40.50.1000 |
| af_B7EWK0_179_307_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9587 | 106 | 234 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E7EQQ6-F1-model_v4 | Acireductone synthase | 0.9876 | 108 | 234 |
GO:0000287
GO:0019509 GO:0043874 |
| AF-A0A482RVJ4-F1-model_v4 | deleted | 0.9819 | 106 | 234 |
|
| AF-A0A132A2J7-F1-model_v4 | Enolase-phosphatase E-1-like protein 1 | 0.9811 | 99 | 212 |
GO:0019509
GO:0043874 |
| AF-A0A2E7EQQ6-F1-model_v4 | Acireductone synthase | 0.9799 | 108 | 234 |
GO:0000287
GO:0019509 GO:0043874 |
| AF-A0A6V7HQE1-F1-model_v4 | Enolase-phosphatase E1 | 0.9737 | 112 | 234 |
GO:0000287
GO:0005634 GO:0005737 GO:0019509 GO:0043874 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar