F403567

General Info

Members Datasets Scaffolds Average Seq Length
316 177 632 98

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10221003|Ga0070681_102210031
Length 115
Sequence LRASWDGNFRRAVKASMIPIQESAKGIAFAVKVHPRARKNAITGEVGDALKLALTAPPVEGKANQAVIEFFAELFAIPRSSVTIASGETSRNKIVRIAGVSKPAAEQKLAENFKS

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
61 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
105 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
114 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.75
Rhizosphere 94.94
Stem 0
Stem Tuber 0
Unclassified 30.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10221003 3300005458 Bacteria 1809
2 JGI24034J26672_10074561 3300002239 Unclassified 612
3 Ga0070683_101217744 3300005329 Unclassified 723
4 Ga0068869_100000935 3300005334 Bacteria 16859
5 Ga0070680_100345537 3300005336 Bacteria 1265
6 Ga0070682_100140957 3300005337 Bacteria 1643
7 Ga0068868_100625937 3300005338 Unclassified 956
8 Ga0070692_10073119 3300005345 Bacteria 1831
9 Ga0070675_100552754 3300005354 Unclassified 1041
10 Ga0070673_101881982 3300005364 Unclassified 567
11 Ga0070659_100886054 3300005366 Unclassified 779
12 Ga0070709_10282878 3300005434 Bacteria 1206
13 Ga0070709_10370414 3300005434 Bacteria 1062
14 Ga0070709_10418277 3300005434 Bacteria 1004
15 Ga0070714_100000075 3300005435 Bacteria 84982
16 Ga0070714_100020172 3300005435 Bacteria 5440
17 Ga0070714_100032486 3300005435 Unclassified 4356
18 Ga0070714_100774531 3300005435 Unclassified 928
19 Ga0070714_100947804 3300005435 Bacteria 836
20 Ga0070714_101401075 3300005435 Unclassified 682
21 Ga0070713_100000134 3300005436 Bacteria 48639
22 Ga0070713_100134429 3300005436 Bacteria 2184
23 Ga0070713_100502385 3300005436 Bacteria 1144
24 Ga0070710_10116543 3300005437 Bacteria 1611
25 Ga0070711_100000271 3300005439 Bacteria 26787
26 Ga0070711_100030638 3300005439 Unclassified 3564
27 Ga0070711_100038547 3300005439 Bacteria 3214
28 Ga0070711_100726746 3300005439 Bacteria 838
29 Ga0070708_100101496 3300005445 Unclassified 2635
30 Ga0070662_100660921 3300005457 Bacteria 882
31 Ga0070681_10129032 3300005458 Bacteria 2461
32 Ga0070698_101903270 3300005471 Bacteria 548
33 Ga0070679_100806998 3300005530 Unclassified 882
34 Ga0070684_101957605 3300005535 Unclassified 553
35 Ga0068853_100024017 3300005539 Bacteria 5109
36 Ga0068853_101597396 3300005539 Bacteria 632
37 Ga0070693_101559989 3300005547 Unclassified 518
38 Ga0070665_100232433 3300005548 Bacteria 1844
39 Ga0068855_100064646 3300005563 Bacteria 4267
40 Ga0070664_100932721 3300005564 Bacteria 815
41 Ga0068856_102356889 3300005614 Unclassified 540
42 Ga0068859_100062826 3300005617 Unclassified 3744
43 Ga0068858_100001619 3300005842 Bacteria 22968
44 Ga0068860_100005894 3300005843 Bacteria 12335
45 Ga0068862_100097898 3300005844 Bacteria 2562
46 Ga0070717_10011648 3300006028 Bacteria 6688
47 Ga0070717_10018940 3300006028 Bacteria 5389
48 Ga0070717_10236080 3300006028 Bacteria 1611
49 Ga0070717_10316062 3300006028 Bacteria 1391
50 Ga0070717_10374871 3300006028 Bacteria 1275
51 Ga0070717_10964286 3300006028 Unclassified 777
52 Ga0070717_12128404 3300006028 Bacteria 505
53 Ga0070715_10003006 3300006163 Bacteria 5274
54 Ga0070715_11097665 3300006163 Unclassified 501
55 Ga0070716_100003540 3300006173 Bacteria 7367
56 Ga0070716_100017381 3300006173 Bacteria 3728
57 Ga0070716_100060259 3300006173 Bacteria 2191
58 Ga0070716_101346165 3300006173 Bacteria 579
59 Ga0070716_101718595 3300006173 Unclassified 518
60 Ga0070712_100000262 3300006175 Bacteria 29465
61 Ga0070712_100002390 3300006175 Bacteria 11557
62 Ga0070712_100322822 3300006175 Bacteria 1256
63 Ga0097621_100111033 3300006237 Unclassified 2316
64 Ga0075434_100033911 3300006871 Bacteria 5040
65 Ga0075434_101764034 3300006871 Unclassified 626
66 Ga0068865_100314018 3300006881 Unclassified 1258
67 Ga0075436_100604275 3300006914 Bacteria 808
68 Ga0097620_100062828 3300006931 Unclassified 3744
69 Ga0075435_100719169 3300007076 Unclassified 868
70 Ga0075435_100903035 3300007076 Unclassified 770
71 Ga0105240_10157882 3300009093 Bacteria 2696
72 Ga0105245_10002858 3300009098 Bacteria 15509
73 Ga0105245_10317201 3300009098 Bacteria 1534
74 Ga0105242_10142758 3300009176 Bacteria 2080
75 Ga0105242_10210220 3300009176 Unclassified 1734
76 Ga0105248_10264320 3300009177 Bacteria 1937
77 Ga0105237_10136586 3300009545 Bacteria 2446
78 Ga0105237_10236827 3300009545 Bacteria 1827
79 Ga0105238_11835860 3300009551 Bacteria 638
80 Ga0105249_10409980 3300009553 Unclassified 1387
81 Ga0105239_10014364 3300010375 Bacteria 8786
82 Ga0105239_10504148 3300010375 Bacteria 1376
83 Ga0105239_10615858 3300010375 Unclassified 1239
84 Ga0105246_10503857 3300011119 Bacteria 1029
85 Ga0157370_10131759 3300013104 Bacteria 2332
86 Ga0157369_12693769 3300013105 Unclassified 501
87 Ga0157374_10012766 3300013296 Bacteria 7319
88 Ga0157374_10308941 3300013296 Bacteria 1565
89 Ga0157378_10121664 3300013297 Bacteria 2406
90 Ga0157378_10596466 3300013297 Bacteria 1115
91 Ga0157378_12068958 3300013297 Unclassified 620
92 Ga0163162_10004210 3300013306 Bacteria 13826
93 Ga0157372_11107502 3300013307 Unclassified 916
94 Ga0157375_10084316 3300013308 Unclassified 3226
95 Ga0157376_10178865 3300014969 Bacteria 1937
96 Ga0157376_11424695 3300014969 Unclassified 725
97 Ga0182007_10028410 3300015262 Bacteria 1922
98 Ga0224569_107404 3300022732 Bacteria 795
99 Ga0228598_1002843 3300024227 Bacteria 3756
100 Ga0207656_10626200 3300025321 Unclassified 550
101 Ga0207692_10002000 3300025898 Bacteria 7789
102 Ga0207692_10605815 3300025898 Bacteria 704
103 Ga0207647_10002874 3300025904 Bacteria 12974
104 Ga0207685_10003971 3300025905 Bacteria 3683
105 Ga0207685_10801074 3300025905 Unclassified 519
106 Ga0207699_10041384 3300025906 Unclassified 2661
107 Ga0207699_10387185 3300025906 Bacteria 993
108 Ga0207699_10519368 3300025906 Bacteria 861
109 Ga0207699_11174733 3300025906 Unclassified 568
110 Ga0207684_11317558 3300025910 Bacteria 594
111 Ga0207707_11537217 3300025912 Unclassified 526
112 Ga0207693_10000275 3300025915 Bacteria 47590
113 Ga0207693_10008118 3300025915 Bacteria 8605
114 Ga0207693_10092417 3300025915 Bacteria 2371
115 Ga0207663_10004323 3300025916 Bacteria 7053
116 Ga0207663_10207112 3300025916 Bacteria 1419
117 Ga0207663_10598892 3300025916 Bacteria 866
118 Ga0207663_10666157 3300025916 Bacteria 822
119 Ga0207646_10741999 3300025922 Bacteria 876
120 Ga0207687_10003150 3300025927 Bacteria 11190
121 Ga0207700_10000111 3300025928 Bacteria 48784
122 Ga0207700_10006979 3300025928 Bacteria 6872
123 Ga0207700_10149384 3300025928 Bacteria 1929
124 Ga0207700_10201224 3300025928 Bacteria 1678
125 Ga0207664_10000096 3300025929 Bacteria 81164
126 Ga0207664_10043578 3300025929 Bacteria 3510
127 Ga0207664_10116333 3300025929 Unclassified 2231
128 Ga0207664_10885386 3300025929 Unclassified 802
129 Ga0207664_11618233 3300025929 Unclassified 570
130 Ga0207706_11707083 3300025933 Unclassified 507
131 Ga0207704_10281424 3300025938 Unclassified 1264
132 Ga0207665_10000358 3300025939 Bacteria 31676
133 Ga0207665_10031372 3300025939 Bacteria 3516
134 Ga0207665_10559963 3300025939 Unclassified 889
135 Ga0207665_10711543 3300025939 Unclassified 790
136 Ga0207689_10000542 3300025942 Bacteria 35861
137 Ga0207661_11004414 3300025944 Bacteria 768
138 Ga0207661_11770303 3300025944 Bacteria 563
139 Ga0207679_10704520 3300025945 Unclassified 916
140 Ga0207667_10165895 3300025949 Bacteria 2271
141 Ga0207651_11905944 3300025960 Unclassified 534
142 Ga0207677_10108430 3300026023 Bacteria 2062
143 Ga0207677_10111955 3300026023 Bacteria 2035
144 Ga0207703_10010977 3300026035 Bacteria 7058
145 Ga0207702_10077565 3300026078 Bacteria 2874
146 Ga0207702_10275050 3300026078 Bacteria 1590
147 Ga0207641_10097653 3300026088 Bacteria 2582
148 Ga0207675_100081187 3300026118 Bacteria 3040
149 Ga0207683_10317237 3300026121 Bacteria 1427
150 Ga0207698_10757315 3300026142 Unclassified 970
151 Ga0268265_10042450 3300028380 Bacteria 3375
152 Ga0268264_10020572 3300028381 Bacteria 5392
153 Ga0265336_10048924 3300028666 Bacteria 1281
154 Ga0265338_10003551 3300028800 Bacteria 21796
155 Ga0265338_10004711 3300028800 Bacteria 18253
156 Ga0265338_10027722 3300028800 Bacteria 5675
157 Ga0265338_10041379 3300028800 Bacteria 4310
158 Ga0265338_10047557 3300028800 Bacteria 3917
159 Ga0265338_10069802 3300028800 Bacteria 3017
160 Ga0265338_10256899 3300028800 Bacteria 1286
161 Ga0265762_1091236 3300030760 Unclassified 665
162 Ga0265325_10006235 3300031241 Bacteria 7269
163 Ga0265325_10129594 3300031241 Bacteria 1209
164 Ga0265340_10515609 3300031247 Unclassified 526
165 Ga0265339_10072264 3300031249 Bacteria 1836
166 Ga0265339_10074494 3300031249 Bacteria 1803
167 Ga0265339_10204121 3300031249 Bacteria 973
168 Ga0265331_10345709 3300031250 Unclassified 666
169 Ga0265331_10541623 3300031250 Unclassified 525
170 Ga0265316_10016458 3300031344 Bacteria 6412
171 Ga0265316_10041841 3300031344 Bacteria 3664
172 Ga0265316_10285616 3300031344 Unclassified 1205
173 Ga0307408_100017169 3300031548 Unclassified 4842
174 Ga0265314_10038372 3300031711 Unclassified 3461
175 Ga0265314_10043404 3300031711 Unclassified 3198
176 Ga0265314_10412027 3300031711 Unclassified 728
177 Ga0307409_100012125 3300031995 Bacteria 5476
178 Ga0307416_100089065 3300032002 Bacteria 2641
179 Ga0373938_0087895 3300034957 Bacteria 765
180 Ga0373926_0057730 3300035083 Unclassified 1410
181 Ga0373934_0083497 3300035086 Bacteria 1284
182 Ga0373934_0317076 3300035086 Unclassified 647
183 Ga0373944_0058037 3300035089 Unclassified 1235
184 Ga0373923_0126178 3300035111 Unclassified 1147
185 Ga0373936_0014158 3300035113 Unclassified 3047
186 Ga0373945_0003349 3300035116 Bacteria 5036
187 Ga0373945_0003464 3300035116 Bacteria 4965
188 Ga0373945_0014544 3300035116 Bacteria 2639
189 Ga0373953_0043566 3300035117 Unclassified 1792
190 Ga0373954_0013357 3300035118 Bacteria 3659
191 Ga0373956_0012621 3300035119 Bacteria 3505
192 Ga0373956_0043386 3300035119 Bacteria 2002
193 Ga0373957_0007308 3300035120 Bacteria 3531
194 Ga0373957_0180488 3300035120 Unclassified 875
195 Ga0373943_0000047 3300035170 Bacteria 41181
196 Ga0373943_0036666 3300035170 Bacteria 2349
197 Ga0373946_0037452 3300035171 Bacteria 1971
198 Ga0373955_0012079 3300035172 Bacteria 4142
199 Ga0373955_0030585 3300035172 Unclassified 2812
200 Ga0373955_0819676 3300035172 Unclassified 572
201 Ga0373924_0036100 3300035410 Unclassified 2007
202 Ga0373924_0207406 3300035410 Unclassified 865
203 Ga0373935_0000841 3300035692 Bacteria 16552
204 Ga0373935_0001333 3300035692 Bacteria 13657
205 Ga0373935_0009893 3300035692 Bacteria 5714
206 Ga0373935_0104955 3300035692 Unclassified 1868
207 Ga0373935_0192490 3300035692 Bacteria 1406
208 Ga0373935_0366156 3300035692 Bacteria 1030
209 Ga0373935_0590904 3300035692 Bacteria 811
210 Ga0373935_1222307 3300035692 Bacteria 560
211 Ga0373927_0068560 3300035695 Bacteria 2295
212 Ga0373927_0082982 3300035695 Bacteria 2078
213 Ga0373927_0089947 3300035695 Bacteria 1993
214 Ga0373927_0215538 3300035695 Bacteria 1261
215 Ga0373927_0864694 3300035695 Bacteria 597
216 Ga0373933_0010271 3300035724 Bacteria 5129
217 Ga0373933_0072959 3300035724 Bacteria 2091
218 Ga0373933_0538309 3300035724 Bacteria 766
219 Ga0373933_0553348 3300035724 Unclassified 755
220 Ga0373947_0000112 3300035725 Bacteria 40758
221 Ga0373947_0026776 3300035725 Unclassified 3372
222 Ga0373947_0326733 3300035725 Bacteria 1026
223 Ga0373937_0147343 3300036401 Unclassified 2204
224 Ga0373937_0156270 3300036401 Bacteria 2138
225 Ga0373937_0345785 3300036401 Unclassified 1408
226 Ga0373937_0492517 3300036401 Bacteria 1164
227 Ga0373925_0000770 3300037068 Bacteria 29427
228 Ga0373925_0008172 3300037068 Bacteria 7620
229 Ga0373925_0010839 3300037068 Bacteria 6610
230 Ga0373925_0027423 3300037068 Unclassified 4169
231 Ga0373925_0042863 3300037068 Bacteria 3357
232 Ga0373925_0049570 3300037068 Bacteria 3130
233 Ga0395905_0446328 3300037471 Viruses 1191
234 Ga0436360_0709063 3300039438 Bacteria 560
235 Ga0451839_0576847 3300041496 Unclassified 551
236 Ga0466961_0087396 3300044693 Bacteria 1970
237 Ga0466963_0100783 3300044694 Bacteria 1977
238 Ga0466957_0207402 3300044842 Bacteria 1289
239 Ga0466957_0515440 3300044842 Bacteria 830
240 Ga0466959_0187748 3300045049 Bacteria 1443
241 Ga0466958_0057069 3300045836 Bacteria 2373
242 Ga0466958_0254892 3300045836 Unclassified 1123
243 Ga0466967_0338778 3300045976 Unclassified 1454
244 Ga0466967_0937855 3300045976 Bacteria 861
245 Ga0466967_1102739 3300045976 Bacteria 791
246 Ga0495592_0203435 3300046454 Unclassified 1335
247 Ga0495629_0018762 3300046459 Bacteria 4945
248 Ga0495653_0461970 3300046463 Unclassified 797
249 Ga0495653_0710292 3300046463 Bacteria 610
250 Ga0495580_0000603 3300046472 Bacteria 30353
251 Ga0495580_0002140 3300046472 Bacteria 17326
252 Ga0495580_0012747 3300046472 Bacteria 6443
253 Ga0495580_0015311 3300046472 Bacteria 5788
254 Ga0495580_0374273 3300046472 Unclassified 963
255 Ga0495580_0744077 3300046472 Unclassified 639
256 Ga0495580_1008594 3300046472 Unclassified 530
257 Ga0495580_1018630 3300046472 Bacteria 527
258 Ga0495582_0001976 3300046473 Bacteria 11502
259 Ga0495582_0355774 3300046473 Bacteria 843
260 Ga0495639_0098262 3300046475 Bacteria 1380
261 Ga0495639_0593302 3300046475 Unclassified 569
262 Ga0495594_0578444 3300046499 Bacteria 637
263 Ga0495630_0039171 3300046517 Bacteria 3545
264 Ga0495630_0153718 3300046517 Bacteria 1751
265 Ga0495630_0530180 3300046517 Bacteria 903
266 Ga0495652_0509371 3300046529 Bacteria 833
267 Ga0495665_0020860 3300046531 Bacteria 3520
268 Ga0495665_0076150 3300046531 Unclassified 1766
269 Ga0495665_0672869 3300046531 Unclassified 514
270 Ga0495586_0143704 3300046535 Bacteria 1340
271 Ga0495586_0164561 3300046535 Bacteria 1252
272 Ga0495645_0308163 3300046543 Bacteria 1032
273 Ga0495667_0447202 3300046559 Bacteria 812
274 Ga0495634_0710642 3300046642 Bacteria 577
275 Ga0495635_0129158 3300046663 Bacteria 1723
276 Ga0495635_0470853 3300046663 Unclassified 829
277 Ga0495588_0458350 3300046674 Unclassified 669
278 Ga0495599_0196575 3300046678 Unclassified 1240
279 Ga0495623_0001371 3300046679 Bacteria 16530
280 Ga0495623_0114464 3300046679 Bacteria 1631
281 Ga0495647_0054850 3300046681 Unclassified 1559
282 Ga0495658_0007843 3300046683 Bacteria 5287
283 Ga0495658_0022720 3300046683 Bacteria 3321
284 Ga0495669_0116161 3300046684 Bacteria 1252
285 Ga0495670_0525501 3300046691 Unclassified 643
286 Ga0495581_0047366 3300047315 Bacteria 2485
287 Ga0495581_0086399 3300047315 Unclassified 1819
288 Ga0495674_0034545 3300047319 Bacteria 4572
289 Ga0495674_0224244 3300047319 Bacteria 1553
290 Ga0495684_0186707 3300047471 Bacteria 1535
291 Ga0495593_0212968 3300047673 Bacteria 970
292 Ga0495593_0482075 3300047673 Bacteria 621
293 Ga0495602_0099618 3300048088 Bacteria 2389
294 Ga0496103_0367087 3300048906 Bacteria 925
295 Ga0496104_0020276 3300048907 Bacteria 6092
296 Ga0496104_0105390 3300048907 Unclassified 2702
297 Ga0496104_0177537 3300048907 Bacteria 2040
298 Ga0496105_0008491 3300048908 Bacteria 7980
299 Ga0496105_0020434 3300048908 Bacteria 5350
300 Ga0496110_0042861 3300048913 Bacteria 3950
301 Ga0496111_0102159 3300048914 Bacteria 2107
302 Ga0496112_0006571 3300048915 Bacteria 10232
303 Ga0496112_0215374 3300048915 Bacteria 1877
304 Ga0496112_0630396 3300048915 Bacteria 1003
305 Ga0496113_0003019 3300048916 Bacteria 9971
306 Ga0496113_1543603 3300048916 Bacteria 512
307 Ga0496114_0157472 3300048917 Bacteria 1973
308 Ga0496115_0005470 3300048918 Bacteria 9242
309 Ga0501083_0309913 3300049744 Bacteria 1027
310 nmdc:mga0n895_199351_c1 3300050512 Unclassified 2033
311 nmdc:mga0rr50_867406_c1 3300050513 Unclassified 770
312 nmdc:mga08x19_919792_c1 3300050514 Unclassified 621
313 nmdc:mga0a205_743680_c1 3300050515 Unclassified 829
314 Ga0495612_0405017 3300053078 Unclassified 620
315 Ga0495619_0112001 3300053085 Bacteria 1866
316 Ga0466962_0197158 3300061719 Bacteria 983
317 Ga0070681_10221003
318 JGI24034J26672_10074561
319 Ga0070683_101217744
320 Ga0068869_100000935
321 Ga0070680_100345537
322 Ga0070682_100140957
323 Ga0068868_100625937
324 Ga0070692_10073119
325 Ga0070675_100552754
326 Ga0070673_101881982
327 Ga0070659_100886054
328 Ga0070709_10282878
329 Ga0070709_10370414
330 Ga0070709_10418277
331 Ga0070714_100000075
332 Ga0070714_100020172
333 Ga0070714_100032486
334 Ga0070714_100774531
335 Ga0070714_100947804
336 Ga0070714_101401075
337 Ga0070713_100000134
338 Ga0070713_100134429
339 Ga0070713_100502385
340 Ga0070710_10116543
341 Ga0070711_100000271
342 Ga0070711_100030638
343 Ga0070711_100038547
344 Ga0070711_100726746
345 Ga0070708_100101496
346 Ga0070662_100660921
347 Ga0070681_10129032
348 Ga0070698_101903270
349 Ga0070679_100806998
350 Ga0070684_101957605
351 Ga0068853_100024017
352 Ga0068853_101597396
353 Ga0070693_101559989
354 Ga0070665_100232433
355 Ga0068855_100064646
356 Ga0070664_100932721
357 Ga0068856_102356889
358 Ga0068859_100062826
359 Ga0068858_100001619
360 Ga0068860_100005894
361 Ga0068862_100097898
362 Ga0070717_10011648
363 Ga0070717_10018940
364 Ga0070717_10236080
365 Ga0070717_10316062
366 Ga0070717_10374871
367 Ga0070717_10964286
368 Ga0070717_12128404
369 Ga0070715_10003006
370 Ga0070715_11097665
371 Ga0070716_100003540
372 Ga0070716_100017381
373 Ga0070716_100060259
374 Ga0070716_101346165
375 Ga0070716_101718595
376 Ga0070712_100000262
377 Ga0070712_100002390
378 Ga0070712_100322822
379 Ga0097621_100111033
380 Ga0075434_100033911
381 Ga0075434_101764034
382 Ga0068865_100314018
383 Ga0075436_100604275
384 Ga0097620_100062828
385 Ga0075435_100719169
386 Ga0075435_100903035
387 Ga0105240_10157882
388 Ga0105245_10002858
389 Ga0105245_10317201
390 Ga0105242_10142758
391 Ga0105242_10210220
392 Ga0105248_10264320
393 Ga0105237_10136586
394 Ga0105237_10236827
395 Ga0105238_11835860
396 Ga0105249_10409980
397 Ga0105239_10014364
398 Ga0105239_10504148
399 Ga0105239_10615858
400 Ga0105246_10503857
401 Ga0157370_10131759
402 Ga0157369_12693769
403 Ga0157374_10012766
404 Ga0157374_10308941
405 Ga0157378_10121664
406 Ga0157378_10596466
407 Ga0157378_12068958
408 Ga0163162_10004210
409 Ga0157372_11107502
410 Ga0157375_10084316
411 Ga0157376_10178865
412 Ga0157376_11424695
413 Ga0182007_10028410
414 Ga0224569_107404
415 Ga0228598_1002843
416 Ga0207656_10626200
417 Ga0207692_10002000
418 Ga0207692_10605815
419 Ga0207647_10002874
420 Ga0207685_10003971
421 Ga0207685_10801074
422 Ga0207699_10041384
423 Ga0207699_10387185
424 Ga0207699_10519368
425 Ga0207699_11174733
426 Ga0207684_11317558
427 Ga0207707_11537217
428 Ga0207693_10000275
429 Ga0207693_10008118
430 Ga0207693_10092417
431 Ga0207663_10004323
432 Ga0207663_10207112
433 Ga0207663_10598892
434 Ga0207663_10666157
435 Ga0207646_10741999
436 Ga0207687_10003150
437 Ga0207700_10000111
438 Ga0207700_10006979
439 Ga0207700_10149384
440 Ga0207700_10201224
441 Ga0207664_10000096
442 Ga0207664_10043578
443 Ga0207664_10116333
444 Ga0207664_10885386
445 Ga0207664_11618233
446 Ga0207706_11707083
447 Ga0207704_10281424
448 Ga0207665_10000358
449 Ga0207665_10031372
450 Ga0207665_10559963
451 Ga0207665_10711543
452 Ga0207689_10000542
453 Ga0207661_11004414
454 Ga0207661_11770303
455 Ga0207679_10704520
456 Ga0207667_10165895
457 Ga0207651_11905944
458 Ga0207677_10108430
459 Ga0207677_10111955
460 Ga0207703_10010977
461 Ga0207702_10077565
462 Ga0207702_10275050
463 Ga0207641_10097653
464 Ga0207675_100081187
465 Ga0207683_10317237
466 Ga0207698_10757315
467 Ga0268265_10042450
468 Ga0268264_10020572
469 Ga0265336_10048924
470 Ga0265338_10003551
471 Ga0265338_10004711
472 Ga0265338_10027722
473 Ga0265338_10041379
474 Ga0265338_10047557
475 Ga0265338_10069802
476 Ga0265338_10256899
477 Ga0265762_1091236
478 Ga0265325_10006235
479 Ga0265325_10129594
480 Ga0265340_10515609
481 Ga0265339_10072264
482 Ga0265339_10074494
483 Ga0265339_10204121
484 Ga0265331_10345709
485 Ga0265331_10541623
486 Ga0265316_10016458
487 Ga0265316_10041841
488 Ga0265316_10285616
489 Ga0307408_100017169
490 Ga0265314_10038372
491 Ga0265314_10043404
492 Ga0265314_10412027
493 Ga0307409_100012125
494 Ga0307416_100089065
495 Ga0373938_0087895
496 Ga0373926_0057730
497 Ga0373934_0083497
498 Ga0373934_0317076
499 Ga0373944_0058037
500 Ga0373923_0126178
501 Ga0373936_0014158
502 Ga0373945_0003349
503 Ga0373945_0003464
504 Ga0373945_0014544
505 Ga0373953_0043566
506 Ga0373954_0013357
507 Ga0373956_0012621
508 Ga0373956_0043386
509 Ga0373957_0007308
510 Ga0373957_0180488
511 Ga0373943_0000047
512 Ga0373943_0036666
513 Ga0373946_0037452
514 Ga0373955_0012079
515 Ga0373955_0030585
516 Ga0373955_0819676
517 Ga0373924_0036100
518 Ga0373924_0207406
519 Ga0373935_0000841
520 Ga0373935_0001333
521 Ga0373935_0009893
522 Ga0373935_0104955
523 Ga0373935_0192490
524 Ga0373935_0366156
525 Ga0373935_0590904
526 Ga0373935_1222307
527 Ga0373927_0068560
528 Ga0373927_0082982
529 Ga0373927_0089947
530 Ga0373927_0215538
531 Ga0373927_0864694
532 Ga0373933_0010271
533 Ga0373933_0072959
534 Ga0373933_0538309
535 Ga0373933_0553348
536 Ga0373947_0000112
537 Ga0373947_0026776
538 Ga0373947_0326733
539 Ga0373937_0147343
540 Ga0373937_0156270
541 Ga0373937_0345785
542 Ga0373937_0492517
543 Ga0373925_0000770
544 Ga0373925_0008172
545 Ga0373925_0010839
546 Ga0373925_0027423
547 Ga0373925_0042863
548 Ga0373925_0049570
549 Ga0395905_0446328
550 Ga0436360_0709063
551 Ga0451839_0576847
552 Ga0466961_0087396
553 Ga0466963_0100783
554 Ga0466957_0207402
555 Ga0466957_0515440
556 Ga0466959_0187748
557 Ga0466958_0057069
558 Ga0466958_0254892
559 Ga0466967_0338778
560 Ga0466967_0937855
561 Ga0466967_1102739
562 Ga0495592_0203435
563 Ga0495629_0018762
564 Ga0495653_0461970
565 Ga0495653_0710292
566 Ga0495580_0000603
567 Ga0495580_0002140
568 Ga0495580_0012747
569 Ga0495580_0015311
570 Ga0495580_0374273
571 Ga0495580_0744077
572 Ga0495580_1008594
573 Ga0495580_1018630
574 Ga0495582_0001976
575 Ga0495582_0355774
576 Ga0495639_0098262
577 Ga0495639_0593302
578 Ga0495594_0578444
579 Ga0495630_0039171
580 Ga0495630_0153718
581 Ga0495630_0530180
582 Ga0495652_0509371
583 Ga0495665_0020860
584 Ga0495665_0076150
585 Ga0495665_0672869
586 Ga0495586_0143704
587 Ga0495586_0164561
588 Ga0495645_0308163
589 Ga0495667_0447202
590 Ga0495634_0710642
591 Ga0495635_0129158
592 Ga0495635_0470853
593 Ga0495588_0458350
594 Ga0495599_0196575
595 Ga0495623_0001371
596 Ga0495623_0114464
597 Ga0495647_0054850
598 Ga0495658_0007843
599 Ga0495658_0022720
600 Ga0495669_0116161
601 Ga0495670_0525501
602 Ga0495581_0047366
603 Ga0495581_0086399
604 Ga0495674_0034545
605 Ga0495674_0224244
606 Ga0495684_0186707
607 Ga0495593_0212968
608 Ga0495593_0482075
609 Ga0495602_0099618
610 Ga0496103_0367087
611 Ga0496104_0020276
612 Ga0496104_0105390
613 Ga0496104_0177537
614 Ga0496105_0008491
615 Ga0496105_0020434
616 Ga0496110_0042861
617 Ga0496111_0102159
618 Ga0496112_0006571
619 Ga0496112_0215374
620 Ga0496112_0630396
621 Ga0496113_0003019
622 Ga0496113_1543603
623 Ga0496114_0157472
624 Ga0496115_0005470
625 Ga0501083_0309913
626 nmdc:mga0n895_199351_c1
627 nmdc:mga0rr50_867406_c1
628 nmdc:mga08x19_919792_c1
629 nmdc:mga0a205_743680_c1
630 Ga0495612_0405017
631 Ga0495619_0112001
632 Ga0466962_0197158

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02594

DUF167

Uncharacterised ACR, YggU family COG1872

26

98

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n91-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.7823 4 95
1yh5-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.7302 4 100
1n91-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.7217 4 95
1yh5-assembly1.cif.gz_A solution nmr structure of protein yggu from escherichia coli. northeast structural genomics consortium target er14. 0.705 4 100
7mzv-assembly1.cif.gz_A structure of yeast pseudouridine synthase 7 (pus7) 0.691 49 91
ID Description Score Start End Superfamily
af_B7EHD8_35_125_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.9419 8 96 3.30.1200.10
af_A0A1D6GPH0_156_306_3.90.110.10 Alpha Beta;Alpha-Beta Complex;L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2;Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 0.9293 48 66 3.90.110.10
af_Q58035_1_98_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.9203 1 96 3.30.1200.10
af_X1WD69_65_162_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.9155 3 97 3.30.1200.10
af_Q8IKR0_45_147_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.9149 4 97 3.30.1200.10
ID Description Score Start End GO Terms
AF-A0A2V9YAC0-F1-model_v4 UPF0235 protein DMG78_18465 0.9832 1 93 GO:0005737
AF-A0A2E4W7H6-F1-model_v4 UPF0235 protein CL489_09745 0.9809 4 96
AF-A0A383CYL2-F1-model_v4 Uncharacterized protein 0.9752 2 81 GO:0005737
AF-A0A847YRR5-F1-model_v4 UPF0235 protein GYA36_15140 0.9747 2 94 GO:0005737
AF-A9FMG3-F1-model_v4 UPF0235 protein sce8156 0.9736 2 97 GO:0005737

Map