F403369

General Info

Members Datasets Scaffolds Average Seq Length
315 133 315 264

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0009745|Ga0501033_0009745_1058_1942
Length 294
Sequence VSATPIFIVSSGRSGTAMLHKMLGAKPDVEMHHEYAVQITQPLAVKRYLGLIDTAAARQAIAESFGAAVHHSRARLWGDSSNKLSWLIADLAVLFPKARFVHLARDGRKVASSYFHKLGAEAYDDRSNAIMQAYYDTGAGIPPPEKPYWWPVPRRGDLLAEAFRGWDQFQRICWHWAEINRVILDSLAALPPERTLFARLEDLVRAPAQVRALLEFLDLDYRDEDFAAFARPHNVNRPEDHLLSDLQRSQFGEIAAPMMTRLGYGDRAEYAVNYSSINHGRPEWLPEYSGGRDP

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
68 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
72 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
73 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
74 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
88 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
89 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
100 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
113 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
125 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
126 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
127 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
128 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
129 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
130 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
131 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.13
Nodule 0
Rhizoplane 0
Rhizosphere 93.02
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10014247 3300003215 Bacteria 3316
2 rootH2_10003154 3300003320 Bacteria 36753
3 rootH2_10201544 3300003320 Bacteria 3704
4 Ga0070658_10024381 3300005327 Unclassified 4852
5 Ga0070658_10430898 3300005327 Unclassified 1135
6 Ga0070676_10026051 3300005328 Bacteria 3310
7 Ga0070680_100001143 3300005336 Bacteria 19030
8 Ga0070660_100001001 3300005339 Bacteria 18970
9 Ga0070660_100092633 3300005339 Bacteria 2385
10 Ga0070661_100002865 3300005344 Bacteria 11851
11 Ga0070661_100005427 3300005344 Bacteria 8789
12 Ga0070659_100003589 3300005366 Bacteria 11037
13 Ga0070659_100129871 3300005366 Unclassified 2045
14 Ga0070659_100363453 3300005366 Bacteria 1216
15 Ga0070710_10238507 3300005437 Bacteria 1164
16 Ga0070681_10000002 3300005458 Bacteria 821814
17 Ga0070681_10079982 3300005458 Bacteria 3225
18 Ga0070679_100003234 3300005530 Bacteria 14885
19 Ga0070679_100230275 3300005530 Bacteria 1813
20 Ga0068853_100000169 3300005539 Bacteria 45200
21 Ga0068853_100049146 3300005539 Unclassified 3623
22 Ga0070672_100509813 3300005543 Bacteria 1041
23 Ga0070696_100013828 3300005546 Bacteria 5419
24 Ga0070696_100185805 3300005546 Bacteria 1544
25 Ga0070693_100087945 3300005547 Bacteria 1867
26 Ga0070665_100252966 3300005548 Unclassified 1762
27 Ga0068855_100000069 3300005563 Bacteria 124154
28 Ga0068855_100063473 3300005563 Bacteria 4311
29 Ga0068855_100143068 3300005563 Bacteria 2724
30 Ga0068857_100161900 3300005577 Bacteria 2031
31 Ga0068856_100316225 3300005614 Bacteria 1579
32 Ga0068852_100001873 3300005616 Bacteria 14312
33 Ga0068852_100063249 3300005616 Bacteria 3222
34 Ga0068858_100008781 3300005842 Bacteria 9693
35 Ga0068865_100130886 3300006881 Bacteria 1880
36 Ga0105240_10000055 3300009093 Bacteria 225380
37 Ga0105240_10001622 3300009093 Bacteria 38172
38 Ga0105240_10048206 3300009093 Bacteria 5386
39 Ga0105240_10054861 3300009093 Bacteria 4992
40 Ga0105240_10129184 3300009093 Bacteria 3032
41 Ga0105240_10145653 3300009093 Unclassified 2827
42 Ga0105240_10372064 3300009093 Bacteria 1615
43 Ga0111539_10560577 3300009094 Unclassified 1330
44 Ga0105245_10018370 3300009098 Bacteria 6114
45 Ga0105241_10098631 3300009174 Unclassified 2318
46 Ga0105241_10134790 3300009174 Unclassified 2004
47 Ga0105241_10148352 3300009174 Unclassified 1916
48 Ga0105241_10226979 3300009174 Bacteria 1573
49 Ga0105241_10275968 3300009174 Bacteria 1434
50 Ga0105242_10006495 3300009176 Bacteria 9005
51 Ga0105248_10000001 3300009177 Bacteria 1881304
52 Ga0105248_10254435 3300009177 Bacteria 1977
53 Ga0105237_10075401 3300009545 Bacteria 3364
54 Ga0105237_10078041 3300009545 Bacteria 3301
55 Ga0105237_10419398 3300009545 Bacteria 1344
56 Ga0105238_10001302 3300009551 Bacteria 25101
57 Ga0105238_10055903 3300009551 Bacteria 3960
58 Ga0105238_10114558 3300009551 Unclassified 2675
59 Ga0105238_10176285 3300009551 Bacteria 2114
60 Ga0105238_10516158 3300009551 Bacteria 1197
61 Ga0105239_10008712 3300010375 Bacteria 11482
62 Ga0105239_10011263 3300010375 Bacteria 9976
63 Ga0105239_10058402 3300010375 Bacteria 4233
64 Ga0105239_10077460 3300010375 Bacteria 3659
65 Ga0105239_10078908 3300010375 Bacteria 3623
66 Ga0105239_10092288 3300010375 Unclassified 3343
67 Ga0105239_10143493 3300010375 Bacteria 2662
68 Ga0105239_10713902 3300010375 Bacteria 1147
69 Ga0105246_10299141 3300011119 Bacteria 1298
70 Ga0157373_10076240 3300013100 Unclassified 2366
71 Ga0157370_10003965 3300013104 Bacteria 17216
72 Ga0157370_10035651 3300013104 Bacteria 4833
73 Ga0157370_10267136 3300013104 Unclassified 1581
74 Ga0157369_10042801 3300013105 Bacteria 4940
75 Ga0157369_10073546 3300013105 Unclassified 3667
76 Ga0157378_10033537 3300013297 Bacteria 4540
77 Ga0157378_10084545 3300013297 Unclassified 2873
78 Ga0163162_10805730 3300013306 Unclassified 1056
79 Ga0157372_10006121 3300013307 Bacteria 12785
80 Ga0157372_10325126 3300013307 Bacteria 1791
81 Ga0213876_10002162 3300021384 Bacteria 11621
82 Ga0213876_10013504 3300021384 Unclassified 4335
83 Ga0209455_1006796 3300025272 Bacteria 3328
84 Ga0209758_1000008 3300025297 Bacteria 1215263
85 Ga0207705_10000058 3300025909 Bacteria 155967
86 Ga0207654_10161675 3300025911 Unclassified 1447
87 Ga0207654_10262205 3300025911 Unclassified 1162
88 Ga0207707_10000002 3300025912 Bacteria 1142054
89 Ga0207707_10000263 3300025912 Bacteria 56613
90 Ga0207707_10112361 3300025912 Bacteria 2382
91 Ga0207695_10000012 3300025913 Bacteria 840961
92 Ga0207695_10005200 3300025913 Bacteria 17414
93 Ga0207695_10023785 3300025913 Bacteria 6914
94 Ga0207695_10077388 3300025913 Bacteria 3379
95 Ga0207695_10081242 3300025913 Unclassified 3280
96 Ga0207671_10065978 3300025914 Bacteria 2693
97 Ga0207671_10091577 3300025914 Bacteria 2291
98 Ga0207671_10262985 3300025914 Bacteria 1358
99 Ga0207693_10051624 3300025915 Bacteria 3227
100 Ga0207660_10000358 3300025917 Bacteria 29719
101 Ga0207660_10000598 3300025917 Bacteria 24324
102 Ga0207657_10000305 3300025919 Bacteria 51999
103 Ga0207657_10073673 3300025919 Bacteria 2885
104 Ga0207649_10000026 3300025920 Bacteria 177395
105 Ga0207649_10007469 3300025920 Bacteria 5942
106 Ga0207652_10000505 3300025921 Bacteria 39729
107 Ga0207652_10000679 3300025921 Bacteria 33231
108 Ga0207652_10157292 3300025921 Unclassified 2036
109 Ga0207694_10000006 3300025924 Bacteria 631109
110 Ga0207694_10075221 3300025924 Unclassified 2643
111 Ga0207694_10445614 3300025924 Unclassified 1080
112 Ga0207687_10047301 3300025927 Bacteria 2982
113 Ga0207690_10043456 3300025932 Bacteria 2957
114 Ga0207691_10629535 3300025940 Bacteria 907
115 Ga0207711_10000001 3300025941 Bacteria 1325674
116 Ga0207661_10645238 3300025944 Unclassified 973
117 Ga0207667_10000026 3300025949 Bacteria 343713
118 Ga0207667_10109380 3300025949 Bacteria 2850
119 Ga0207712_10482310 3300025961 Unclassified 1057
120 Ga0207640_10305468 3300025981 Unclassified 1260
121 Ga0207703_10006319 3300026035 Bacteria 9470
122 Ga0207639_10000177 3300026041 Bacteria 49899
123 Ga0207639_10070777 3300026041 Unclassified 2726
124 Ga0207678_10024407 3300026067 Bacteria 5279
125 Ga0207648_10369635 3300026089 Unclassified 1295
126 Ga0207674_10069382 3300026116 Bacteria 3545
127 Ga0207698_10022737 3300026142 Bacteria 4366
128 Ga0207698_10042273 3300026142 Bacteria 3403
129 Ga0207698_10157968 3300026142 Bacteria 1979
130 Ga0265337_1000207 3300028556 Bacteria 31578
131 Ga0265334_10004531 3300028573 Bacteria 6159
132 Ga0265334_10011897 3300028573 Bacteria 3655
133 Ga0265318_10000457 3300028577 Bacteria 30611
134 Ga0265318_10002023 3300028577 Bacteria 11213
135 Ga0265338_10000011 3300028800 Bacteria 433370
136 Ga0265338_10013228 3300028800 Bacteria 9339
137 Ga0265338_10022625 3300028800 Bacteria 6497
138 Ga0265338_10129504 3300028800 Unclassified 1996
139 Ga0265338_10236127 3300028800 Unclassified 1357
140 Ga0265330_10015057 3300031235 Bacteria 3582
141 Ga0265330_10030119 3300031235 Bacteria 2439
142 Ga0265330_10051076 3300031235 Unclassified 1813
143 Ga0265330_10169709 3300031235 Bacteria 925
144 Ga0265332_10003059 3300031238 Bacteria 8190
145 Ga0265332_10010958 3300031238 Bacteria 4027
146 Ga0265328_10012906 3300031239 Unclassified 3318
147 Ga0265328_10072580 3300031239 Bacteria 1265
148 Ga0265320_10156057 3300031240 Unclassified 1029
149 Ga0265325_10000002 3300031241 Bacteria 396758
150 Ga0265325_10000163 3300031241 Bacteria 47195
151 Ga0265325_10006421 3300031241 Bacteria 7131
152 Ga0265325_10158487 3300031241 Bacteria 1066
153 Ga0265340_10000016 3300031247 Bacteria 94019
154 Ga0265340_10000602 3300031247 Bacteria 20076
155 Ga0265340_10013587 3300031247 Bacteria 4274
156 Ga0265340_10018723 3300031247 Bacteria 3569
157 Ga0265339_10000709 3300031249 Bacteria 25841
158 Ga0265339_10008803 3300031249 Bacteria 6389
159 Ga0265339_10019699 3300031249 Bacteria 3955
160 Ga0265339_10019722 3300031249 Unclassified 3952
161 Ga0265331_10000008 3300031250 Bacteria 324311
162 Ga0265331_10000009 3300031250 Bacteria 314950
163 Ga0265331_10001065 3300031250 Bacteria 21378
164 Ga0265331_10002786 3300031250 Bacteria 11591
165 Ga0265327_10000036 3300031251 Bacteria 312827
166 Ga0265327_10010535 3300031251 Bacteria 6484
167 Ga0265316_10004664 3300031344 Bacteria 13572
168 Ga0265316_10036824 3300031344 Bacteria 3955
169 Ga0265316_10092258 3300031344 Bacteria 2309
170 Ga0265316_10190878 3300031344 Bacteria 1522
171 Ga0265316_10201568 3300031344 Bacteria 1475
172 Ga0265316_10390425 3300031344 Bacteria 1003
173 Ga0265313_10000338 3300031595 Bacteria 50856
174 Ga0265313_10001699 3300031595 Bacteria 20295
175 Ga0265313_10002422 3300031595 Bacteria 16124
176 Ga0265313_10002567 3300031595 Bacteria 15507
177 Ga0265313_10011240 3300031595 Bacteria 5579
178 Ga0265314_10003469 3300031711 Bacteria 15229
179 Ga0265314_10007827 3300031711 Bacteria 9233
180 Ga0265314_10009666 3300031711 Bacteria 8122
181 Ga0265314_10011714 3300031711 Bacteria 7215
182 Ga0265314_10015671 3300031711 Bacteria 6008
183 Ga0265314_10039564 3300031711 Unclassified 3394
184 Ga0265314_10042465 3300031711 Bacteria 3243
185 Ga0265314_10050456 3300031711 Bacteria 2906
186 Ga0265314_10112932 3300031711 Unclassified 1723
187 Ga0265314_10122737 3300031711 Bacteria 1632
188 Ga0265314_10127711 3300031711 Bacteria 1590
189 Ga0265342_10004506 3300031712 Bacteria 10928
190 Ga0265342_10004736 3300031712 Bacteria 10594
191 Ga0265342_10029022 3300031712 Bacteria 3438
192 Ga0265342_10039978 3300031712 Unclassified 2846
193 Ga0265342_10087395 3300031712 Bacteria 1791
194 Ga0395898_0084871 3300037466 Unclassified 3052
195 Ga0395901_0038339 3300038443 Bacteria 4956
196 Ga0436365_0530758 3300039437 Archaea 949
197 Ga0436365_1513507 3300039437 Bacteria 68714
198 Ga0436365_1848959 3300039437 Bacteria 20440
199 Ga0436360_1135335 3300039438 Bacteria 1580
200 Ga0495582_0047353 3300046473 Bacteria 2368
201 Ga0495664_0114585 3300046477 Bacteria 1629
202 Ga0495628_0261213 3300046516 Bacteria 1290
203 Ga0495652_0042039 3300046529 Unclassified 3942
204 Ga0495652_0223123 3300046529 Bacteria 1415
205 Ga0495587_0021170 3300046536 Bacteria 4010
206 Ga0495645_0006391 3300046543 Bacteria 8181
207 Ga0495599_0331861 3300046678 Unclassified 914
208 Ga0495581_0310778 3300047315 Bacteria 921
209 Ga0495674_0075976 3300047319 Unclassified 2890
210 Ga0495675_0152749 3300047444 Unclassified 1426
211 Ga0496121_0001374 3300048924 Bacteria 41288
212 Ga0496126_0002288 3300048929 Bacteria 26402
213 Ga0495682_0000460 3300049460 Bacteria 28085
214 Ga0501031_0019057 3300049568 Bacteria 4467
215 Ga0501031_0057675 3300049568 Bacteria 2530
216 Ga0501031_0151063 3300049568 Bacteria 1518
217 Ga0501032_0039469 3300049569 Bacteria 3211
218 Ga0501032_0093205 3300049569 Bacteria 1997
219 Ga0501032_0118233 3300049569 Bacteria 1753
220 Ga0501033_0006770 3300049570 Bacteria 8952
221 Ga0501033_0009745 3300049570 Bacteria 7380
222 Ga0501033_0018496 3300049570 Bacteria 5265
223 Ga0501033_0068922 3300049570 Bacteria 2600
224 Ga0501033_0069749 3300049570 Bacteria 2583
225 Ga0501033_0118101 3300049570 Bacteria 1926
226 Ga0501033_0161650 3300049570 Bacteria 1612
227 Ga0501033_0335060 3300049570 Bacteria 1061
228 Ga0501034_0013758 3300049571 Bacteria 8324
229 Ga0501034_0018416 3300049571 Bacteria 7161
230 Ga0501034_0029747 3300049571 Bacteria 5553
231 Ga0501034_0060781 3300049571 Bacteria 3795
232 Ga0501034_0164682 3300049571 Unclassified 2186
233 Ga0501034_0872025 3300049571 Bacteria 789
234 Ga0501036_0030467 3300049572 Bacteria 4556
235 Ga0501036_0090815 3300049572 Bacteria 2580
236 Ga0501037_0014319 3300049573 Bacteria 5843
237 Ga0501037_0056660 3300049573 Unclassified 2862
238 Ga0501037_0097571 3300049573 Bacteria 2123
239 Ga0501038_0020605 3300049574 Bacteria 5926
240 Ga0501038_0042275 3300049574 Bacteria 3969
241 Ga0501038_0186804 3300049574 Unclassified 1670
242 Ga0501038_0250368 3300049574 Unclassified 1404
243 Ga0501043_0015742 3300049579 Bacteria 5929
244 Ga0501043_0039077 3300049579 Unclassified 3730
245 Ga0501043_0223700 3300049579 Bacteria 1455
246 Ga0501043_0228484 3300049579 Bacteria 1438
247 Ga0501043_0335216 3300049579 Bacteria 1151
248 Ga0501046_0005739 3300049580 Bacteria 11076
249 Ga0501046_0376371 3300049580 Bacteria 1028
250 Ga0501047_0001789 3300049581 Bacteria 20799
251 Ga0501047_0004036 3300049581 Bacteria 13807
252 Ga0501047_0009122 3300049581 Bacteria 9368
253 Ga0501047_0014230 3300049581 Bacteria 7563
254 Ga0501047_0015838 3300049581 Bacteria 7184
255 Ga0501047_0042623 3300049581 Bacteria 4385
256 Ga0501047_0108783 3300049581 Bacteria 2655
257 Ga0501047_0123060 3300049581 Bacteria 2475
258 Ga0501047_0305874 3300049581 Unclassified 1431
259 Ga0501047_0367396 3300049581 Bacteria 1274
260 Ga0501047_0410094 3300049581 Bacteria 1187
261 Ga0501048_0011324 3300049582 Bacteria 6651
262 Ga0501067_0008255 3300049583 Bacteria 5784
263 Ga0501067_0014363 3300049583 Bacteria 4384
264 Ga0501067_0181944 3300049583 Unclassified 1171
265 Ga0501068_0137057 3300049584 Unclassified 1533
266 Ga0501070_0000017 3300049586 Bacteria 173127
267 Ga0501070_0086412 3300049586 Bacteria 2597
268 Ga0501070_0172954 3300049586 Bacteria 1779
269 Ga0501072_0008074 3300049588 Bacteria 7988
270 Ga0501072_0225655 3300049588 Bacteria 1493
271 Ga0501073_0041561 3300049589 Bacteria 3248
272 Ga0501073_0046528 3300049589 Bacteria 3051
273 Ga0501073_0173895 3300049589 Bacteria 1491
274 Ga0501079_0002077 3300049741 Bacteria 14360
275 Ga0501080_0008039 3300049742 Bacteria 9557
276 Ga0501080_0063287 3300049742 Bacteria 3443
277 Ga0501080_0076545 3300049742 Bacteria 3111
278 Ga0501080_0303469 3300049742 Unclassified 1447
279 Ga0501083_0307483 3300049744 Bacteria 1031
280 Ga0501035_0002699 3300049822 Bacteria 17244
281 Ga0501035_0006022 3300049822 Bacteria 11418
282 Ga0501035_0006866 3300049822 Bacteria 10632
283 Ga0501035_0025731 3300049822 Bacteria 5394
284 Ga0501035_0084642 3300049822 Bacteria 2796
285 Ga0501035_0183204 3300049822 Bacteria 1803
286 Ga0501035_0217972 3300049822 Unclassified 1630
287 Ga0501035_0273997 3300049822 Bacteria 1428
288 Ga0501044_0002656 3300049823 Bacteria 20336
289 Ga0501044_0006634 3300049823 Bacteria 12763
290 Ga0501044_0007218 3300049823 Bacteria 12222
291 Ga0501044_0032668 3300049823 Bacteria 5470
292 Ga0501044_0034138 3300049823 Bacteria 5339
293 Ga0501044_0037148 3300049823 Bacteria 5092
294 Ga0501044_0048516 3300049823 Bacteria 4385
295 Ga0501044_0065987 3300049823 Bacteria 3691
296 Ga0501044_0067890 3300049823 Bacteria 3632
297 Ga0501044_0227786 3300049823 Bacteria 1812
298 Ga0501044_0296692 3300049823 Bacteria 1546
299 Ga0501044_0343057 3300049823 Bacteria 1414
300 nmdc:mga06r32_512754_c1 3300050510 Unclassified 1175
301 nmdc:mga08y16_284269_c1 3300050511 Unclassified 1706
302 nmdc:mga08y16_504170_c1 3300050511 Unclassified 1229
303 Ga0500595_015827 3300053119 Bacteria 2823
304 Ga0500642_0097683 3300053130 Unclassified 1363
305 Ga0500655_001287 3300053133 Unclassified 4755
306 Ga0500559_0000006 3300053136 Bacteria 229895
307 Ga0500559_0034721 3300053136 Bacteria 2176
308 Ga0500568_0085208 3300053139 Unclassified 1196
309 Ga0500619_036529 3300053154 Unclassified 1530
310 Ga0500619_090178 3300053154 Bacteria 1035
311 Ga0500639_059047 3300053163 Bacteria 1981
312 Ga0500636_0015799 3300053177 Bacteria 4449
313 Ga0501084_0004285 3300054114 Bacteria 11616
314 Ga0501084_0033558 3300054114 Bacteria 4294
315 Ga0501082_0058976 3300060353 Bacteria 3307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005842 Ga0068858_100008781 Ga0068858_1000087813 221
2 3300026035 Ga0207703_10006319 Ga0207703_100063195 221
3 3300031247 Ga0265340_10013587 Ga0265340_100135874 222
4 3300049571 Ga0501034_0872025 Ga0501034_0872025_22_774 222
5 3300049581 Ga0501047_0410094 Ga0501047_0410094_11_751 222
6 3300039437 Ga0436365_0530758 Ga0436365_0530758_22_759 228
7 3300028577 Ga0265318_10002023 Ga0265318_100020232 232
8 3300028800 Ga0265338_10236127 Ga0265338_102361272 232
9 3300031239 Ga0265328_10072580 Ga0265328_100725802 232
10 3300031240 Ga0265320_10156057 Ga0265320_101560572 232
11 3300031241 Ga0265325_10006421 Ga0265325_100064213 232
12 3300031250 Ga0265331_10001065 Ga0265331_100010658 232
13 3300031344 Ga0265316_10190878 Ga0265316_101908782 232
14 3300031595 Ga0265313_10000338 Ga0265313_100003383 232
15 3300031595 Ga0265313_10001699 Ga0265313_1000169911 232
16 3300031711 Ga0265314_10007827 Ga0265314_100078272 232
17 3300031711 Ga0265314_10009666 Ga0265314_100096665 232
18 3300031712 Ga0265342_10087395 Ga0265342_100873952 232
19 3300005563 Ga0068855_100000069 Ga0068855_100000069120 233
20 3300025911 Ga0207654_10262205 Ga0207654_102622052 233
21 3300025913 Ga0207695_10000012 Ga0207695_10000012176 233
22 3300025949 Ga0207667_10000026 Ga0207667_10000026217 233
23 3300005344 Ga0070661_100005427 Ga0070661_1000054277 235
24 3300005437 Ga0070710_10238507 Ga0070710_102385071 235
25 3300005539 Ga0068853_100049146 Ga0068853_1000491462 235
26 3300005614 Ga0068856_100316225 Ga0068856_1003162251 235
27 3300005616 Ga0068852_100001873 Ga0068852_1000018737 235
28 3300009551 Ga0105238_10114558 Ga0105238_101145583 235
29 3300013100 Ga0157373_10076240 Ga0157373_100762402 235
30 3300013105 Ga0157369_10042801 Ga0157369_100428013 235
31 3300021384 Ga0213876_10013504 Ga0213876_100135042 235
32 3300025915 Ga0207693_10051624 Ga0207693_100516242 235
33 3300025924 Ga0207694_10000006 Ga0207694_10000006488 235
34 3300025927 Ga0207687_10047301 Ga0207687_100473012 235
35 3300025944 Ga0207661_10645238 Ga0207661_106452381 235
36 3300025961 Ga0207712_10482310 Ga0207712_104823102 235
37 3300026041 Ga0207639_10070777 Ga0207639_100707772 235
38 3300026142 Ga0207698_10157968 Ga0207698_101579682 235
39 3300031241 Ga0265325_10158487 Ga0265325_101584871 235
40 3300031344 Ga0265316_10201568 Ga0265316_102015682 235
41 3300046516 Ga0495628_0261213 Ga0495628_0261213_498_1277 235
42 3300046678 Ga0495599_0331861 Ga0495599_0331861_15_788 235
43 3300049570 Ga0501033_0118101 Ga0501033_0118101_30_803 235
44 3300049571 Ga0501034_0029747 Ga0501034_0029747_1374_2147 235
45 3300049572 Ga0501036_0090815 Ga0501036_0090815_709_1482 235
46 3300049574 Ga0501038_0250368 Ga0501038_0250368_10_783 235
47 3300049579 Ga0501043_0223700 Ga0501043_0223700_626_1399 235
48 3300049580 Ga0501046_0005739 Ga0501046_0005739_3293_4066 235
49 3300049581 Ga0501047_0001789 Ga0501047_0001789_9678_10451 235
50 3300049581 Ga0501047_0108783 Ga0501047_0108783_1861_2625 235
51 3300049581 Ga0501047_0305874 Ga0501047_0305874_502_1275 235
52 3300049586 Ga0501070_0172954 Ga0501070_0172954_981_1760 235
53 3300049588 Ga0501072_0225655 Ga0501072_0225655_695_1468 235
54 3300049589 Ga0501073_0046528 Ga0501073_0046528_1331_2104 235
55 3300049742 Ga0501080_0063287 Ga0501080_0063287_2128_2901 235
56 3300049744 Ga0501083_0307483 Ga0501083_0307483_10_783 235
57 3300049823 Ga0501044_0067890 Ga0501044_0067890_762_1535 235
58 3300049823 Ga0501044_0296692 Ga0501044_0296692_101_874 235
59 3300053130 Ga0500642_0097683 Ga0500642_0097683_455_1234 235
60 3300003320 rootH2_10201544 rootH2_102015444 236
61 3300048924 Ga0496121_0001374 Ga0496121_0001374_35545_36366 245
62 3300009174 Ga0105241_10226979 Ga0105241_102269792 246
63 3300005546 Ga0070696_100185805 Ga0070696_1001858052 247
64 3300005547 Ga0070693_100087945 Ga0070693_1000879452 247
65 3300009176 Ga0105242_10006495 Ga0105242_100064954 247
66 3300021384 Ga0213876_10002162 Ga0213876_1000216210 247
67 3300039437 Ga0436365_1513507 Ga0436365_1513507_41253_42065 247
68 3300054114 Ga0501084_0004285 Ga0501084_0004285_9724_10527 247
69 3300009093 Ga0105240_10000055 Ga0105240_10000055161 249
70 3300009177 Ga0105248_10254435 Ga0105248_102544352 249
71 3300048929 Ga0496126_0002288 Ga0496126_0002288_7528_8349 249
72 3300028573 Ga0265334_10011897 Ga0265334_100118973 250
73 3300028800 Ga0265338_10000011 Ga0265338_10000011352 250
74 3300031238 Ga0265332_10003059 Ga0265332_100030593 250
75 3300031241 Ga0265325_10000002 Ga0265325_1000000220 250
76 3300031249 Ga0265339_10000709 Ga0265339_100007093 250
77 3300031250 Ga0265331_10002786 Ga0265331_100027869 250
78 3300031344 Ga0265316_10092258 Ga0265316_100922582 250
79 3300031595 Ga0265313_10002567 Ga0265313_100025673 250
80 3300031712 Ga0265342_10004506 Ga0265342_100045067 250
81 3300046529 Ga0495652_0223123 Ga0495652_0223123_488_1324 250
82 3300047444 Ga0495675_0152749 Ga0495675_0152749_237_1067 250
83 3300049569 Ga0501032_0039469 Ga0501032_0039469_919_1749 250
84 3300049570 Ga0501033_0006770 Ga0501033_0006770_6350_7180 250
85 3300049571 Ga0501034_0164682 Ga0501034_0164682_705_1535 250
86 3300049583 Ga0501067_0181944 Ga0501067_0181944_67_897 250
87 3300049586 Ga0501070_0086412 Ga0501070_0086412_1718_2548 250
88 3300049589 Ga0501073_0173895 Ga0501073_0173895_375_1190 250
89 3300049742 Ga0501080_0076545 Ga0501080_0076545_154_984 250
90 3300049822 Ga0501035_0217972 Ga0501035_0217972_459_1289 250
91 3300003215 JGI25153J46596_10014247 JGI25153J46596_100142473 251
92 3300003320 rootH2_10003154 rootH2_1000315414 251
93 3300005327 Ga0070658_10024381 Ga0070658_100243814 251
94 3300005327 Ga0070658_10430898 Ga0070658_104308981 251
95 3300005328 Ga0070676_10026051 Ga0070676_100260513 251
96 3300005336 Ga0070680_100001143 Ga0070680_1000011438 251
97 3300005339 Ga0070660_100001001 Ga0070660_10000100114 251
98 3300005339 Ga0070660_100092633 Ga0070660_1000926332 251
99 3300005344 Ga0070661_100002865 Ga0070661_10000286510 251
100 3300005366 Ga0070659_100003589 Ga0070659_1000035897 251
101 3300005366 Ga0070659_100129871 Ga0070659_1001298712 251
102 3300005366 Ga0070659_100363453 Ga0070659_1003634531 251
103 3300005458 Ga0070681_10000002 Ga0070681_10000002589 251
104 3300005458 Ga0070681_10079982 Ga0070681_100799822 251
105 3300005530 Ga0070679_100003234 Ga0070679_1000032348 251
106 3300005530 Ga0070679_100230275 Ga0070679_1002302752 251
107 3300005539 Ga0068853_100000169 Ga0068853_10000016923 251
108 3300005543 Ga0070672_100509813 Ga0070672_1005098131 251
109 3300005546 Ga0070696_100013828 Ga0070696_1000138283 251
110 3300005548 Ga0070665_100252966 Ga0070665_1002529662 251
111 3300005563 Ga0068855_100063473 Ga0068855_1000634734 251
112 3300005563 Ga0068855_100143068 Ga0068855_1001430682 251
113 3300005577 Ga0068857_100161900 Ga0068857_1001619002 251
114 3300005616 Ga0068852_100063249 Ga0068852_1000632493 251
115 3300006881 Ga0068865_100130886 Ga0068865_1001308862 251
116 3300009093 Ga0105240_10001622 Ga0105240_1000162222 251
117 3300009093 Ga0105240_10048206 Ga0105240_100482064 251
118 3300009093 Ga0105240_10054861 Ga0105240_100548614 251
119 3300009093 Ga0105240_10129184 Ga0105240_101291842 251
120 3300009093 Ga0105240_10145653 Ga0105240_101456532 251
121 3300009093 Ga0105240_10372064 Ga0105240_103720642 251
122 3300009094 Ga0111539_10560577 Ga0111539_105605772 251
123 3300009098 Ga0105245_10018370 Ga0105245_100183703 251
124 3300009174 Ga0105241_10098631 Ga0105241_100986312 251
125 3300009174 Ga0105241_10134790 Ga0105241_101347902 251
126 3300009174 Ga0105241_10148352 Ga0105241_101483523 251
127 3300009174 Ga0105241_10275968 Ga0105241_102759682 251
128 3300009177 Ga0105248_10000001 Ga0105248_100000011725 251
129 3300009545 Ga0105237_10075401 Ga0105237_100754012 251
130 3300009545 Ga0105237_10078041 Ga0105237_100780412 251
131 3300009545 Ga0105237_10419398 Ga0105237_104193982 251
132 3300009551 Ga0105238_10001302 Ga0105238_100013028 251
133 3300009551 Ga0105238_10055903 Ga0105238_100559032 251
134 3300009551 Ga0105238_10176285 Ga0105238_101762852 251
135 3300009551 Ga0105238_10516158 Ga0105238_105161582 251
136 3300010375 Ga0105239_10008712 Ga0105239_100087122 251
137 3300010375 Ga0105239_10011263 Ga0105239_100112635 251
138 3300010375 Ga0105239_10058402 Ga0105239_100584022 251
139 3300010375 Ga0105239_10077460 Ga0105239_100774602 251
140 3300010375 Ga0105239_10078908 Ga0105239_100789084 251
141 3300010375 Ga0105239_10092288 Ga0105239_100922882 251
142 3300010375 Ga0105239_10143493 Ga0105239_101434933 251
143 3300010375 Ga0105239_10713902 Ga0105239_107139022 251
144 3300011119 Ga0105246_10299141 Ga0105246_102991412 251
145 3300013104 Ga0157370_10003965 Ga0157370_100039653 251
146 3300013104 Ga0157370_10035651 Ga0157370_100356514 251
147 3300013104 Ga0157370_10267136 Ga0157370_102671361 251
148 3300013105 Ga0157369_10073546 Ga0157369_100735462 251
149 3300013297 Ga0157378_10033537 Ga0157378_100335371 251
150 3300013297 Ga0157378_10084545 Ga0157378_100845452 251
151 3300013306 Ga0163162_10805730 Ga0163162_108057301 251
152 3300013307 Ga0157372_10006121 Ga0157372_1000612111 251
153 3300013307 Ga0157372_10325126 Ga0157372_103251262 251
154 3300025272 Ga0209455_1006796 Ga0209455_10067962 251
155 3300025297 Ga0209758_1000008 Ga0209758_1000008198 251
156 3300025909 Ga0207705_10000058 Ga0207705_1000005886 251
157 3300025911 Ga0207654_10161675 Ga0207654_101616752 251
158 3300025912 Ga0207707_10000002 Ga0207707_10000002369 251
159 3300025912 Ga0207707_10000263 Ga0207707_1000026340 251
160 3300025912 Ga0207707_10112361 Ga0207707_101123612 251
161 3300025913 Ga0207695_10005200 Ga0207695_100052009 251
162 3300025913 Ga0207695_10023785 Ga0207695_100237852 251
163 3300025913 Ga0207695_10077388 Ga0207695_100773884 251
164 3300025913 Ga0207695_10081242 Ga0207695_100812423 251
165 3300025914 Ga0207671_10065978 Ga0207671_100659782 251
166 3300025914 Ga0207671_10091577 Ga0207671_100915772 251
167 3300025914 Ga0207671_10262985 Ga0207671_102629851 251
168 3300025917 Ga0207660_10000358 Ga0207660_1000035814 251
169 3300025917 Ga0207660_10000598 Ga0207660_1000059814 251
170 3300025919 Ga0207657_10000305 Ga0207657_1000030515 251
171 3300025919 Ga0207657_10073673 Ga0207657_100736732 251
172 3300025920 Ga0207649_10000026 Ga0207649_10000026160 251
173 3300025920 Ga0207649_10007469 Ga0207649_100074694 251
174 3300025921 Ga0207652_10000505 Ga0207652_1000050517 251
175 3300025921 Ga0207652_10000679 Ga0207652_1000067915 251
176 3300025921 Ga0207652_10157292 Ga0207652_101572922 251
177 3300025924 Ga0207694_10075221 Ga0207694_100752212 251
178 3300025924 Ga0207694_10445614 Ga0207694_104456141 251
179 3300025932 Ga0207690_10043456 Ga0207690_100434562 251
180 3300025940 Ga0207691_10629535 Ga0207691_106295351 251
181 3300025941 Ga0207711_10000001 Ga0207711_10000001147 251
182 3300025949 Ga0207667_10109380 Ga0207667_101093803 251
183 3300025981 Ga0207640_10305468 Ga0207640_103054682 251
184 3300026041 Ga0207639_10000177 Ga0207639_1000017722 251
185 3300026067 Ga0207678_10024407 Ga0207678_100244074 251
186 3300026089 Ga0207648_10369635 Ga0207648_103696351 251
187 3300026116 Ga0207674_10069382 Ga0207674_100693823 251
188 3300026142 Ga0207698_10022737 Ga0207698_100227373 251
189 3300026142 Ga0207698_10042273 Ga0207698_100422733 251
190 3300028556 Ga0265337_1000207 Ga0265337_10002076 251
191 3300028573 Ga0265334_10004531 Ga0265334_100045315 251
192 3300028577 Ga0265318_10000457 Ga0265318_1000045713 251
193 3300028800 Ga0265338_10013228 Ga0265338_100132283 251
194 3300028800 Ga0265338_10022625 Ga0265338_100226254 251
195 3300028800 Ga0265338_10129504 Ga0265338_101295042 251
196 3300031235 Ga0265330_10015057 Ga0265330_100150572 251
197 3300031235 Ga0265330_10030119 Ga0265330_100301192 251
198 3300031235 Ga0265330_10051076 Ga0265330_100510762 251
199 3300031235 Ga0265330_10169709 Ga0265330_101697091 251
200 3300031238 Ga0265332_10010958 Ga0265332_100109582 251
201 3300031239 Ga0265328_10012906 Ga0265328_100129062 251
202 3300031241 Ga0265325_10000163 Ga0265325_1000016311 251
203 3300031247 Ga0265340_10000016 Ga0265340_1000001612 251
204 3300031247 Ga0265340_10000602 Ga0265340_1000060219 251
205 3300031247 Ga0265340_10018723 Ga0265340_100187232 251
206 3300031249 Ga0265339_10008803 Ga0265339_100088033 251
207 3300031249 Ga0265339_10019699 Ga0265339_100196994 251
208 3300031249 Ga0265339_10019722 Ga0265339_100197224 251
209 3300031250 Ga0265331_10000008 Ga0265331_10000008280 251
210 3300031250 Ga0265331_10000009 Ga0265331_10000009211 251
211 3300031251 Ga0265327_10000036 Ga0265327_10000036160 251
212 3300031251 Ga0265327_10010535 Ga0265327_100105352 251
213 3300031344 Ga0265316_10004664 Ga0265316_100046646 251
214 3300031344 Ga0265316_10036824 Ga0265316_100368242 251
215 3300031344 Ga0265316_10390425 Ga0265316_103904251 251
216 3300031595 Ga0265313_10002422 Ga0265313_100024227 251
217 3300031595 Ga0265313_10011240 Ga0265313_100112403 251
218 3300031711 Ga0265314_10003469 Ga0265314_100034694 251
219 3300031711 Ga0265314_10011714 Ga0265314_100117142 251
220 3300031711 Ga0265314_10015671 Ga0265314_100156714 251
221 3300031711 Ga0265314_10039564 Ga0265314_100395643 251
222 3300031711 Ga0265314_10042465 Ga0265314_100424653 251
223 3300031711 Ga0265314_10050456 Ga0265314_100504561 251
224 3300031711 Ga0265314_10112932 Ga0265314_101129321 251
225 3300031711 Ga0265314_10122737 Ga0265314_101227372 251
226 3300031711 Ga0265314_10127711 Ga0265314_101277112 251
227 3300031712 Ga0265342_10004736 Ga0265342_100047362 251
228 3300031712 Ga0265342_10029022 Ga0265342_100290222 251
229 3300031712 Ga0265342_10039978 Ga0265342_100399782 251
230 3300037466 Ga0395898_0084871 Ga0395898_0084871_1998_2822 251
231 3300038443 Ga0395901_0038339 Ga0395901_0038339_204_1028 251
232 3300039437 Ga0436365_1848959 Ga0436365_1848959_4405_5226 251
233 3300039438 Ga0436360_1135335 Ga0436360_1135335_207_1040 251
234 3300046473 Ga0495582_0047353 Ga0495582_0047353_1173_2003 251
235 3300046477 Ga0495664_0114585 Ga0495664_0114585_620_1456 251
236 3300046529 Ga0495652_0042039 Ga0495652_0042039_2713_3549 251
237 3300046536 Ga0495587_0021170 Ga0495587_0021170_2465_3289 251
238 3300046543 Ga0495645_0006391 Ga0495645_0006391_4326_5162 251
239 3300047315 Ga0495581_0310778 Ga0495581_0310778_74_904 251
240 3300047319 Ga0495674_0075976 Ga0495674_0075976_1080_1910 251
241 3300049460 Ga0495682_0000460 Ga0495682_0000460_1696_2532 251
242 3300049568 Ga0501031_0019057 Ga0501031_0019057_842_1666 251
243 3300049568 Ga0501031_0057675 Ga0501031_0057675_721_1542 251
244 3300049568 Ga0501031_0151063 Ga0501031_0151063_572_1393 251
245 3300049569 Ga0501032_0093205 Ga0501032_0093205_87_908 251
246 3300049569 Ga0501032_0118233 Ga0501032_0118233_436_1269 251
247 3300049570 Ga0501033_0009745 Ga0501033_0009745_1058_1942 251
248 3300049570 Ga0501033_0018496 Ga0501033_0018496_1592_2422 251
249 3300049570 Ga0501033_0068922 Ga0501033_0068922_557_1399 251
250 3300049570 Ga0501033_0069749 Ga0501033_0069749_27_881 251
251 3300049570 Ga0501033_0161650 Ga0501033_0161650_450_1271 251
252 3300049570 Ga0501033_0335060 Ga0501033_0335060_102_1001 251
253 3300049571 Ga0501034_0013758 Ga0501034_0013758_1689_2510 251
254 3300049571 Ga0501034_0018416 Ga0501034_0018416_4515_5339 251
255 3300049571 Ga0501034_0060781 Ga0501034_0060781_2517_3341 251
256 3300049572 Ga0501036_0030467 Ga0501036_0030467_1624_2448 251
257 3300049573 Ga0501037_0014319 Ga0501037_0014319_3396_4220 251
258 3300049573 Ga0501037_0056660 Ga0501037_0056660_84_905 251
259 3300049573 Ga0501037_0097571 Ga0501037_0097571_70_891 251
260 3300049574 Ga0501038_0020605 Ga0501038_0020605_4467_5291 251
261 3300049574 Ga0501038_0042275 Ga0501038_0042275_1414_2235 251
262 3300049574 Ga0501038_0186804 Ga0501038_0186804_444_1298 251
263 3300049579 Ga0501043_0015742 Ga0501043_0015742_1624_2448 251
264 3300049579 Ga0501043_0039077 Ga0501043_0039077_427_1260 251
265 3300049579 Ga0501043_0228484 Ga0501043_0228484_128_949 251
266 3300049579 Ga0501043_0335216 Ga0501043_0335216_92_913 251
267 3300049580 Ga0501046_0376371 Ga0501046_0376371_91_921 251
268 3300049581 Ga0501047_0004036 Ga0501047_0004036_6207_7043 251
269 3300049581 Ga0501047_0009122 Ga0501047_0009122_499_1383 251
270 3300049581 Ga0501047_0014230 Ga0501047_0014230_3440_4270 251
271 3300049581 Ga0501047_0015838 Ga0501047_0015838_5256_6077 251
272 3300049581 Ga0501047_0042623 Ga0501047_0042623_3099_3953 251
273 3300049581 Ga0501047_0123060 Ga0501047_0123060_305_1135 251
274 3300049581 Ga0501047_0367396 Ga0501047_0367396_104_937 251
275 3300049582 Ga0501048_0011324 Ga0501048_0011324_1304_2128 251
276 3300049583 Ga0501067_0008255 Ga0501067_0008255_3465_4289 251
277 3300049583 Ga0501067_0014363 Ga0501067_0014363_2751_3587 251
278 3300049584 Ga0501068_0137057 Ga0501068_0137057_150_974 251
279 3300049586 Ga0501070_0000017 Ga0501070_0000017_35738_36559 251
280 3300049588 Ga0501072_0008074 Ga0501072_0008074_682_1518 251
281 3300049589 Ga0501073_0041561 Ga0501073_0041561_1550_2386 251
282 3300049741 Ga0501079_0002077 Ga0501079_0002077_9782_10606 251
283 3300049742 Ga0501080_0008039 Ga0501080_0008039_4939_5769 251
284 3300049742 Ga0501080_0303469 Ga0501080_0303469_490_1326 251
285 3300049822 Ga0501035_0002699 Ga0501035_0002699_7419_8240 251
286 3300049822 Ga0501035_0006022 Ga0501035_0006022_3068_3967 251
287 3300049822 Ga0501035_0006866 Ga0501035_0006866_8195_9049 251
288 3300049822 Ga0501035_0025731 Ga0501035_0025731_3703_4587 251
289 3300049822 Ga0501035_0084642 Ga0501035_0084642_1865_2689 251
290 3300049822 Ga0501035_0183204 Ga0501035_0183204_182_1006 251
291 3300049822 Ga0501035_0273997 Ga0501035_0273997_450_1271 251
292 3300049823 Ga0501044_0002656 Ga0501044_0002656_10430_11251 251
293 3300049823 Ga0501044_0006634 Ga0501044_0006634_3592_4446 251
294 3300049823 Ga0501044_0007218 Ga0501044_0007218_9494_10315 251
295 3300049823 Ga0501044_0032668 Ga0501044_0032668_4259_5089 251
296 3300049823 Ga0501044_0034138 Ga0501044_0034138_2973_3857 251
297 3300049823 Ga0501044_0037148 Ga0501044_0037148_2014_2913 251
298 3300049823 Ga0501044_0048516 Ga0501044_0048516_1577_2401 251
299 3300049823 Ga0501044_0065987 Ga0501044_0065987_1677_2510 251
300 3300049823 Ga0501044_0227786 Ga0501044_0227786_327_1151 251
301 3300049823 Ga0501044_0343057 Ga0501044_0343057_30_851 251
302 3300050510 nmdc:mga06r32_512754_c1 nmdc:mga06r32_512754_c1_113_937 251
303 3300050511 nmdc:mga08y16_284269_c1 nmdc:mga08y16_284269_c1_228_1052 251
304 3300050511 nmdc:mga08y16_504170_c1 nmdc:mga08y16_504170_c1_23_847 251
305 3300053119 Ga0500595_015827 Ga0500595_015827_650_1474 251
306 3300053133 Ga0500655_001287 Ga0500655_001287_2856_3692 251
307 3300053136 Ga0500559_0000006 Ga0500559_0000006_112625_113458 251
308 3300053136 Ga0500559_0034721 Ga0500559_0034721_1233_2066 251
309 3300053139 Ga0500568_0085208 Ga0500568_0085208_14_835 251
310 3300053154 Ga0500619_036529 Ga0500619_036529_518_1348 251
311 3300053154 Ga0500619_090178 Ga0500619_090178_172_1005 251
312 3300053163 Ga0500639_059047 Ga0500639_059047_390_1223 251
313 3300053177 Ga0500636_0015799 Ga0500636_0015799_11_844 251
314 3300054114 Ga0501084_0033558 Ga0501084_0033558_3175_3999 251
315 3300060353 Ga0501082_0058976 Ga0501082_0058976_636_1460 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00685

Sulfotransfer_1

Sulfotransferase domain

3

236

0.76

PF13469

Sulfotransfer_3

Sulfotransferase family

5

139

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wrj-assembly1.cif.gz_B crystal structure of human tyrosylprotein sulfotransferase-1 complexed with pap and gastrin peptide 0.6879 2 245
3ap3-assembly2.cif.gz_C crystal structure of human tyrosylprotein sulfotransferase-2 complexed with pap 0.6818 1 247
3ap3-assembly2.cif.gz_C crystal structure of human tyrosylprotein sulfotransferase-2 complexed with pap 0.6696 1 247
5wrj-assembly1.cif.gz_B crystal structure of human tyrosylprotein sulfotransferase-1 complexed with pap and gastrin peptide 0.6682 2 245
3ap3-assembly1.cif.gz_B crystal structure of human tyrosylprotein sulfotransferase-2 complexed with pap 0.6551 2 247
ID Description Score Start End Superfamily
af_Q5RJS8_51_358_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7056 2 245 3.40.50.300
af_Q5RJS8_51_358_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6855 2 245 3.40.50.300
af_Q20351_1_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6827 19 249 3.40.50.300
1dekB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6424 2 106 3.40.50.300
af_P9WLG1_33_376_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6409 1 241 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A832C803-F1-model_v4 Sulfotransferase 0.9648 2 251 GO:0016740
AF-A0A7Y8M9L8-F1-model_v4 Sulfotransferase 0.9594 2 251 GO:0016740
AF-A0A832C803-F1-model_v4 Sulfotransferase 0.9574 2 251 GO:0016740
AF-A0A7Y8M9L8-F1-model_v4 Sulfotransferase 0.9519 2 251 GO:0016740
AF-A0A1F6BCN4-F1-model_v4 Sulfotransferase domain-containing protein 0.9503 2 251

Feature Viewer

pLDDT pTM Quality
91.24 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map