F403278

General Info

Members Datasets Scaffolds Average Seq Length
315 194 630 93

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_1863803|Ga0395898_1863803_48_482
Length 107
Sequence MQRSRGCAVQSVNERKLMTKNLAIWVLALSALILSSCDTPTGQGAAVQENQAARYGPPPSGGWPYGRWAGTPGFYHSPYTGRVYDLRGVPHGGLTRDVDTGRLFRKP

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
149 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
150 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
151 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
152 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.03
Rhizosphere 93.97
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_1863803 3300037466 Bacteria 522
2 JGI25405J52794_10000419 3300003911 Bacteria 5991
3 Ga0065704_10012559 3300005289 Bacteria 1589
4 Ga0065712_10026037 3300005290 Bacteria 1430
5 Ga0065715_10003151 3300005293 Bacteria 4224
6 Ga0070658_10476700 3300005327 Bacteria 1077
7 Ga0070676_10000235 3300005328 Bacteria 23742
8 Ga0070683_100041363 3300005329 Bacteria 4240
9 Ga0070683_100059371 3300005329 Bacteria 3553
10 Ga0070683_100216384 3300005329 Bacteria 1820
11 Ga0070690_100046454 3300005330 Bacteria 2760
12 Ga0068869_100862150 3300005334 Bacteria 782
13 Ga0068869_101457719 3300005334 Bacteria 607
14 Ga0070680_100160928 3300005336 Bacteria 1886
15 Ga0070682_100076406 3300005337 Bacteria 2156
16 Ga0068868_100023115 3300005338 Bacteria 4701
17 Ga0070689_100019623 3300005340 Bacteria 5000
18 Ga0070687_100000962 3300005343 Bacteria 9783
19 Ga0070661_100188174 3300005344 Bacteria 1573
20 Ga0070668_100001622 3300005347 Bacteria 16271
21 Ga0070668_100114220 3300005347 Bacteria 2152
22 Ga0070668_101072771 3300005347 Unclassified 726
23 Ga0070669_100000680 3300005353 Bacteria 24869
24 Ga0070675_100000641 3300005354 Bacteria 24149
25 Ga0070675_100013904 3300005354 Bacteria 6336
26 Ga0070671_100043502 3300005355 Bacteria 3732
27 Ga0070674_100363502 3300005356 Bacteria 1172
28 Ga0070673_100187263 3300005364 Bacteria 1775
29 Ga0070688_100099405 3300005365 Bacteria 1915
30 Ga0070688_100143721 3300005365 Bacteria 1623
31 Ga0070659_100004974 3300005366 Bacteria 9515
32 Ga0070667_100001723 3300005367 Bacteria 19547
33 Ga0070667_100365383 3300005367 Bacteria 1309
34 Ga0070709_10022909 3300005434 Bacteria 3660
35 Ga0070714_100106231 3300005435 Bacteria 2480
36 Ga0070714_100162148 3300005435 Bacteria 2023
37 Ga0070713_100192534 3300005436 Bacteria 1838
38 Ga0070713_100287940 3300005436 Bacteria 1509
39 Ga0070710_10082331 3300005437 Bacteria 1881
40 Ga0070710_10220407 3300005437 Bacteria 1207
41 Ga0070710_10307148 3300005437 Unclassified 1037
42 Ga0070711_100025196 3300005439 Bacteria 3889
43 Ga0070711_100042371 3300005439 Bacteria 3076
44 Ga0070711_102057091 3300005439 Bacteria 503
45 Ga0070705_101148651 3300005440 Unclassified 638
46 Ga0070708_100928319 3300005445 Unclassified 817
47 Ga0070708_100936037 3300005445 Unclassified 813
48 Ga0070663_100287776 3300005455 Bacteria 1311
49 Ga0070663_101211152 3300005455 Bacteria 664
50 Ga0070678_100167024 3300005456 Bacteria 1788
51 Ga0070662_100004629 3300005457 Bacteria 8718
52 Ga0070662_100207427 3300005457 Bacteria 1558
53 Ga0070662_100527202 3300005457 Bacteria 988
54 Ga0070681_10186068 3300005458 Bacteria 1997
55 Ga0068867_100085691 3300005459 Bacteria 2382
56 Ga0070685_10037978 3300005466 Bacteria 2729
57 Ga0070706_100230576 3300005467 Bacteria 1729
58 Ga0070706_100265029 3300005467 Bacteria 1603
59 Ga0070706_100580077 3300005467 Unclassified 1043
60 Ga0070707_100059201 3300005468 Bacteria 3674
61 Ga0070707_100135319 3300005468 Unclassified 2397
62 Ga0070707_100136237 3300005468 Bacteria 2389
63 Ga0070707_100926995 3300005468 Bacteria 836
64 Ga0070698_100007647 3300005471 Bacteria 11692
65 Ga0070699_100311709 3300005518 Bacteria 1413
66 Ga0070679_100308119 3300005530 Bacteria 1534
67 Ga0070684_100157794 3300005535 Bacteria 2057
68 Ga0070684_100571653 3300005535 Bacteria 1050
69 Ga0070684_100583469 3300005535 Bacteria 1039
70 Ga0070697_100008852 3300005536 Bacteria 7857
71 Ga0070697_100486047 3300005536 Bacteria 1078
72 Ga0070672_100108097 3300005543 Bacteria 2264
73 Ga0070672_100661836 3300005543 Bacteria 912
74 Ga0070686_100104790 3300005544 Bacteria 1916
75 Ga0070686_100226079 3300005544 Bacteria 1355
76 Ga0070665_100078469 3300005548 Bacteria 3308
77 Ga0070665_100103045 3300005548 Bacteria 2857
78 Ga0070665_100219063 3300005548 Bacteria 1904
79 Ga0068855_100184818 3300005563 Bacteria 2355
80 Ga0070664_100127743 3300005564 Bacteria 2231
81 Ga0070664_100275771 3300005564 Bacteria 1516
82 Ga0068856_100147317 3300005614 Bacteria 2362
83 Ga0068856_100540304 3300005614 Bacteria 1187
84 Ga0068852_100657199 3300005616 Bacteria 1056
85 Ga0068864_100715792 3300005618 Unclassified 979
86 Ga0068858_100459680 3300005842 Bacteria 1227
87 Ga0068860_100005020 3300005843 Bacteria 13468
88 Ga0068862_100011173 3300005844 Bacteria 7416
89 Ga0068862_100767607 3300005844 Bacteria 939
90 Ga0081455_10003329 3300005937 Bacteria 18535
91 Ga0081455_10008790 3300005937 Bacteria 10453
92 Ga0081455_10097657 3300005937 Bacteria 2366
93 Ga0081455_10213083 3300005937 Bacteria 1438
94 Ga0081455_10448515 3300005937 Bacteria 882
95 Ga0081455_10777792 3300005937 Unclassified 603
96 Ga0081540_1068122 3300005983 Bacteria 1659
97 Ga0070717_10007239 3300006028 Bacteria 8230
98 Ga0070717_10145120 3300006028 Bacteria 2050
99 Ga0070717_10185743 3300006028 Bacteria 1814
100 Ga0070712_100031063 3300006175 Bacteria 3595
101 Ga0070712_100160633 3300006175 Bacteria 1735
102 Ga0070712_100359041 3300006175 Bacteria 1194
103 Ga0070712_100731615 3300006175 Unclassified 845
104 Ga0097621_100142573 3300006237 Bacteria 2048
105 Ga0075433_10771956 3300006852 Bacteria 840
106 Ga0075434_101105045 3300006871 Bacteria 806
107 Ga0099795_10368011 3300007788 Bacteria 646
108 Ga0105250_10091156 3300009092 Bacteria 1240
109 Ga0105240_11117859 3300009093 Bacteria 838
110 Ga0105245_10077763 3300009098 Bacteria 3026
111 Ga0105245_10311997 3300009098 Bacteria 1547
112 Ga0114129_10850579 3300009147 Bacteria 1160
113 Ga0114129_12446943 3300009147 Bacteria 625
114 Ga0105243_10240631 3300009148 Bacteria 1610
115 Ga0105241_11210326 3300009174 Bacteria 716
116 Ga0105237_12695909 3300009545 Bacteria 508
117 Ga0105249_10001222 3300009553 Bacteria 22630
118 Ga0105249_10256178 3300009553 Bacteria 1737
119 Ga0099796_10177146 3300010159 Bacteria 854
120 Ga0105239_10002579 3300010375 Bacteria 22951
121 Ga0105239_10738043 3300010375 Bacteria 1127
122 Ga0157370_10444797 3300013104 Bacteria 1192
123 Ga0157369_10213706 3300013105 Bacteria 2021
124 Ga0157374_10010264 3300013296 Bacteria 8054
125 Ga0157374_10203626 3300013296 Bacteria 1938
126 Ga0157374_10299174 3300013296 Bacteria 1591
127 Ga0157378_10007987 3300013297 Bacteria 9239
128 Ga0157378_10170484 3300013297 Bacteria 2041
129 Ga0157378_10220207 3300013297 Bacteria 1804
130 Ga0157378_10370762 3300013297 Bacteria 1403
131 Ga0157378_10428321 3300013297 Bacteria 1309
132 Ga0163162_10427520 3300013306 Bacteria 1456
133 Ga0163162_10521714 3300013306 Bacteria 1317
134 Ga0157372_10480592 3300013307 Bacteria 1448
135 Ga0157372_10830194 3300013307 Bacteria 1073
136 Ga0157375_10178330 3300013308 Bacteria 2275
137 Ga0163163_10082661 3300014325 Bacteria 3215
138 Ga0163163_10227940 3300014325 Bacteria 1912
139 Ga0182008_10362488 3300014497 Bacteria 771
140 Ga0157377_10829675 3300014745 Bacteria 684
141 Ga0157376_10162481 3300014969 Bacteria 2026
142 Ga0157376_10194166 3300014969 Bacteria 1863
143 Ga0157376_10409590 3300014969 Bacteria 1313
144 Ga0182007_10182712 3300015262 Bacteria 726
145 Ga0182005_1213686 3300015265 Bacteria 584
146 Ga0163161_10130385 3300017792 Bacteria 1896
147 Ga0163161_10351896 3300017792 Bacteria 1171
148 Ga0207666_1000104 3300025271 Bacteria 13328
149 Ga0207666_1000884 3300025271 Bacteria 3588
150 Ga0207673_1000770 3300025290 Bacteria 3455
151 Ga0207673_1009774 3300025290 Bacteria 1228
152 Ga0207697_10000080 3300025315 Bacteria 42127
153 Ga0207697_10024824 3300025315 Bacteria 2452
154 Ga0207697_10025404 3300025315 Bacteria 2421
155 Ga0207697_10026929 3300025315 Bacteria 2351
156 Ga0207697_10065762 3300025315 Bacteria 1513
157 Ga0207692_10095751 3300025898 Bacteria 1619
158 Ga0207692_11023395 3300025898 Bacteria 546
159 Ga0207688_10276068 3300025901 Bacteria 1023
160 Ga0207680_10588419 3300025903 Bacteria 795
161 Ga0207680_10960153 3300025903 Bacteria 612
162 Ga0207685_10212137 3300025905 Bacteria 916
163 Ga0207685_10299831 3300025905 Bacteria 795
164 Ga0207699_10012199 3300025906 Bacteria 4366
165 Ga0207645_10000462 3300025907 Bacteria 33661
166 Ga0207645_10072784 3300025907 Bacteria 2200
167 Ga0207705_10228917 3300025909 Bacteria 1413
168 Ga0207684_10010255 3300025910 Bacteria 8247
169 Ga0207684_10138032 3300025910 Bacteria 2094
170 Ga0207684_10277798 3300025910 Bacteria 1445
171 Ga0207684_10921892 3300025910 Unclassified 734
172 Ga0207693_10147514 3300025915 Bacteria 1850
173 Ga0207663_10022339 3300025916 Bacteria 3615
174 Ga0207663_10834365 3300025916 Bacteria 735
175 Ga0207662_10000089 3300025918 Bacteria 43194
176 Ga0207662_11224635 3300025918 Bacteria 533
177 Ga0207657_10253501 3300025919 Bacteria 1402
178 Ga0207649_10250087 3300025920 Bacteria 1276
179 Ga0207649_11425726 3300025920 Unclassified 548
180 Ga0207646_10014890 3300025922 Bacteria 7367
181 Ga0207646_10033500 3300025922 Bacteria 4648
182 Ga0207646_10285112 3300025922 Bacteria 1493
183 Ga0207646_10998130 3300025922 Unclassified 740
184 Ga0207646_11836972 3300025922 Bacteria 517
185 Ga0207681_10001719 3300025923 Bacteria 14074
186 Ga0207659_10001448 3300025926 Bacteria 14159
187 Ga0207659_10783412 3300025926 Bacteria 819
188 Ga0207687_10049522 3300025927 Bacteria 2921
189 Ga0207700_10005040 3300025928 Bacteria 7858
190 Ga0207700_10489570 3300025928 Bacteria 1087
191 Ga0207700_10533855 3300025928 Bacteria 1040
192 Ga0207700_10956619 3300025928 Bacteria 767
193 Ga0207664_10049688 3300025929 Bacteria 3303
194 Ga0207644_10844817 3300025931 Bacteria 766
195 Ga0207690_10179346 3300025932 Bacteria 1593
196 Ga0207690_11372204 3300025932 Unclassified 591
197 Ga0207706_10000188 3300025933 Bacteria 68890
198 Ga0207706_10085153 3300025933 Bacteria 2779
199 Ga0207706_10177672 3300025933 Bacteria 1870
200 Ga0207706_10198925 3300025933 Bacteria 1758
201 Ga0207706_10890926 3300025933 Bacteria 752
202 Ga0207709_10147036 3300025935 Bacteria 1627
203 Ga0207670_10011380 3300025936 Bacteria 5162
204 Ga0207670_10112058 3300025936 Bacteria 1968
205 Ga0207669_10194352 3300025937 Bacteria 1467
206 Ga0207704_10164295 3300025938 Bacteria 1584
207 Ga0207665_10035882 3300025939 Bacteria 3294
208 Ga0207665_10330954 3300025939 Bacteria 1145
209 Ga0207691_10029335 3300025940 Bacteria 5146
210 Ga0207691_10125964 3300025940 Bacteria 2267
211 Ga0207689_10041499 3300025942 Bacteria 3807
212 Ga0207689_10877181 3300025942 Bacteria 757
213 Ga0207661_10267810 3300025944 Bacteria 1524
214 Ga0207661_10506525 3300025944 Bacteria 1103
215 Ga0207661_10610551 3300025944 Bacteria 1001
216 Ga0207679_10291440 3300025945 Bacteria 1403
217 Ga0207667_10157091 3300025949 Bacteria 2340
218 Ga0207712_10016820 3300025961 Bacteria 4742
219 Ga0207712_11617730 3300025961 Unclassified 581
220 Ga0207668_10011547 3300025972 Bacteria 5372
221 Ga0207668_11047791 3300025972 Unclassified 730
222 Ga0207658_10019462 3300025986 Bacteria 4695
223 Ga0207658_10147172 3300025986 Bacteria 1915
224 Ga0207677_10997235 3300026023 Bacteria 759
225 Ga0207703_10360124 3300026035 Bacteria 1341
226 Ga0207678_10001478 3300026067 Bacteria 21558
227 Ga0207648_10297241 3300026089 Bacteria 1447
228 Ga0207683_10031268 3300026121 Bacteria 4619
229 Ga0207683_10316436 3300026121 Bacteria 1429
230 Ga0207698_11440270 3300026142 Bacteria 704
231 Ga0268266_10495843 3300028379 Bacteria 1165
232 Ga0268266_11265113 3300028379 Bacteria 713
233 Ga0268265_10002979 3300028380 Bacteria 12384
234 Ga0268264_10041629 3300028381 Bacteria 3801
235 Ga0373948_0060918 3300034817 Bacteria 829
236 Ga0373956_0078025 3300035119 Bacteria 1517
237 Ga0373957_0137733 3300035120 Bacteria 997
238 Ga0373943_0021901 3300035170 Bacteria 2955
239 Ga0373955_0085531 3300035172 Bacteria 1790
240 Ga0373935_0007503 3300035692 Bacteria 6530
241 Ga0373935_0204284 3300035692 Bacteria 1367
242 Ga0373935_0337283 3300035692 Bacteria 1073
243 Ga0373927_0038619 3300035695 Bacteria 3100
244 Ga0373947_0020585 3300035725 Bacteria 3810
245 Ga0373947_0238086 3300035725 Bacteria 1200
246 Ga0373947_0871614 3300035725 Bacteria 615
247 Ga0373947_0959340 3300035725 Bacteria 583
248 Ga0373937_0234597 3300036401 Bacteria 1728
249 Ga0373937_0482705 3300036401 Bacteria 1177
250 Ga0373937_0661217 3300036401 Bacteria 990
251 Ga0373925_0317829 3300037068 Bacteria 1259
252 Ga0373925_0743985 3300037068 Bacteria 808
253 Ga0395900_0201444 3300037418 Bacteria 2014
254 Ga0395898_0641802 3300037466 Bacteria 1004
255 Ga0395901_0308897 3300038443 Unclassified 1638
256 Ga0451807_2298785 3300041486 Unclassified 560
257 Ga0439450_110574 3300042008 Bacteria 703
258 Ga0439455_0000810 3300042012 Bacteria 4747
259 Ga0439458_0011573 3300042157 Bacteria 1975
260 Ga0439460_0262849 3300042461 Bacteria 598
261 Ga0466964_0041722 3300044706 Bacteria 1857
262 Ga0451576_0037761 3300045051 Bacteria 5115
263 Ga0466967_0058296 3300045976 Bacteria 3413
264 Ga0495592_0058535 3300046454 Bacteria 2841
265 Ga0495629_0049111 3300046459 Bacteria 2958
266 Ga0495641_0050346 3300046461 Bacteria 1904
267 Ga0495641_0529091 3300046461 Bacteria 538
268 Ga0495585_0118842 3300046492 Bacteria 1400
269 Ga0495618_0120285 3300046514 Bacteria 1682
270 Ga0495630_0034283 3300046517 Bacteria 3790
271 Ga0495644_0142799 3300046523 Bacteria 915
272 Ga0495642_0496980 3300046528 Bacteria 540
273 Ga0495652_0274109 3300046529 Bacteria 1238
274 Ga0495586_0138228 3300046535 Bacteria 1366
275 Ga0495645_0014031 3300046543 Bacteria 5677
276 Ga0495667_0392890 3300046559 Bacteria 874
277 Ga0495634_0023054 3300046642 Bacteria 4381
278 Ga0495634_0151266 3300046642 Bacteria 1468
279 Ga0495635_0058502 3300046663 Bacteria 2652
280 Ga0495599_0001566 3300046678 Bacteria 13177
281 Ga0495646_0040440 3300046680 Bacteria 2871
282 Ga0495658_0097334 3300046683 Bacteria 1751
283 Ga0495669_0028662 3300046684 Bacteria 2439
284 Ga0495624_0125366 3300046690 Bacteria 1576
285 Ga0495604_0233677 3300047317 Bacteria 1260
286 Ga0495674_0114973 3300047319 Bacteria 2278
287 Ga0495674_1424797 3300047319 Unclassified 515
288 Ga0495680_0540493 3300047322 Bacteria 786
289 Ga0495684_0100288 3300047471 Bacteria 2189
290 Ga0495614_0228375 3300048089 Bacteria 848
291 Ga0496101_0063884 3300048904 Bacteria 2681
292 Ga0496102_0459974 3300048905 Bacteria 1193
293 Ga0496102_0550354 3300048905 Bacteria 1077
294 Ga0496102_1207798 3300048905 Unclassified 676
295 Ga0496104_0833047 3300048907 Bacteria 828
296 Ga0496107_0592888 3300048910 Bacteria 819
297 Ga0496108_0174613 3300048911 Bacteria 1860
298 Ga0496108_0758662 3300048911 Bacteria 839
299 Ga0496109_0158372 3300048912 Bacteria 2121
300 Ga0496109_0279048 3300048912 Bacteria 1575
301 Ga0496109_0807809 3300048912 Bacteria 876
302 Ga0496110_0684438 3300048913 Bacteria 926
303 Ga0496110_1426531 3300048913 Unclassified 602
304 Ga0496112_0201635 3300048915 Bacteria 1949
305 Ga0496112_1263132 3300048915 Bacteria 654
306 Ga0496115_0019789 3300048918 Bacteria 5184
307 Ga0496115_0124430 3300048918 Bacteria 2123
308 Ga0496115_0231357 3300048918 Bacteria 1524
309 nmdc:mga0n895_401831_c1 3300050512 Bacteria 1385
310 nmdc:mga0rr50_1138324_c1 3300050513 Bacteria 663
311 nmdc:mga0a205_1514798_c1 3300050515 Bacteria 519
312 Ga0495601_0041139 3300053077 Bacteria 2897
313 Ga0495595_0092373 3300053084 Bacteria 1453
314 Ga0495595_0273272 3300053084 Bacteria 848
315 Ga0495619_0461148 3300053085 Bacteria 875
316 Ga0395898_1863803
317 JGI25405J52794_10000419
318 Ga0065704_10012559
319 Ga0065712_10026037
320 Ga0065715_10003151
321 Ga0070658_10476700
322 Ga0070676_10000235
323 Ga0070683_100041363
324 Ga0070683_100059371
325 Ga0070683_100216384
326 Ga0070690_100046454
327 Ga0068869_100862150
328 Ga0068869_101457719
329 Ga0070680_100160928
330 Ga0070682_100076406
331 Ga0068868_100023115
332 Ga0070689_100019623
333 Ga0070687_100000962
334 Ga0070661_100188174
335 Ga0070668_100001622
336 Ga0070668_100114220
337 Ga0070668_101072771
338 Ga0070669_100000680
339 Ga0070675_100000641
340 Ga0070675_100013904
341 Ga0070671_100043502
342 Ga0070674_100363502
343 Ga0070673_100187263
344 Ga0070688_100099405
345 Ga0070688_100143721
346 Ga0070659_100004974
347 Ga0070667_100001723
348 Ga0070667_100365383
349 Ga0070709_10022909
350 Ga0070714_100106231
351 Ga0070714_100162148
352 Ga0070713_100192534
353 Ga0070713_100287940
354 Ga0070710_10082331
355 Ga0070710_10220407
356 Ga0070710_10307148
357 Ga0070711_100025196
358 Ga0070711_100042371
359 Ga0070711_102057091
360 Ga0070705_101148651
361 Ga0070708_100928319
362 Ga0070708_100936037
363 Ga0070663_100287776
364 Ga0070663_101211152
365 Ga0070678_100167024
366 Ga0070662_100004629
367 Ga0070662_100207427
368 Ga0070662_100527202
369 Ga0070681_10186068
370 Ga0068867_100085691
371 Ga0070685_10037978
372 Ga0070706_100230576
373 Ga0070706_100265029
374 Ga0070706_100580077
375 Ga0070707_100059201
376 Ga0070707_100135319
377 Ga0070707_100136237
378 Ga0070707_100926995
379 Ga0070698_100007647
380 Ga0070699_100311709
381 Ga0070679_100308119
382 Ga0070684_100157794
383 Ga0070684_100571653
384 Ga0070684_100583469
385 Ga0070697_100008852
386 Ga0070697_100486047
387 Ga0070672_100108097
388 Ga0070672_100661836
389 Ga0070686_100104790
390 Ga0070686_100226079
391 Ga0070665_100078469
392 Ga0070665_100103045
393 Ga0070665_100219063
394 Ga0068855_100184818
395 Ga0070664_100127743
396 Ga0070664_100275771
397 Ga0068856_100147317
398 Ga0068856_100540304
399 Ga0068852_100657199
400 Ga0068864_100715792
401 Ga0068858_100459680
402 Ga0068860_100005020
403 Ga0068862_100011173
404 Ga0068862_100767607
405 Ga0081455_10003329
406 Ga0081455_10008790
407 Ga0081455_10097657
408 Ga0081455_10213083
409 Ga0081455_10448515
410 Ga0081455_10777792
411 Ga0081540_1068122
412 Ga0070717_10007239
413 Ga0070717_10145120
414 Ga0070717_10185743
415 Ga0070712_100031063
416 Ga0070712_100160633
417 Ga0070712_100359041
418 Ga0070712_100731615
419 Ga0097621_100142573
420 Ga0075433_10771956
421 Ga0075434_101105045
422 Ga0099795_10368011
423 Ga0105250_10091156
424 Ga0105240_11117859
425 Ga0105245_10077763
426 Ga0105245_10311997
427 Ga0114129_10850579
428 Ga0114129_12446943
429 Ga0105243_10240631
430 Ga0105241_11210326
431 Ga0105237_12695909
432 Ga0105249_10001222
433 Ga0105249_10256178
434 Ga0099796_10177146
435 Ga0105239_10002579
436 Ga0105239_10738043
437 Ga0157370_10444797
438 Ga0157369_10213706
439 Ga0157374_10010264
440 Ga0157374_10203626
441 Ga0157374_10299174
442 Ga0157378_10007987
443 Ga0157378_10170484
444 Ga0157378_10220207
445 Ga0157378_10370762
446 Ga0157378_10428321
447 Ga0163162_10427520
448 Ga0163162_10521714
449 Ga0157372_10480592
450 Ga0157372_10830194
451 Ga0157375_10178330
452 Ga0163163_10082661
453 Ga0163163_10227940
454 Ga0182008_10362488
455 Ga0157377_10829675
456 Ga0157376_10162481
457 Ga0157376_10194166
458 Ga0157376_10409590
459 Ga0182007_10182712
460 Ga0182005_1213686
461 Ga0163161_10130385
462 Ga0163161_10351896
463 Ga0207666_1000104
464 Ga0207666_1000884
465 Ga0207673_1000770
466 Ga0207673_1009774
467 Ga0207697_10000080
468 Ga0207697_10024824
469 Ga0207697_10025404
470 Ga0207697_10026929
471 Ga0207697_10065762
472 Ga0207692_10095751
473 Ga0207692_11023395
474 Ga0207688_10276068
475 Ga0207680_10588419
476 Ga0207680_10960153
477 Ga0207685_10212137
478 Ga0207685_10299831
479 Ga0207699_10012199
480 Ga0207645_10000462
481 Ga0207645_10072784
482 Ga0207705_10228917
483 Ga0207684_10010255
484 Ga0207684_10138032
485 Ga0207684_10277798
486 Ga0207684_10921892
487 Ga0207693_10147514
488 Ga0207663_10022339
489 Ga0207663_10834365
490 Ga0207662_10000089
491 Ga0207662_11224635
492 Ga0207657_10253501
493 Ga0207649_10250087
494 Ga0207649_11425726
495 Ga0207646_10014890
496 Ga0207646_10033500
497 Ga0207646_10285112
498 Ga0207646_10998130
499 Ga0207646_11836972
500 Ga0207681_10001719
501 Ga0207659_10001448
502 Ga0207659_10783412
503 Ga0207687_10049522
504 Ga0207700_10005040
505 Ga0207700_10489570
506 Ga0207700_10533855
507 Ga0207700_10956619
508 Ga0207664_10049688
509 Ga0207644_10844817
510 Ga0207690_10179346
511 Ga0207690_11372204
512 Ga0207706_10000188
513 Ga0207706_10085153
514 Ga0207706_10177672
515 Ga0207706_10198925
516 Ga0207706_10890926
517 Ga0207709_10147036
518 Ga0207670_10011380
519 Ga0207670_10112058
520 Ga0207669_10194352
521 Ga0207704_10164295
522 Ga0207665_10035882
523 Ga0207665_10330954
524 Ga0207691_10029335
525 Ga0207691_10125964
526 Ga0207689_10041499
527 Ga0207689_10877181
528 Ga0207661_10267810
529 Ga0207661_10506525
530 Ga0207661_10610551
531 Ga0207679_10291440
532 Ga0207667_10157091
533 Ga0207712_10016820
534 Ga0207712_11617730
535 Ga0207668_10011547
536 Ga0207668_11047791
537 Ga0207658_10019462
538 Ga0207658_10147172
539 Ga0207677_10997235
540 Ga0207703_10360124
541 Ga0207678_10001478
542 Ga0207648_10297241
543 Ga0207683_10031268
544 Ga0207683_10316436
545 Ga0207698_11440270
546 Ga0268266_10495843
547 Ga0268266_11265113
548 Ga0268265_10002979
549 Ga0268264_10041629
550 Ga0373948_0060918
551 Ga0373956_0078025
552 Ga0373957_0137733
553 Ga0373943_0021901
554 Ga0373955_0085531
555 Ga0373935_0007503
556 Ga0373935_0204284
557 Ga0373935_0337283
558 Ga0373927_0038619
559 Ga0373947_0020585
560 Ga0373947_0238086
561 Ga0373947_0871614
562 Ga0373947_0959340
563 Ga0373937_0234597
564 Ga0373937_0482705
565 Ga0373937_0661217
566 Ga0373925_0317829
567 Ga0373925_0743985
568 Ga0395900_0201444
569 Ga0395898_0641802
570 Ga0395901_0308897
571 Ga0451807_2298785
572 Ga0439450_110574
573 Ga0439455_0000810
574 Ga0439458_0011573
575 Ga0439460_0262849
576 Ga0466964_0041722
577 Ga0451576_0037761
578 Ga0466967_0058296
579 Ga0495592_0058535
580 Ga0495629_0049111
581 Ga0495641_0050346
582 Ga0495641_0529091
583 Ga0495585_0118842
584 Ga0495618_0120285
585 Ga0495630_0034283
586 Ga0495644_0142799
587 Ga0495642_0496980
588 Ga0495652_0274109
589 Ga0495586_0138228
590 Ga0495645_0014031
591 Ga0495667_0392890
592 Ga0495634_0023054
593 Ga0495634_0151266
594 Ga0495635_0058502
595 Ga0495599_0001566
596 Ga0495646_0040440
597 Ga0495658_0097334
598 Ga0495669_0028662
599 Ga0495624_0125366
600 Ga0495604_0233677
601 Ga0495674_0114973
602 Ga0495674_1424797
603 Ga0495680_0540493
604 Ga0495684_0100288
605 Ga0495614_0228375
606 Ga0496101_0063884
607 Ga0496102_0459974
608 Ga0496102_0550354
609 Ga0496102_1207798
610 Ga0496104_0833047
611 Ga0496107_0592888
612 Ga0496108_0174613
613 Ga0496108_0758662
614 Ga0496109_0158372
615 Ga0496109_0279048
616 Ga0496109_0807809
617 Ga0496110_0684438
618 Ga0496110_1426531
619 Ga0496112_0201635
620 Ga0496112_1263132
621 Ga0496115_0019789
622 Ga0496115_0124430
623 Ga0496115_0231357
624 nmdc:mga0n895_401831_c1
625 nmdc:mga0rr50_1138324_c1
626 nmdc:mga0a205_1514798_c1
627 Ga0495601_0041139
628 Ga0495595_0092373
629 Ga0495595_0273272
630 Ga0495619_0461148

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5eio-assembly1.cif.gz_C-2 crystal structure of lysy from thermus thermophilus complexed with nadp+ and lysw-gamma-aminoadipic semialdehyde 0.7861 57 88
5ein-assembly1.cif.gz_C crystal structure of c148a mutant of lysy from thermus thermophilus in complex with nadp+ and lysw-gamma-aminoadipic acid 0.7827 57 88
3wwn-assembly1.cif.gz_B-2 crystal structure of lysz from thermus thermophilus complex with lysw 0.7785 57 88
7qce-assembly1.cif.gz_A crystal structure of an atypical phd finger of vin3 0.6284 50 71
6hls-assembly1.cif.gz_I yeast apo rna polymerase i* 0.5883 56 88
ID Description Score Start End Superfamily
af_P10080_177_283_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.7967 74 88 3.30.70.330
5eioC00 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.7861 57 88 2.20.28.160
5einC00 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.7827 57 88 2.20.28.160
3wwnB00 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.7785 57 88 2.20.28.160
af_B8A106_254_510_1.20.120.1750 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7088 51 88 1.20.120.1750
ID Description Score Start End GO Terms
AF-A0A2V6K6B0-F1-model_v4 Glycine zipper domain-containing protein 0.9747 31 90
AF-A0A6G6KDV5-F1-model_v4 Secreted protein 0.9303 46 90
AF-A0A366HBQ7-F1-model_v4 Uncharacterized protein 0.9229 46 90
AF-A0A512MFB8-F1-model_v4 Uncharacterized protein 0.9187 46 90
AF-A0A5R8KGA4-F1-model_v4 Uncharacterized protein 0.9165 46 90 GO:0016020

Map