F403217

General Info

Members Datasets Scaffolds Average Seq Length
315 194 314 121

Family's Representative Sequence

Representative Sequence 3300025981|Ga0207640_10316006|Ga0207640_103160063
Length 142
Sequence LASADSVPLDNPPDKVALAATVLNNLGGFGTQRHIFLCCDQTKPKCCTTRRGLAGWDYLKNRLRELGLSEQGGVQRTKANCLRVCEAGPIAVVWPDNVWYHSCDPPVLERIILEHLRDGVPVEDYRLNSPGSPSRARPRADR

Samples

Sample ID Description Type Environment
1 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
117 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
120 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
121 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
122 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
123 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
124 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
125 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
126 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
127 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
128 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
129 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
135 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
136 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
137 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 2.54
Rhizosphere 95.56
Stem 0
Stem Tuber 0
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10008377 3300005328 Bacteria 5570
2 Ga0070676_11220812 3300005328 Bacteria 572
3 Ga0070670_100004141 3300005331 Bacteria 12122
4 Ga0070677_10060218 3300005333 Bacteria 1564
5 Ga0070677_10423330 3300005333 Bacteria 707
6 Ga0068869_100022305 3300005334 Bacteria 4361
7 Ga0068869_100043445 3300005334 Bacteria 3228
8 Ga0068869_100161984 3300005334 Bacteria 1742
9 Ga0070666_10219665 3300005335 Bacteria 1340
10 Ga0070666_11398224 3300005335 Bacteria 523
11 Ga0068868_100219293 3300005338 Bacteria 1592
12 Ga0068868_100437536 3300005338 Bacteria 1135
13 Ga0070689_100409901 3300005340 Bacteria 1147
14 Ga0070687_100155763 3300005343 Bacteria 1346
15 Ga0070661_100476828 3300005344 Bacteria 996
16 Ga0070661_101060619 3300005344 Bacteria 674
17 Ga0070669_100431335 3300005353 Bacteria 1083
18 Ga0070675_100001994 3300005354 Bacteria 15146
19 Ga0070675_100108584 3300005354 Bacteria 2343
20 Ga0070675_100621504 3300005354 Bacteria 981
21 Ga0070675_100728996 3300005354 Bacteria 904
22 Ga0070671_100018769 3300005355 Bacteria 5620
23 Ga0070674_100089513 3300005356 Bacteria 2218
24 Ga0070674_100324898 3300005356 Bacteria 1235
25 Ga0070673_100013186 3300005364 Bacteria 5706
26 Ga0070673_100107543 3300005364 Bacteria 2307
27 Ga0070673_101299297 3300005364 Unclassified 683
28 Ga0070688_100028387 3300005365 Bacteria 3340
29 Ga0070705_100738117 3300005440 Bacteria 777
30 Ga0070700_100002609 3300005441 Bacteria 9211
31 Ga0070700_100111304 3300005441 Bacteria 1821
32 Ga0070700_101657680 3300005441 Bacteria 548
33 Ga0070678_100075523 3300005456 Bacteria 2535
34 Ga0070681_11112631 3300005458 Unclassified 711
35 Ga0068867_100000456 3300005459 Bacteria 27121
36 Ga0068867_100498412 3300005459 Bacteria 1046
37 Ga0068867_100700124 3300005459 Bacteria 894
38 Ga0070685_11041481 3300005466 Unclassified 616
39 Ga0070686_100756042 3300005544 Bacteria 780
40 Ga0070696_100442657 3300005546 Bacteria 1024
41 Ga0070696_101104535 3300005546 Bacteria 667
42 Ga0070704_100452353 3300005549 Bacteria 1106
43 Ga0070664_100299917 3300005564 Bacteria 1452
44 Ga0070664_100642626 3300005564 Bacteria 986
45 Ga0068854_100006245 3300005578 Bacteria 7567
46 Ga0070702_100205837 3300005615 Bacteria 1306
47 Ga0068852_100609255 3300005616 Bacteria 1097
48 Ga0068852_100715649 3300005616 Bacteria 1012
49 Ga0068859_102743521 3300005617 Bacteria 541
50 Ga0068864_100451202 3300005618 Bacteria 1230
51 Ga0068864_101022756 3300005618 Bacteria 820
52 Ga0068866_10018483 3300005718 Bacteria 3153
53 Ga0068866_10033873 3300005718 Bacteria 2483
54 Ga0068861_100100016 3300005719 Bacteria 2304
55 Ga0068861_100159029 3300005719 Bacteria 1862
56 Ga0068861_101386623 3300005719 Bacteria 686
57 Ga0068861_101852974 3300005719 Bacteria 599
58 Ga0068851_10027302 3300005834 Bacteria 2813
59 Ga0068870_10364694 3300005840 Bacteria 931
60 Ga0068870_10493724 3300005840 Bacteria 815
61 Ga0068870_10670093 3300005840 Bacteria 713
62 Ga0068863_101096430 3300005841 Bacteria 801
63 Ga0068858_100542288 3300005842 Bacteria 1126
64 Ga0068858_102039019 3300005842 Bacteria 567
65 Ga0068860_100274031 3300005843 Bacteria 1647
66 Ga0068862_101223587 3300005844 Bacteria 750
67 Ga0081539_10143676 3300005985 Bacteria 1156
68 Ga0075432_10303132 3300006058 Bacteria 664
69 Ga0097621_100232331 3300006237 Bacteria 1610
70 Ga0097621_101599250 3300006237 Bacteria 620
71 Ga0068871_100028855 3300006358 Bacteria 4354
72 Ga0075431_100014651 3300006847 Bacteria 7933
73 Ga0075433_10005477 3300006852 Bacteria 9971
74 Ga0075433_10128596 3300006852 Bacteria 2250
75 Ga0075434_100000111 3300006871 Bacteria 46866
76 Ga0075434_100052052 3300006871 Bacteria 4068
77 Ga0075434_100065708 3300006871 Bacteria 3613
78 Ga0075434_102166387 3300006871 Bacteria 560
79 Ga0075429_100990651 3300006880 Bacteria 735
80 Ga0068865_100005360 3300006881 Bacteria 7767
81 Ga0068865_100054384 3300006881 Bacteria 2781
82 Ga0097620_102744718 3300006931 Bacteria 541
83 Ga0075435_100021136 3300007076 Bacteria 5000
84 Ga0075435_100115632 3300007076 Bacteria 2234
85 Ga0099795_10040465 3300007788 Bacteria 1655
86 Ga0111539_10005517 3300009094 Bacteria 16366
87 Ga0111539_10007638 3300009094 Bacteria 13818
88 Ga0111539_10171380 3300009094 Bacteria 2536
89 Ga0111539_10207172 3300009094 Bacteria 2285
90 Ga0105245_10541644 3300009098 Bacteria 1185
91 Ga0114129_10009269 3300009147 Bacteria 14036
92 Ga0114129_10059640 3300009147 Bacteria 5334
93 Ga0114129_10471428 3300009147 Bacteria 1644
94 Ga0114129_10598679 3300009147 Bacteria 1428
95 Ga0105243_10077914 3300009148 Bacteria 2697
96 Ga0105243_10878435 3300009148 Bacteria 890
97 Ga0105241_11346217 3300009174 Bacteria 682
98 Ga0105242_10001709 3300009176 Bacteria 17356
99 Ga0105242_10009038 3300009176 Bacteria 7657
100 Ga0105248_10021387 3300009177 Bacteria 7168
101 Ga0105248_10178533 3300009177 Bacteria 2393
102 Ga0105248_10318929 3300009177 Bacteria 1750
103 Ga0105248_11353148 3300009177 Unclassified 805
104 Ga0105248_11423401 3300009177 Bacteria 784
105 Ga0105248_11486278 3300009177 Unclassified 767
106 Ga0105237_11665956 3300009545 Unclassified 645
107 Ga0105238_10008566 3300009551 Bacteria 10232
108 Ga0105249_10756261 3300009553 Unclassified 1034
109 Ga0105249_11289584 3300009553 Bacteria 802
110 Ga0099796_10217396 3300010159 Bacteria 782
111 Ga0105246_11017395 3300011119 Bacteria 751
112 Ga0157378_10386098 3300013297 Bacteria 1376
113 Ga0157378_10541280 3300013297 Bacteria 1168
114 Ga0157375_10785718 3300013308 Unclassified 1101
115 Ga0163163_10021891 3300014325 Bacteria 6042
116 Ga0157380_10009513 3300014326 Bacteria 6969
117 Ga0157380_10173437 3300014326 Bacteria 1887
118 Ga0157380_10203043 3300014326 Bacteria 1760
119 Ga0157380_10383038 3300014326 Bacteria 1328
120 Ga0157377_10295590 3300014745 Bacteria 1067
121 Ga0157377_10492724 3300014745 Bacteria 855
122 Ga0157376_10151427 3300014969 Bacteria 2092
123 Ga0157376_10205766 3300014969 Bacteria 1814
124 Ga0207656_10064145 3300025321 Unclassified 1618
125 Ga0207682_10103534 3300025893 Bacteria 1247
126 Ga0207642_10117920 3300025899 Bacteria 1364
127 Ga0207642_10142506 3300025899 Bacteria 1265
128 Ga0207642_10667906 3300025899 Bacteria 652
129 Ga0207710_10047175 3300025900 Bacteria 1925
130 Ga0207680_10454081 3300025903 Bacteria 910
131 Ga0207680_10514688 3300025903 Bacteria 853
132 Ga0207680_10541873 3300025903 Bacteria 830
133 Ga0207680_10712591 3300025903 Unclassified 719
134 Ga0207645_10022014 3300025907 Bacteria 4151
135 Ga0207645_10525287 3300025907 Bacteria 802
136 Ga0207643_10010780 3300025908 Bacteria 4928
137 Ga0207643_10033240 3300025908 Bacteria 2885
138 Ga0207695_10354709 3300025913 Bacteria 1353
139 Ga0207662_10176630 3300025918 Bacteria 1372
140 Ga0207662_10222526 3300025918 Bacteria 1230
141 Ga0207649_11205323 3300025920 Bacteria 598
142 Ga0207681_10006840 3300025923 Bacteria 6995
143 Ga0207681_10031852 3300025923 Bacteria 3447
144 Ga0207694_10014775 3300025924 Bacteria 5887
145 Ga0207694_10163152 3300025924 Bacteria 1801
146 Ga0207650_10008496 3300025925 Bacteria 7010
147 Ga0207659_10017594 3300025926 Bacteria 4671
148 Ga0207659_10037910 3300025926 Bacteria 3350
149 Ga0207659_10453838 3300025926 Bacteria 1080
150 Ga0207690_10434730 3300025932 Bacteria 1052
151 Ga0207706_10204344 3300025933 Bacteria 1732
152 Ga0207686_10006011 3300025934 Bacteria 6515
153 Ga0207686_10124584 3300025934 Bacteria 1759
154 Ga0207686_10412909 3300025934 Bacteria 1031
155 Ga0207709_10039919 3300025935 Bacteria 2807
156 Ga0207670_10258977 3300025936 Bacteria 1348
157 Ga0207669_10050682 3300025937 Bacteria 2483
158 Ga0207669_10991228 3300025937 Bacteria 706
159 Ga0207704_10001077 3300025938 Bacteria 12125
160 Ga0207704_10246879 3300025938 Bacteria 1337
161 Ga0207691_10024349 3300025940 Bacteria 5694
162 Ga0207691_11576606 3300025940 Bacteria 535
163 Ga0207711_10008147 3300025941 Bacteria 8769
164 Ga0207711_10107824 3300025941 Bacteria 2473
165 Ga0207711_10358549 3300025941 Bacteria 1350
166 Ga0207711_10589762 3300025941 Bacteria 1037
167 Ga0207689_10000796 3300025942 Bacteria 30368
168 Ga0207689_10066242 3300025942 Bacteria 2970
169 Ga0207679_10382584 3300025945 Bacteria 1234
170 Ga0207679_12155703 3300025945 Bacteria 506
171 Ga0207667_10463147 3300025949 Bacteria 1287
172 Ga0207651_10007612 3300025960 Bacteria 5781
173 Ga0207651_10016934 3300025960 Bacteria 4289
174 Ga0207712_10164147 3300025961 Bacteria 1729
175 Ga0207640_10007509 3300025981 Bacteria 6021
176 Ga0207640_10136937 3300025981 Bacteria 1779
177 Ga0207640_10197613 3300025981 Bacteria 1521
178 Ga0207640_10316006 3300025981 Bacteria 1241
179 Ga0207640_10518979 3300025981 Bacteria 995
180 Ga0207677_10478128 3300026023 Bacteria 1073
181 Ga0207677_11058804 3300026023 Bacteria 738
182 Ga0207703_10049883 3300026035 Bacteria 3385
183 Ga0207703_10388849 3300026035 Bacteria 1292
184 Ga0207703_10412407 3300026035 Bacteria 1255
185 Ga0207678_10524456 3300026067 Unclassified 1034
186 Ga0207708_10007174 3300026075 Bacteria 8237
187 Ga0207708_10294022 3300026075 Bacteria 1319
188 Ga0207708_11599999 3300026075 Unclassified 572
189 Ga0207641_10817914 3300026088 Bacteria 922
190 Ga0207648_10000077 3300026089 Bacteria 93009
191 Ga0207648_10421942 3300026089 Bacteria 1211
192 Ga0207676_10354338 3300026095 Bacteria 1358
193 Ga0207676_10415435 3300026095 Bacteria 1260
194 Ga0207674_10734240 3300026116 Bacteria 953
195 Ga0207675_100081783 3300026118 Bacteria 3029
196 Ga0207675_100120986 3300026118 Bacteria 2477
197 Ga0207675_100127871 3300026118 Bacteria 2408
198 Ga0207675_100446513 3300026118 Bacteria 1281
199 Ga0207675_101764016 3300026118 Bacteria 638
200 Ga0207683_10050276 3300026121 Bacteria 3651
201 Ga0207683_10224547 3300026121 Bacteria 1712
202 Ga0207698_10832890 3300026142 Bacteria 927
203 Ga0209969_1066445 3300027360 Bacteria 571
204 Ga0209968_1055625 3300027526 Unclassified 692
205 Ga0207428_10001495 3300027907 Bacteria 24437
206 Ga0207428_10001962 3300027907 Bacteria 20882
207 Ga0207428_10394634 3300027907 Unclassified 1014
208 Ga0207428_10553107 3300027907 Bacteria 832
209 Ga0268265_10155591 3300028380 Bacteria 1934
210 Ga0268264_10138542 3300028381 Bacteria 2167
211 Ga0268264_10155989 3300028381 Bacteria 2052
212 Ga0265339_10255332 3300031249 Unclassified 847
213 Ga0316576_10098058 3300031727 Bacteria 2188
214 Ga0316576_10810978 3300031727 Bacteria 673
215 Ga0316576_10931084 3300031727 Bacteria 621
216 Ga0316578_10096020 3300031728 Bacteria 1774
217 Ga0307409_101118903 3300031995 Bacteria 809
218 Ga0373948_0000326 3300034817 Bacteria 5783
219 Ga0373959_0001480 3300034820 Bacteria 3751
220 Ga0373938_0000842 3300034957 Bacteria 4949
221 Ga0373928_0001434 3300035084 Bacteria 4626
222 Ga0373929_0001509 3300035085 Bacteria 4424
223 Ga0373940_0000163 3300035088 Bacteria 8840
224 Ga0373944_0283474 3300035089 Bacteria 618
225 Ga0373949_0002817 3300035090 Bacteria 4322
226 Ga0373951_0002196 3300035091 Bacteria 4964
227 Ga0373952_0000063 3300035092 Bacteria 13330
228 Ga0373932_0006409 3300035112 Bacteria 2782
229 Ga0373939_0002345 3300035114 Bacteria 4478
230 Ga0373941_0000667 3300035115 Bacteria 6940
231 Ga0373960_0001427 3300035121 Bacteria 5284
232 Ga0373946_0418495 3300035171 Bacteria 679
233 Ga0373942_0001136 3300035207 Bacteria 7065
234 Ga0373961_0006444 3300035241 Bacteria 2818
235 Ga0373962_0004599 3300035242 Bacteria 3334
236 Ga0316574_0398391 3300035398 Bacteria 867
237 Ga0373931_0016193 3300035691 Bacteria 3666
238 Ga0373947_0590685 3300035725 Bacteria 757
239 Ga0316584_0024523 3300036712 Bacteria 4415
240 Ga0373925_0326437 3300037068 Bacteria 1243
241 Ga0395900_0200268 3300037418 Bacteria 2021
242 Ga0395905_0131694 3300037471 Bacteria 2352
243 Ga0439436_0141315 3300041404 Bacteria 677
244 Ga0451853_1510120 3300041512 Bacteria 2711
245 Ga0439435_0161820 3300042436 Bacteria 723
246 Ga0466960_0611683 3300044901 Unclassified 648
247 Ga0451576_0012707 3300045051 Bacteria 9452
248 Ga0451576_1315855 3300045051 Bacteria 753
249 Ga0451576_1870463 3300045051 Bacteria 620
250 Ga0466967_0713225 3300045976 Bacteria 994
251 Ga0495629_0179420 3300046459 Bacteria 1468
252 Ga0495582_0313676 3300046473 Bacteria 902
253 Ga0495594_0327569 3300046499 Bacteria 872
254 Ga0495586_0241432 3300046535 Unclassified 1030
255 Ga0495634_0288119 3300046642 Bacteria 996
256 Ga0495635_0419802 3300046663 Bacteria 887
257 Ga0495659_0362169 3300046664 Bacteria 621
258 Ga0495659_0524034 3300046664 Unclassified 521
259 Ga0495647_0021569 3300046681 Bacteria 2320
260 Ga0495647_0431043 3300046681 Bacteria 608
261 Ga0495647_0431793 3300046681 Unclassified 608
262 Ga0495658_0035208 3300046683 Bacteria 2753
263 Ga0495671_0458953 3300046692 Bacteria 609
264 Ga0495674_0356885 3300047319 Bacteria 1186
265 Ga0495684_0482823 3300047471 Bacteria 855
266 Ga0496101_1335377 3300048904 Bacteria 560
267 Ga0496104_0049740 3300048907 Bacteria 3953
268 Ga0496107_0096408 3300048910 Bacteria 2165
269 Ga0496108_0021323 3300048911 Bacteria 5325
270 Ga0496109_0075692 3300048912 Bacteria 3095
271 Ga0496111_0899453 3300048914 Bacteria 637
272 Ga0496112_0019555 3300048915 Bacteria 6394
273 Ga0496113_0340728 3300048916 Bacteria 1202
274 Ga0496116_0000008 3300048919 Bacteria 726753
275 Ga0496121_0000012 3300048924 Bacteria 653131
276 Ga0496126_0366918 3300048929 Bacteria 1175
277 Ga0501031_0301993 3300049568 Bacteria 1037
278 Ga0501036_0103730 3300049572 Bacteria 2405
279 Ga0501040_0106898 3300049576 Bacteria 1955
280 Ga0501041_0168398 3300049577 Bacteria 1370
281 Ga0501068_0852716 3300049584 Bacteria 598
282 Ga0501072_0139290 3300049588 Bacteria 1934
283 Ga0501076_0394031 3300049592 Bacteria 1138
284 Ga0501079_0376093 3300049741 Bacteria 1114
285 Ga0501080_0269138 3300049742 Bacteria 1551
286 Ga0501081_0017289 3300049743 Bacteria 4771
287 nmdc:mga0yw44_51176_c1 3300050492 Bacteria 2500
288 nmdc:mga05p37_1351935_c1 3300050507 Bacteria 722
289 nmdc:mga05p37_183607_c1 3300050507 Bacteria 2544
290 nmdc:mga05p37_325846_c1 3300050507 Bacteria 1816
291 nmdc:mga05p37_334900_c1 3300050507 Bacteria 1786
292 nmdc:mga05p37_4371_c1 3300050507 Bacteria 16503
293 nmdc:mga05p37_552838_c1 3300050507 Bacteria 1310
294 nmdc:mga05p37_84957_c1 3300050507 Bacteria 3899
295 nmdc:mga09592_11223_c1 3300050508 Bacteria 7290
296 nmdc:mga0qj67_1195667_c1 3300050509 Unclassified 592
297 nmdc:mga0qj67_31455_c1 3300050509 Bacteria 4133
298 nmdc:mga06r32_16884_c1 3300050510 Bacteria 6659
299 nmdc:mga06r32_199164_c1 3300050510 Bacteria 1991
300 nmdc:mga08y16_3332_c1 3300050511 Bacteria 16637
301 nmdc:mga08y16_74686_c1 3300050511 Bacteria 3533
302 nmdc:mga08y16_7530_c1 3300050511 Bacteria 11402
303 nmdc:mga0n895_1197340_c1 3300050512 Bacteria 734
304 nmdc:mga0n895_1417_c1 3300050512 Bacteria 17917
305 nmdc:mga0n895_64766_c1 3300050512 Bacteria 3616
306 nmdc:mga0rr50_32369_c1 3300050513 Bacteria 3725
307 nmdc:mga0rr50_5496_c1 3300050513 Bacteria 7568
308 nmdc:mga08x19_300806_c1 3300050514 Bacteria 1114
309 nmdc:mga0a205_34690_c1 3300050515 Bacteria 4841
310 nmdc:mga0a205_426215_c1 3300050515 Bacteria 1188
311 nmdc:mga0a205_670_c1 3300050515 Bacteria 27277
312 Ga0495619_0486820 3300053085 Unclassified 849
313 Ga0495619_0738293 3300053085 Bacteria 668
314 Ga0501084_0114202 3300054114 Bacteria 2270

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10471428 Ga0114129_104714282 106
2 3300050507 nmdc:mga05p37_334900_c1 nmdc:mga05p37_334900_c1_480_869 106
3 3300005340 Ga0070689_100409901 Ga0070689_1004099012 107
4 3300005365 Ga0070688_100028387 Ga0070688_1000283872 107
5 3300005618 Ga0068864_101022756 Ga0068864_1010227562 107
6 3300009094 Ga0111539_10171380 Ga0111539_101713802 107
7 3300025936 Ga0207670_10258977 Ga0207670_102589772 107
8 3300005440 Ga0070705_100738117 Ga0070705_1007381172 113
9 3300005546 Ga0070696_100442657 Ga0070696_1004426571 113
10 3300026116 Ga0207674_10734240 Ga0207674_107342402 113
11 3300036712 Ga0316584_0024523 Ga0316584_0024523_2046_2396 113
12 3300009147 Ga0114129_10598679 Ga0114129_105986792 114
13 3300050507 nmdc:mga05p37_552838_c1 nmdc:mga05p37_552838_c1_140_508 114
14 iso_pu_bacteria 2643221588 2643951113 115
15 3300026075 Ga0207708_10294022 Ga0207708_102940222 116
16 3300005844 Ga0068862_101223587 Ga0068862_1012235872 117
17 3300009553 Ga0105249_10756261 Ga0105249_107562612 117
18 3300025940 Ga0207691_11576606 Ga0207691_115766062 117
19 3300025961 Ga0207712_10164147 Ga0207712_101641472 117
20 3300028380 Ga0268265_10155591 Ga0268265_101555912 117
21 3300009174 Ga0105241_11346217 Ga0105241_113462171 118
22 3300031727 Ga0316576_10098058 Ga0316576_100980582 118
23 3300037471 Ga0395905_0131694 Ga0395905_0131694_596_976 118
24 3300046535 Ga0495586_0241432 Ga0495586_0241432_250_609 118
25 3300048919 Ga0496116_0000008 Ga0496116_0000008_468283_468654 118
26 3300048924 Ga0496121_0000012 Ga0496121_0000012_247098_247469 118
27 3300048929 Ga0496126_0366918 Ga0496126_0366918_285_656 118
28 3300050492 nmdc:mga0yw44_51176_c1 nmdc:mga0yw44_51176_c1_1152_1514 118
29 3300050507 nmdc:mga05p37_325846_c1 nmdc:mga05p37_325846_c1_1147_1551 118
30 3300005328 Ga0070676_11220812 Ga0070676_112208122 119
31 3300005335 Ga0070666_10219665 Ga0070666_102196652 119
32 3300005338 Ga0068868_100437536 Ga0068868_1004375362 119
33 3300005459 Ga0068867_100498412 Ga0068867_1004984122 119
34 3300005459 Ga0068867_100700124 Ga0068867_1007001241 119
35 3300005544 Ga0070686_100756042 Ga0070686_1007560421 119
36 3300005578 Ga0068854_100006245 Ga0068854_1000062457 119
37 3300005616 Ga0068852_100609255 Ga0068852_1006092552 119
38 3300005718 Ga0068866_10018483 Ga0068866_100184833 119
39 3300005719 Ga0068861_101386623 Ga0068861_1013866232 119
40 3300006058 Ga0075432_10303132 Ga0075432_103031321 119
41 3300006237 Ga0097621_100232331 Ga0097621_1002323312 119
42 3300006358 Ga0068871_100028855 Ga0068871_1000288553 119
43 3300006847 Ga0075431_100014651 Ga0075431_10001465113 119
44 3300006881 Ga0068865_100054384 Ga0068865_1000543842 119
45 3300009098 Ga0105245_10541644 Ga0105245_105416442 119
46 3300009148 Ga0105243_10878435 Ga0105243_108784352 119
47 3300009176 Ga0105242_10001709 Ga0105242_1000170917 119
48 3300009177 Ga0105248_10318929 Ga0105248_103189292 119
49 3300013297 Ga0157378_10386098 Ga0157378_103860982 119
50 3300014326 Ga0157380_10383038 Ga0157380_103830383 119
51 3300014969 Ga0157376_10151427 Ga0157376_101514272 119
52 3300025899 Ga0207642_10117920 Ga0207642_101179202 119
53 3300025899 Ga0207642_10667906 Ga0207642_106679061 119
54 3300025923 Ga0207681_10031852 Ga0207681_100318525 119
55 3300025934 Ga0207686_10124584 Ga0207686_101245842 119
56 3300025938 Ga0207704_10246879 Ga0207704_102468791 119
57 3300025981 Ga0207640_10007509 Ga0207640_100075093 119
58 3300026023 Ga0207677_10478128 Ga0207677_104781282 119
59 3300026023 Ga0207677_11058804 Ga0207677_110588041 119
60 3300026089 Ga0207648_10421942 Ga0207648_104219421 119
61 3300026118 Ga0207675_101764016 Ga0207675_1017640162 119
62 3300027907 Ga0207428_10001962 Ga0207428_1000196224 119
63 3300031249 Ga0265339_10255332 Ga0265339_102553322 119
64 3300031727 Ga0316576_10931084 Ga0316576_109310841 119
65 3300031728 Ga0316578_10096020 Ga0316578_100960202 119
66 3300035398 Ga0316574_0398391 Ga0316574_0398391_38_436 119
67 3300041404 Ga0439436_0141315 Ga0439436_0141315_157_522 119
68 3300042436 Ga0439435_0161820 Ga0439435_0161820_21_380 119
69 3300046664 Ga0495659_0362169 Ga0495659_0362169_232_591 119
70 3300049568 Ga0501031_0301993 Ga0501031_0301993_641_1000 119
71 3300049572 Ga0501036_0103730 Ga0501036_0103730_972_1331 119
72 3300049576 Ga0501040_0106898 Ga0501040_0106898_1169_1528 119
73 3300049577 Ga0501041_0168398 Ga0501041_0168398_519_878 119
74 3300049584 Ga0501068_0852716 Ga0501068_0852716_104_463 119
75 3300049588 Ga0501072_0139290 Ga0501072_0139290_1085_1444 119
76 3300049592 Ga0501076_0394031 Ga0501076_0394031_307_666 119
77 3300049741 Ga0501079_0376093 Ga0501079_0376093_219_578 119
78 3300049742 Ga0501080_0269138 Ga0501080_0269138_1114_1473 119
79 3300049743 Ga0501081_0017289 Ga0501081_0017289_4060_4419 119
80 3300050509 nmdc:mga0qj67_31455_c1 nmdc:mga0qj67_31455_c1_1869_2228 119
81 3300050510 nmdc:mga06r32_16884_c1 nmdc:mga06r32_16884_c1_5245_5604 119
82 3300053085 Ga0495619_0486820 Ga0495619_0486820_450_809 119
83 3300054114 Ga0501084_0114202 Ga0501084_0114202_1195_1554 119
84 3300005334 Ga0068869_100043445 Ga0068869_1000434453 120
85 3300005334 Ga0068869_100161984 Ga0068869_1001619842 120
86 3300005353 Ga0070669_100431335 Ga0070669_1004313351 120
87 3300005354 Ga0070675_100621504 Ga0070675_1006215041 120
88 3300005354 Ga0070675_100728996 Ga0070675_1007289962 120
89 3300005364 Ga0070673_101299297 Ga0070673_1012992972 120
90 3300005441 Ga0070700_100111304 Ga0070700_1001113042 120
91 3300005441 Ga0070700_101657680 Ga0070700_1016576802 120
92 3300005458 Ga0070681_11112631 Ga0070681_111126312 120
93 3300005546 Ga0070696_101104535 Ga0070696_1011045351 120
94 3300005549 Ga0070704_100452353 Ga0070704_1004523532 120
95 3300005616 Ga0068852_100715649 Ga0068852_1007156492 120
96 3300005719 Ga0068861_100159029 Ga0068861_1001590291 120
97 3300005719 Ga0068861_101852974 Ga0068861_1018529742 120
98 3300006852 Ga0075433_10005477 Ga0075433_100054771 120
99 3300006852 Ga0075433_10128596 Ga0075433_101285964 120
100 3300006871 Ga0075434_100000111 Ga0075434_10000011114 120
101 3300006871 Ga0075434_100052052 Ga0075434_1000520522 120
102 3300006871 Ga0075434_102166387 Ga0075434_1021663871 120
103 3300006880 Ga0075429_100990651 Ga0075429_1009906512 120
104 3300007076 Ga0075435_100115632 Ga0075435_1001156322 120
105 3300009094 Ga0111539_10005517 Ga0111539_1000551715 120
106 3300009094 Ga0111539_10007638 Ga0111539_100076381 120
107 3300009094 Ga0111539_10207172 Ga0111539_102071722 120
108 3300009147 Ga0114129_10009269 Ga0114129_1000926919 120
109 3300009147 Ga0114129_10059640 Ga0114129_100596404 120
110 3300009177 Ga0105248_10021387 Ga0105248_100213873 120
111 3300009177 Ga0105248_10178533 Ga0105248_101785333 120
112 3300009177 Ga0105248_11486278 Ga0105248_114862781 120
113 3300014969 Ga0157376_10205766 Ga0157376_102057663 120
114 3300025903 Ga0207680_10454081 Ga0207680_104540812 120
115 3300025903 Ga0207680_10712591 Ga0207680_107125911 120
116 3300025926 Ga0207659_10453838 Ga0207659_104538381 120
117 3300025932 Ga0207690_10434730 Ga0207690_104347302 120
118 3300025941 Ga0207711_10107824 Ga0207711_101078243 120
119 3300025942 Ga0207689_10066242 Ga0207689_100662423 120
120 3300025945 Ga0207679_12155703 Ga0207679_121557032 120
121 3300026075 Ga0207708_11599999 Ga0207708_115999992 120
122 3300026118 Ga0207675_100081783 Ga0207675_1000817831 120
123 3300026118 Ga0207675_100127871 Ga0207675_1001278713 120
124 3300026142 Ga0207698_10832890 Ga0207698_108328902 120
125 3300027360 Ga0209969_1066445 Ga0209969_10664451 120
126 3300027526 Ga0209968_1055625 Ga0209968_10556252 120
127 3300027907 Ga0207428_10394634 Ga0207428_103946342 120
128 3300027907 Ga0207428_10553107 Ga0207428_105531072 120
129 3300031727 Ga0316576_10810978 Ga0316576_108109782 120
130 3300031995 Ga0307409_101118903 Ga0307409_1011189031 120
131 3300035089 Ga0373944_0283474 Ga0373944_0283474_47_409 120
132 3300035171 Ga0373946_0418495 Ga0373946_0418495_127_492 120
133 3300035725 Ga0373947_0590685 Ga0373947_0590685_180_542 120
134 3300037068 Ga0373925_0326437 Ga0373925_0326437_574_936 120
135 3300037418 Ga0395900_0200268 Ga0395900_0200268_1502_1864 120
136 3300044901 Ga0466960_0611683 Ga0466960_0611683_229_591 120
137 3300045051 Ga0451576_1315855 Ga0451576_1315855_13_375 120
138 3300045976 Ga0466967_0713225 Ga0466967_0713225_555_932 120
139 3300046459 Ga0495629_0179420 Ga0495629_0179420_1010_1372 120
140 3300046473 Ga0495582_0313676 Ga0495582_0313676_255_617 120
141 3300046499 Ga0495594_0327569 Ga0495594_0327569_463_825 120
142 3300046664 Ga0495659_0524034 Ga0495659_0524034_80_448 120
143 3300046681 Ga0495647_0021569 Ga0495647_0021569_136_498 120
144 3300046683 Ga0495658_0035208 Ga0495658_0035208_1148_1510 120
145 3300046692 Ga0495671_0458953 Ga0495671_0458953_24_386 120
146 3300050507 nmdc:mga05p37_4371_c1 nmdc:mga05p37_4371_c1_8385_8747 120
147 3300050507 nmdc:mga05p37_84957_c1 nmdc:mga05p37_84957_c1_2976_3338 120
148 3300050511 nmdc:mga08y16_74686_c1 nmdc:mga08y16_74686_c1_137_502 120
149 3300050511 nmdc:mga08y16_7530_c1 nmdc:mga08y16_7530_c1_1079_1441 120
150 3300050512 nmdc:mga0n895_1197340_c1 nmdc:mga0n895_1197340_c1_227_592 120
151 3300050512 nmdc:mga0n895_1417_c1 nmdc:mga0n895_1417_c1_3203_3565 120
152 3300050513 nmdc:mga0rr50_32369_c1 nmdc:mga0rr50_32369_c1_610_972 120
153 3300050515 nmdc:mga0a205_34690_c1 nmdc:mga0a205_34690_c1_1399_1761 120
154 3300050515 nmdc:mga0a205_670_c1 nmdc:mga0a205_670_c1_8218_8580 120
155 3300005328 Ga0070676_10008377 Ga0070676_100083777 121
156 3300005331 Ga0070670_100004141 Ga0070670_1000041412 121
157 3300005333 Ga0070677_10060218 Ga0070677_100602182 121
158 3300005333 Ga0070677_10423330 Ga0070677_104233302 121
159 3300005334 Ga0068869_100022305 Ga0068869_1000223056 121
160 3300005335 Ga0070666_11398224 Ga0070666_113982241 121
161 3300005338 Ga0068868_100219293 Ga0068868_1002192932 121
162 3300005343 Ga0070687_100155763 Ga0070687_1001557632 121
163 3300005344 Ga0070661_100476828 Ga0070661_1004768282 121
164 3300005344 Ga0070661_101060619 Ga0070661_1010606191 121
165 3300005354 Ga0070675_100001994 Ga0070675_1000019943 121
166 3300005354 Ga0070675_100108584 Ga0070675_1001085842 121
167 3300005355 Ga0070671_100018769 Ga0070671_1000187694 121
168 3300005356 Ga0070674_100089513 Ga0070674_1000895132 121
169 3300005356 Ga0070674_100324898 Ga0070674_1003248982 121
170 3300005364 Ga0070673_100013186 Ga0070673_1000131866 121
171 3300005364 Ga0070673_100107543 Ga0070673_1001075432 121
172 3300005441 Ga0070700_100002609 Ga0070700_1000026097 121
173 3300005456 Ga0070678_100075523 Ga0070678_1000755233 121
174 3300005459 Ga0068867_100000456 Ga0068867_10000045613 121
175 3300005466 Ga0070685_11041481 Ga0070685_110414812 121
176 3300005564 Ga0070664_100299917 Ga0070664_1002999172 121
177 3300005564 Ga0070664_100642626 Ga0070664_1006426262 121
178 3300005615 Ga0070702_100205837 Ga0070702_1002058372 121
179 3300005617 Ga0068859_102743521 Ga0068859_1027435211 121
180 3300005618 Ga0068864_100451202 Ga0068864_1004512022 121
181 3300005718 Ga0068866_10033873 Ga0068866_100338732 121
182 3300005719 Ga0068861_100100016 Ga0068861_1001000162 121
183 3300005834 Ga0068851_10027302 Ga0068851_100273022 121
184 3300005840 Ga0068870_10364694 Ga0068870_103646942 121
185 3300005840 Ga0068870_10493724 Ga0068870_104937242 121
186 3300005840 Ga0068870_10670093 Ga0068870_106700932 121
187 3300005841 Ga0068863_101096430 Ga0068863_1010964302 121
188 3300005842 Ga0068858_100542288 Ga0068858_1005422883 121
189 3300005842 Ga0068858_102039019 Ga0068858_1020390191 121
190 3300005843 Ga0068860_100274031 Ga0068860_1002740312 121
191 3300005985 Ga0081539_10143676 Ga0081539_101436763 121
192 3300006237 Ga0097621_101599250 Ga0097621_1015992502 121
193 3300006871 Ga0075434_100065708 Ga0075434_1000657083 121
194 3300006881 Ga0068865_100005360 Ga0068865_1000053607 121
195 3300006931 Ga0097620_102744718 Ga0097620_1027447181 121
196 3300007076 Ga0075435_100021136 Ga0075435_1000211362 121
197 3300007788 Ga0099795_10040465 Ga0099795_100404652 121
198 3300009148 Ga0105243_10077914 Ga0105243_100779142 121
199 3300009176 Ga0105242_10009038 Ga0105242_100090384 121
200 3300009177 Ga0105248_11353148 Ga0105248_113531481 121
201 3300009177 Ga0105248_11423401 Ga0105248_114234012 121
202 3300009545 Ga0105237_11665956 Ga0105237_116659561 121
203 3300009551 Ga0105238_10008566 Ga0105238_100085669 121
204 3300009553 Ga0105249_11289584 Ga0105249_112895842 121
205 3300010159 Ga0099796_10217396 Ga0099796_102173962 121
206 3300011119 Ga0105246_11017395 Ga0105246_110173952 121
207 3300013297 Ga0157378_10541280 Ga0157378_105412802 121
208 3300013308 Ga0157375_10785718 Ga0157375_107857182 121
209 3300014325 Ga0163163_10021891 Ga0163163_100218917 121
210 3300014326 Ga0157380_10009513 Ga0157380_100095134 121
211 3300014326 Ga0157380_10173437 Ga0157380_101734373 121
212 3300014326 Ga0157380_10203043 Ga0157380_102030432 121
213 3300014745 Ga0157377_10295590 Ga0157377_102955902 121
214 3300014745 Ga0157377_10492724 Ga0157377_104927242 121
215 3300025321 Ga0207656_10064145 Ga0207656_100641452 121
216 3300025893 Ga0207682_10103534 Ga0207682_101035342 121
217 3300025899 Ga0207642_10142506 Ga0207642_101425062 121
218 3300025900 Ga0207710_10047175 Ga0207710_100471752 121
219 3300025903 Ga0207680_10514688 Ga0207680_105146882 121
220 3300025903 Ga0207680_10541873 Ga0207680_105418732 121
221 3300025907 Ga0207645_10022014 Ga0207645_100220143 121
222 3300025907 Ga0207645_10525287 Ga0207645_105252871 121
223 3300025908 Ga0207643_10010780 Ga0207643_100107803 121
224 3300025908 Ga0207643_10033240 Ga0207643_100332403 121
225 3300025913 Ga0207695_10354709 Ga0207695_103547091 121
226 3300025918 Ga0207662_10176630 Ga0207662_101766302 121
227 3300025918 Ga0207662_10222526 Ga0207662_102225262 121
228 3300025920 Ga0207649_11205323 Ga0207649_112053231 121
229 3300025923 Ga0207681_10006840 Ga0207681_100068402 121
230 3300025924 Ga0207694_10014775 Ga0207694_100147756 121
231 3300025924 Ga0207694_10163152 Ga0207694_101631522 121
232 3300025925 Ga0207650_10008496 Ga0207650_100084969 121
233 3300025926 Ga0207659_10017594 Ga0207659_100175942 121
234 3300025926 Ga0207659_10037910 Ga0207659_100379103 121
235 3300025933 Ga0207706_10204344 Ga0207706_102043442 121
236 3300025934 Ga0207686_10006011 Ga0207686_100060114 121
237 3300025934 Ga0207686_10412909 Ga0207686_104129092 121
238 3300025935 Ga0207709_10039919 Ga0207709_100399192 121
239 3300025937 Ga0207669_10050682 Ga0207669_100506822 121
240 3300025937 Ga0207669_10991228 Ga0207669_109912282 121
241 3300025938 Ga0207704_10001077 Ga0207704_100010777 121
242 3300025940 Ga0207691_10024349 Ga0207691_100243492 121
243 3300025941 Ga0207711_10008147 Ga0207711_100081472 121
244 3300025941 Ga0207711_10358549 Ga0207711_103585491 121
245 3300025941 Ga0207711_10589762 Ga0207711_105897622 121
246 3300025942 Ga0207689_10000796 Ga0207689_1000079625 121
247 3300025945 Ga0207679_10382584 Ga0207679_103825842 121
248 3300025949 Ga0207667_10463147 Ga0207667_104631472 121
249 3300025960 Ga0207651_10007612 Ga0207651_100076122 121
250 3300025960 Ga0207651_10016934 Ga0207651_100169343 121
251 3300025981 Ga0207640_10136937 Ga0207640_101369372 121
252 3300025981 Ga0207640_10197613 Ga0207640_101976132 121
253 3300025981 Ga0207640_10316006 Ga0207640_103160063 121
254 3300025981 Ga0207640_10518979 Ga0207640_105189792 121
255 3300026035 Ga0207703_10049883 Ga0207703_100498832 121
256 3300026035 Ga0207703_10388849 Ga0207703_103888492 121
257 3300026035 Ga0207703_10412407 Ga0207703_104124073 121
258 3300026067 Ga0207678_10524456 Ga0207678_105244561 121
259 3300026075 Ga0207708_10007174 Ga0207708_1000717411 121
260 3300026088 Ga0207641_10817914 Ga0207641_108179142 121
261 3300026089 Ga0207648_10000077 Ga0207648_1000007771 121
262 3300026095 Ga0207676_10354338 Ga0207676_103543382 121
263 3300026095 Ga0207676_10415435 Ga0207676_104154352 121
264 3300026118 Ga0207675_100120986 Ga0207675_1001209862 121
265 3300026118 Ga0207675_100446513 Ga0207675_1004465132 121
266 3300026121 Ga0207683_10050276 Ga0207683_100502763 121
267 3300026121 Ga0207683_10224547 Ga0207683_102245471 121
268 3300027907 Ga0207428_10001495 Ga0207428_1000149521 121
269 3300028381 Ga0268264_10138542 Ga0268264_101385422 121
270 3300028381 Ga0268264_10155989 Ga0268264_101559892 121
271 3300034817 Ga0373948_0000326 Ga0373948_0000326_1195_1560 121
272 3300034820 Ga0373959_0001480 Ga0373959_0001480_2998_3363 121
273 3300034957 Ga0373938_0000842 Ga0373938_0000842_390_755 121
274 3300035084 Ga0373928_0001434 Ga0373928_0001434_560_925 121
275 3300035085 Ga0373929_0001509 Ga0373929_0001509_2750_3115 121
276 3300035088 Ga0373940_0000163 Ga0373940_0000163_1149_1514 121
277 3300035090 Ga0373949_0002817 Ga0373949_0002817_3655_4020 121
278 3300035091 Ga0373951_0002196 Ga0373951_0002196_4079_4444 121
279 3300035092 Ga0373952_0000063 Ga0373952_0000063_1632_1997 121
280 3300035112 Ga0373932_0006409 Ga0373932_0006409_1136_1501 121
281 3300035114 Ga0373939_0002345 Ga0373939_0002345_2324_2689 121
282 3300035115 Ga0373941_0000667 Ga0373941_0000667_5088_5453 121
283 3300035121 Ga0373960_0001427 Ga0373960_0001427_3808_4173 121
284 3300035207 Ga0373942_0001136 Ga0373942_0001136_5606_5971 121
285 3300035241 Ga0373961_0006444 Ga0373961_0006444_1219_1584 121
286 3300035242 Ga0373962_0004599 Ga0373962_0004599_1246_1611 121
287 3300035691 Ga0373931_0016193 Ga0373931_0016193_777_1142 121
288 3300041512 Ga0451853_1510120 Ga0451853_1510120_1891_2256 121
289 3300045051 Ga0451576_0012707 Ga0451576_0012707_702_1067 121
290 3300045051 Ga0451576_1870463 Ga0451576_1870463_154_522 121
291 3300046642 Ga0495634_0288119 Ga0495634_0288119_489_857 121
292 3300046663 Ga0495635_0419802 Ga0495635_0419802_51_482 121
293 3300046681 Ga0495647_0431043 Ga0495647_0431043_166_597 121
294 3300046681 Ga0495647_0431793 Ga0495647_0431793_16_384 121
295 3300047319 Ga0495674_0356885 Ga0495674_0356885_731_1099 121
296 3300047471 Ga0495684_0482823 Ga0495684_0482823_159_527 121
297 3300048904 Ga0496101_1335377 Ga0496101_1335377_97_462 121
298 3300048907 Ga0496104_0049740 Ga0496104_0049740_2088_2456 121
299 3300048910 Ga0496107_0096408 Ga0496107_0096408_194_562 121
300 3300048911 Ga0496108_0021323 Ga0496108_0021323_321_689 121
301 3300048912 Ga0496109_0075692 Ga0496109_0075692_267_635 121
302 3300048914 Ga0496111_0899453 Ga0496111_0899453_100_468 121
303 3300048915 Ga0496112_0019555 Ga0496112_0019555_902_1270 121
304 3300048916 Ga0496113_0340728 Ga0496113_0340728_659_1027 121
305 3300050507 nmdc:mga05p37_1351935_c1 nmdc:mga05p37_1351935_c1_277_645 121
306 3300050507 nmdc:mga05p37_183607_c1 nmdc:mga05p37_183607_c1_2099_2467 121
307 3300050508 nmdc:mga09592_11223_c1 nmdc:mga09592_11223_c1_97_465 121
308 3300050509 nmdc:mga0qj67_1195667_c1 nmdc:mga0qj67_1195667_c1_78_446 121
309 3300050510 nmdc:mga06r32_199164_c1 nmdc:mga06r32_199164_c1_1546_1914 121
310 3300050511 nmdc:mga08y16_3332_c1 nmdc:mga08y16_3332_c1_5461_5829 121
311 3300050512 nmdc:mga0n895_64766_c1 nmdc:mga0n895_64766_c1_846_1211 121
312 3300050513 nmdc:mga0rr50_5496_c1 nmdc:mga0rr50_5496_c1_2958_3323 121
313 3300050514 nmdc:mga08x19_300806_c1 nmdc:mga08x19_300806_c1_112_480 121
314 3300050515 nmdc:mga0a205_426215_c1 nmdc:mga0a205_426215_c1_236_604 121
315 3300053085 Ga0495619_0738293 Ga0495619_0738293_121_552 121

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p8n-assembly1.cif.gz_B tmhydabc- t. maritima hydrogenase with bridge closed 0.8668 20 115
7p92-assembly1.cif.gz_B tmhydabc- t. maritima bifurcating hydrogenase with bridge domain up 0.8652 17 112
8oh5-assembly1.cif.gz_B cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) 0.8553 21 117
7p5h-assembly1.cif.gz_b tmhydabc- d2 map 0.8549 17 112
7q4v-assembly1.cif.gz_B electron bifurcating hydrogenase - hydabc from a. woodii 0.8471 18 115
ID Description Score Start End Superfamily
5abrB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.792 19 115 3.40.30.10
af_I1M6F2_186_285_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7594 20 114 3.40.30.10
af_Q7XQA0_31_116_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.737 20 105 3.40.30.10
5abrB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7361 19 115 3.40.30.10
1m2dB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7201 20 115 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3C1HFJ2-F1-model_v4 Ferredoxin 0.9531 35 121
AF-A0A7V4H1E3-F1-model_v4 Uncharacterized protein 0.9417 37 121
AF-A0A7W0FX34-F1-model_v4 (2Fe-2S) ferredoxin domain-containing protein 0.9392 4 117
AF-A0A382NT38-F1-model_v4 Ferredoxin 0.9344 6 117
AF-A0A518DNR2-F1-model_v4 Ferredoxin, 2Fe-2S 0.9339 7 121

Feature Viewer

pLDDT pTM Quality
87.64 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map