F403217
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 315 | 194 | 314 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300025981|Ga0207640_10316006|Ga0207640_103160063 |
| Length | 142 |
| Sequence | LASADSVPLDNPPDKVALAATVLNNLGGFGTQRHIFLCCDQTKPKCCTTRRGLAGWDYLKNRLRELGLSEQGGVQRTKANCLRVCEAGPIAVVWPDNVWYHSCDPPVLERIILEHLRDGVPVEDYRLNSPGSPSRARPRADR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 41 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 45 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 51 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 63 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 113 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 117 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 118 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 119 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 120 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 121 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 122 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 123 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 124 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 125 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 126 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 127 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 128 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 129 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 131 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 133 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 134 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 136 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 137 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 138 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 139 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 140 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 141 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 143 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 144 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 145 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 146 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 147 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 148 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 149 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 150 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 164 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 165 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 168 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 169 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 170 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 171 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 172 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 173 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 184 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0 |
| Isolates | 0.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.32 |
| Nodule | 0 |
| Rhizoplane | 2.54 |
| Rhizosphere | 95.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10008377 | 3300005328 | Bacteria | 5570 |
| 2 | Ga0070676_11220812 | 3300005328 | Bacteria | 572 |
| 3 | Ga0070670_100004141 | 3300005331 | Bacteria | 12122 |
| 4 | Ga0070677_10060218 | 3300005333 | Bacteria | 1564 |
| 5 | Ga0070677_10423330 | 3300005333 | Bacteria | 707 |
| 6 | Ga0068869_100022305 | 3300005334 | Bacteria | 4361 |
| 7 | Ga0068869_100043445 | 3300005334 | Bacteria | 3228 |
| 8 | Ga0068869_100161984 | 3300005334 | Bacteria | 1742 |
| 9 | Ga0070666_10219665 | 3300005335 | Bacteria | 1340 |
| 10 | Ga0070666_11398224 | 3300005335 | Bacteria | 523 |
| 11 | Ga0068868_100219293 | 3300005338 | Bacteria | 1592 |
| 12 | Ga0068868_100437536 | 3300005338 | Bacteria | 1135 |
| 13 | Ga0070689_100409901 | 3300005340 | Bacteria | 1147 |
| 14 | Ga0070687_100155763 | 3300005343 | Bacteria | 1346 |
| 15 | Ga0070661_100476828 | 3300005344 | Bacteria | 996 |
| 16 | Ga0070661_101060619 | 3300005344 | Bacteria | 674 |
| 17 | Ga0070669_100431335 | 3300005353 | Bacteria | 1083 |
| 18 | Ga0070675_100001994 | 3300005354 | Bacteria | 15146 |
| 19 | Ga0070675_100108584 | 3300005354 | Bacteria | 2343 |
| 20 | Ga0070675_100621504 | 3300005354 | Bacteria | 981 |
| 21 | Ga0070675_100728996 | 3300005354 | Bacteria | 904 |
| 22 | Ga0070671_100018769 | 3300005355 | Bacteria | 5620 |
| 23 | Ga0070674_100089513 | 3300005356 | Bacteria | 2218 |
| 24 | Ga0070674_100324898 | 3300005356 | Bacteria | 1235 |
| 25 | Ga0070673_100013186 | 3300005364 | Bacteria | 5706 |
| 26 | Ga0070673_100107543 | 3300005364 | Bacteria | 2307 |
| 27 | Ga0070673_101299297 | 3300005364 | Unclassified | 683 |
| 28 | Ga0070688_100028387 | 3300005365 | Bacteria | 3340 |
| 29 | Ga0070705_100738117 | 3300005440 | Bacteria | 777 |
| 30 | Ga0070700_100002609 | 3300005441 | Bacteria | 9211 |
| 31 | Ga0070700_100111304 | 3300005441 | Bacteria | 1821 |
| 32 | Ga0070700_101657680 | 3300005441 | Bacteria | 548 |
| 33 | Ga0070678_100075523 | 3300005456 | Bacteria | 2535 |
| 34 | Ga0070681_11112631 | 3300005458 | Unclassified | 711 |
| 35 | Ga0068867_100000456 | 3300005459 | Bacteria | 27121 |
| 36 | Ga0068867_100498412 | 3300005459 | Bacteria | 1046 |
| 37 | Ga0068867_100700124 | 3300005459 | Bacteria | 894 |
| 38 | Ga0070685_11041481 | 3300005466 | Unclassified | 616 |
| 39 | Ga0070686_100756042 | 3300005544 | Bacteria | 780 |
| 40 | Ga0070696_100442657 | 3300005546 | Bacteria | 1024 |
| 41 | Ga0070696_101104535 | 3300005546 | Bacteria | 667 |
| 42 | Ga0070704_100452353 | 3300005549 | Bacteria | 1106 |
| 43 | Ga0070664_100299917 | 3300005564 | Bacteria | 1452 |
| 44 | Ga0070664_100642626 | 3300005564 | Bacteria | 986 |
| 45 | Ga0068854_100006245 | 3300005578 | Bacteria | 7567 |
| 46 | Ga0070702_100205837 | 3300005615 | Bacteria | 1306 |
| 47 | Ga0068852_100609255 | 3300005616 | Bacteria | 1097 |
| 48 | Ga0068852_100715649 | 3300005616 | Bacteria | 1012 |
| 49 | Ga0068859_102743521 | 3300005617 | Bacteria | 541 |
| 50 | Ga0068864_100451202 | 3300005618 | Bacteria | 1230 |
| 51 | Ga0068864_101022756 | 3300005618 | Bacteria | 820 |
| 52 | Ga0068866_10018483 | 3300005718 | Bacteria | 3153 |
| 53 | Ga0068866_10033873 | 3300005718 | Bacteria | 2483 |
| 54 | Ga0068861_100100016 | 3300005719 | Bacteria | 2304 |
| 55 | Ga0068861_100159029 | 3300005719 | Bacteria | 1862 |
| 56 | Ga0068861_101386623 | 3300005719 | Bacteria | 686 |
| 57 | Ga0068861_101852974 | 3300005719 | Bacteria | 599 |
| 58 | Ga0068851_10027302 | 3300005834 | Bacteria | 2813 |
| 59 | Ga0068870_10364694 | 3300005840 | Bacteria | 931 |
| 60 | Ga0068870_10493724 | 3300005840 | Bacteria | 815 |
| 61 | Ga0068870_10670093 | 3300005840 | Bacteria | 713 |
| 62 | Ga0068863_101096430 | 3300005841 | Bacteria | 801 |
| 63 | Ga0068858_100542288 | 3300005842 | Bacteria | 1126 |
| 64 | Ga0068858_102039019 | 3300005842 | Bacteria | 567 |
| 65 | Ga0068860_100274031 | 3300005843 | Bacteria | 1647 |
| 66 | Ga0068862_101223587 | 3300005844 | Bacteria | 750 |
| 67 | Ga0081539_10143676 | 3300005985 | Bacteria | 1156 |
| 68 | Ga0075432_10303132 | 3300006058 | Bacteria | 664 |
| 69 | Ga0097621_100232331 | 3300006237 | Bacteria | 1610 |
| 70 | Ga0097621_101599250 | 3300006237 | Bacteria | 620 |
| 71 | Ga0068871_100028855 | 3300006358 | Bacteria | 4354 |
| 72 | Ga0075431_100014651 | 3300006847 | Bacteria | 7933 |
| 73 | Ga0075433_10005477 | 3300006852 | Bacteria | 9971 |
| 74 | Ga0075433_10128596 | 3300006852 | Bacteria | 2250 |
| 75 | Ga0075434_100000111 | 3300006871 | Bacteria | 46866 |
| 76 | Ga0075434_100052052 | 3300006871 | Bacteria | 4068 |
| 77 | Ga0075434_100065708 | 3300006871 | Bacteria | 3613 |
| 78 | Ga0075434_102166387 | 3300006871 | Bacteria | 560 |
| 79 | Ga0075429_100990651 | 3300006880 | Bacteria | 735 |
| 80 | Ga0068865_100005360 | 3300006881 | Bacteria | 7767 |
| 81 | Ga0068865_100054384 | 3300006881 | Bacteria | 2781 |
| 82 | Ga0097620_102744718 | 3300006931 | Bacteria | 541 |
| 83 | Ga0075435_100021136 | 3300007076 | Bacteria | 5000 |
| 84 | Ga0075435_100115632 | 3300007076 | Bacteria | 2234 |
| 85 | Ga0099795_10040465 | 3300007788 | Bacteria | 1655 |
| 86 | Ga0111539_10005517 | 3300009094 | Bacteria | 16366 |
| 87 | Ga0111539_10007638 | 3300009094 | Bacteria | 13818 |
| 88 | Ga0111539_10171380 | 3300009094 | Bacteria | 2536 |
| 89 | Ga0111539_10207172 | 3300009094 | Bacteria | 2285 |
| 90 | Ga0105245_10541644 | 3300009098 | Bacteria | 1185 |
| 91 | Ga0114129_10009269 | 3300009147 | Bacteria | 14036 |
| 92 | Ga0114129_10059640 | 3300009147 | Bacteria | 5334 |
| 93 | Ga0114129_10471428 | 3300009147 | Bacteria | 1644 |
| 94 | Ga0114129_10598679 | 3300009147 | Bacteria | 1428 |
| 95 | Ga0105243_10077914 | 3300009148 | Bacteria | 2697 |
| 96 | Ga0105243_10878435 | 3300009148 | Bacteria | 890 |
| 97 | Ga0105241_11346217 | 3300009174 | Bacteria | 682 |
| 98 | Ga0105242_10001709 | 3300009176 | Bacteria | 17356 |
| 99 | Ga0105242_10009038 | 3300009176 | Bacteria | 7657 |
| 100 | Ga0105248_10021387 | 3300009177 | Bacteria | 7168 |
| 101 | Ga0105248_10178533 | 3300009177 | Bacteria | 2393 |
| 102 | Ga0105248_10318929 | 3300009177 | Bacteria | 1750 |
| 103 | Ga0105248_11353148 | 3300009177 | Unclassified | 805 |
| 104 | Ga0105248_11423401 | 3300009177 | Bacteria | 784 |
| 105 | Ga0105248_11486278 | 3300009177 | Unclassified | 767 |
| 106 | Ga0105237_11665956 | 3300009545 | Unclassified | 645 |
| 107 | Ga0105238_10008566 | 3300009551 | Bacteria | 10232 |
| 108 | Ga0105249_10756261 | 3300009553 | Unclassified | 1034 |
| 109 | Ga0105249_11289584 | 3300009553 | Bacteria | 802 |
| 110 | Ga0099796_10217396 | 3300010159 | Bacteria | 782 |
| 111 | Ga0105246_11017395 | 3300011119 | Bacteria | 751 |
| 112 | Ga0157378_10386098 | 3300013297 | Bacteria | 1376 |
| 113 | Ga0157378_10541280 | 3300013297 | Bacteria | 1168 |
| 114 | Ga0157375_10785718 | 3300013308 | Unclassified | 1101 |
| 115 | Ga0163163_10021891 | 3300014325 | Bacteria | 6042 |
| 116 | Ga0157380_10009513 | 3300014326 | Bacteria | 6969 |
| 117 | Ga0157380_10173437 | 3300014326 | Bacteria | 1887 |
| 118 | Ga0157380_10203043 | 3300014326 | Bacteria | 1760 |
| 119 | Ga0157380_10383038 | 3300014326 | Bacteria | 1328 |
| 120 | Ga0157377_10295590 | 3300014745 | Bacteria | 1067 |
| 121 | Ga0157377_10492724 | 3300014745 | Bacteria | 855 |
| 122 | Ga0157376_10151427 | 3300014969 | Bacteria | 2092 |
| 123 | Ga0157376_10205766 | 3300014969 | Bacteria | 1814 |
| 124 | Ga0207656_10064145 | 3300025321 | Unclassified | 1618 |
| 125 | Ga0207682_10103534 | 3300025893 | Bacteria | 1247 |
| 126 | Ga0207642_10117920 | 3300025899 | Bacteria | 1364 |
| 127 | Ga0207642_10142506 | 3300025899 | Bacteria | 1265 |
| 128 | Ga0207642_10667906 | 3300025899 | Bacteria | 652 |
| 129 | Ga0207710_10047175 | 3300025900 | Bacteria | 1925 |
| 130 | Ga0207680_10454081 | 3300025903 | Bacteria | 910 |
| 131 | Ga0207680_10514688 | 3300025903 | Bacteria | 853 |
| 132 | Ga0207680_10541873 | 3300025903 | Bacteria | 830 |
| 133 | Ga0207680_10712591 | 3300025903 | Unclassified | 719 |
| 134 | Ga0207645_10022014 | 3300025907 | Bacteria | 4151 |
| 135 | Ga0207645_10525287 | 3300025907 | Bacteria | 802 |
| 136 | Ga0207643_10010780 | 3300025908 | Bacteria | 4928 |
| 137 | Ga0207643_10033240 | 3300025908 | Bacteria | 2885 |
| 138 | Ga0207695_10354709 | 3300025913 | Bacteria | 1353 |
| 139 | Ga0207662_10176630 | 3300025918 | Bacteria | 1372 |
| 140 | Ga0207662_10222526 | 3300025918 | Bacteria | 1230 |
| 141 | Ga0207649_11205323 | 3300025920 | Bacteria | 598 |
| 142 | Ga0207681_10006840 | 3300025923 | Bacteria | 6995 |
| 143 | Ga0207681_10031852 | 3300025923 | Bacteria | 3447 |
| 144 | Ga0207694_10014775 | 3300025924 | Bacteria | 5887 |
| 145 | Ga0207694_10163152 | 3300025924 | Bacteria | 1801 |
| 146 | Ga0207650_10008496 | 3300025925 | Bacteria | 7010 |
| 147 | Ga0207659_10017594 | 3300025926 | Bacteria | 4671 |
| 148 | Ga0207659_10037910 | 3300025926 | Bacteria | 3350 |
| 149 | Ga0207659_10453838 | 3300025926 | Bacteria | 1080 |
| 150 | Ga0207690_10434730 | 3300025932 | Bacteria | 1052 |
| 151 | Ga0207706_10204344 | 3300025933 | Bacteria | 1732 |
| 152 | Ga0207686_10006011 | 3300025934 | Bacteria | 6515 |
| 153 | Ga0207686_10124584 | 3300025934 | Bacteria | 1759 |
| 154 | Ga0207686_10412909 | 3300025934 | Bacteria | 1031 |
| 155 | Ga0207709_10039919 | 3300025935 | Bacteria | 2807 |
| 156 | Ga0207670_10258977 | 3300025936 | Bacteria | 1348 |
| 157 | Ga0207669_10050682 | 3300025937 | Bacteria | 2483 |
| 158 | Ga0207669_10991228 | 3300025937 | Bacteria | 706 |
| 159 | Ga0207704_10001077 | 3300025938 | Bacteria | 12125 |
| 160 | Ga0207704_10246879 | 3300025938 | Bacteria | 1337 |
| 161 | Ga0207691_10024349 | 3300025940 | Bacteria | 5694 |
| 162 | Ga0207691_11576606 | 3300025940 | Bacteria | 535 |
| 163 | Ga0207711_10008147 | 3300025941 | Bacteria | 8769 |
| 164 | Ga0207711_10107824 | 3300025941 | Bacteria | 2473 |
| 165 | Ga0207711_10358549 | 3300025941 | Bacteria | 1350 |
| 166 | Ga0207711_10589762 | 3300025941 | Bacteria | 1037 |
| 167 | Ga0207689_10000796 | 3300025942 | Bacteria | 30368 |
| 168 | Ga0207689_10066242 | 3300025942 | Bacteria | 2970 |
| 169 | Ga0207679_10382584 | 3300025945 | Bacteria | 1234 |
| 170 | Ga0207679_12155703 | 3300025945 | Bacteria | 506 |
| 171 | Ga0207667_10463147 | 3300025949 | Bacteria | 1287 |
| 172 | Ga0207651_10007612 | 3300025960 | Bacteria | 5781 |
| 173 | Ga0207651_10016934 | 3300025960 | Bacteria | 4289 |
| 174 | Ga0207712_10164147 | 3300025961 | Bacteria | 1729 |
| 175 | Ga0207640_10007509 | 3300025981 | Bacteria | 6021 |
| 176 | Ga0207640_10136937 | 3300025981 | Bacteria | 1779 |
| 177 | Ga0207640_10197613 | 3300025981 | Bacteria | 1521 |
| 178 | Ga0207640_10316006 | 3300025981 | Bacteria | 1241 |
| 179 | Ga0207640_10518979 | 3300025981 | Bacteria | 995 |
| 180 | Ga0207677_10478128 | 3300026023 | Bacteria | 1073 |
| 181 | Ga0207677_11058804 | 3300026023 | Bacteria | 738 |
| 182 | Ga0207703_10049883 | 3300026035 | Bacteria | 3385 |
| 183 | Ga0207703_10388849 | 3300026035 | Bacteria | 1292 |
| 184 | Ga0207703_10412407 | 3300026035 | Bacteria | 1255 |
| 185 | Ga0207678_10524456 | 3300026067 | Unclassified | 1034 |
| 186 | Ga0207708_10007174 | 3300026075 | Bacteria | 8237 |
| 187 | Ga0207708_10294022 | 3300026075 | Bacteria | 1319 |
| 188 | Ga0207708_11599999 | 3300026075 | Unclassified | 572 |
| 189 | Ga0207641_10817914 | 3300026088 | Bacteria | 922 |
| 190 | Ga0207648_10000077 | 3300026089 | Bacteria | 93009 |
| 191 | Ga0207648_10421942 | 3300026089 | Bacteria | 1211 |
| 192 | Ga0207676_10354338 | 3300026095 | Bacteria | 1358 |
| 193 | Ga0207676_10415435 | 3300026095 | Bacteria | 1260 |
| 194 | Ga0207674_10734240 | 3300026116 | Bacteria | 953 |
| 195 | Ga0207675_100081783 | 3300026118 | Bacteria | 3029 |
| 196 | Ga0207675_100120986 | 3300026118 | Bacteria | 2477 |
| 197 | Ga0207675_100127871 | 3300026118 | Bacteria | 2408 |
| 198 | Ga0207675_100446513 | 3300026118 | Bacteria | 1281 |
| 199 | Ga0207675_101764016 | 3300026118 | Bacteria | 638 |
| 200 | Ga0207683_10050276 | 3300026121 | Bacteria | 3651 |
| 201 | Ga0207683_10224547 | 3300026121 | Bacteria | 1712 |
| 202 | Ga0207698_10832890 | 3300026142 | Bacteria | 927 |
| 203 | Ga0209969_1066445 | 3300027360 | Bacteria | 571 |
| 204 | Ga0209968_1055625 | 3300027526 | Unclassified | 692 |
| 205 | Ga0207428_10001495 | 3300027907 | Bacteria | 24437 |
| 206 | Ga0207428_10001962 | 3300027907 | Bacteria | 20882 |
| 207 | Ga0207428_10394634 | 3300027907 | Unclassified | 1014 |
| 208 | Ga0207428_10553107 | 3300027907 | Bacteria | 832 |
| 209 | Ga0268265_10155591 | 3300028380 | Bacteria | 1934 |
| 210 | Ga0268264_10138542 | 3300028381 | Bacteria | 2167 |
| 211 | Ga0268264_10155989 | 3300028381 | Bacteria | 2052 |
| 212 | Ga0265339_10255332 | 3300031249 | Unclassified | 847 |
| 213 | Ga0316576_10098058 | 3300031727 | Bacteria | 2188 |
| 214 | Ga0316576_10810978 | 3300031727 | Bacteria | 673 |
| 215 | Ga0316576_10931084 | 3300031727 | Bacteria | 621 |
| 216 | Ga0316578_10096020 | 3300031728 | Bacteria | 1774 |
| 217 | Ga0307409_101118903 | 3300031995 | Bacteria | 809 |
| 218 | Ga0373948_0000326 | 3300034817 | Bacteria | 5783 |
| 219 | Ga0373959_0001480 | 3300034820 | Bacteria | 3751 |
| 220 | Ga0373938_0000842 | 3300034957 | Bacteria | 4949 |
| 221 | Ga0373928_0001434 | 3300035084 | Bacteria | 4626 |
| 222 | Ga0373929_0001509 | 3300035085 | Bacteria | 4424 |
| 223 | Ga0373940_0000163 | 3300035088 | Bacteria | 8840 |
| 224 | Ga0373944_0283474 | 3300035089 | Bacteria | 618 |
| 225 | Ga0373949_0002817 | 3300035090 | Bacteria | 4322 |
| 226 | Ga0373951_0002196 | 3300035091 | Bacteria | 4964 |
| 227 | Ga0373952_0000063 | 3300035092 | Bacteria | 13330 |
| 228 | Ga0373932_0006409 | 3300035112 | Bacteria | 2782 |
| 229 | Ga0373939_0002345 | 3300035114 | Bacteria | 4478 |
| 230 | Ga0373941_0000667 | 3300035115 | Bacteria | 6940 |
| 231 | Ga0373960_0001427 | 3300035121 | Bacteria | 5284 |
| 232 | Ga0373946_0418495 | 3300035171 | Bacteria | 679 |
| 233 | Ga0373942_0001136 | 3300035207 | Bacteria | 7065 |
| 234 | Ga0373961_0006444 | 3300035241 | Bacteria | 2818 |
| 235 | Ga0373962_0004599 | 3300035242 | Bacteria | 3334 |
| 236 | Ga0316574_0398391 | 3300035398 | Bacteria | 867 |
| 237 | Ga0373931_0016193 | 3300035691 | Bacteria | 3666 |
| 238 | Ga0373947_0590685 | 3300035725 | Bacteria | 757 |
| 239 | Ga0316584_0024523 | 3300036712 | Bacteria | 4415 |
| 240 | Ga0373925_0326437 | 3300037068 | Bacteria | 1243 |
| 241 | Ga0395900_0200268 | 3300037418 | Bacteria | 2021 |
| 242 | Ga0395905_0131694 | 3300037471 | Bacteria | 2352 |
| 243 | Ga0439436_0141315 | 3300041404 | Bacteria | 677 |
| 244 | Ga0451853_1510120 | 3300041512 | Bacteria | 2711 |
| 245 | Ga0439435_0161820 | 3300042436 | Bacteria | 723 |
| 246 | Ga0466960_0611683 | 3300044901 | Unclassified | 648 |
| 247 | Ga0451576_0012707 | 3300045051 | Bacteria | 9452 |
| 248 | Ga0451576_1315855 | 3300045051 | Bacteria | 753 |
| 249 | Ga0451576_1870463 | 3300045051 | Bacteria | 620 |
| 250 | Ga0466967_0713225 | 3300045976 | Bacteria | 994 |
| 251 | Ga0495629_0179420 | 3300046459 | Bacteria | 1468 |
| 252 | Ga0495582_0313676 | 3300046473 | Bacteria | 902 |
| 253 | Ga0495594_0327569 | 3300046499 | Bacteria | 872 |
| 254 | Ga0495586_0241432 | 3300046535 | Unclassified | 1030 |
| 255 | Ga0495634_0288119 | 3300046642 | Bacteria | 996 |
| 256 | Ga0495635_0419802 | 3300046663 | Bacteria | 887 |
| 257 | Ga0495659_0362169 | 3300046664 | Bacteria | 621 |
| 258 | Ga0495659_0524034 | 3300046664 | Unclassified | 521 |
| 259 | Ga0495647_0021569 | 3300046681 | Bacteria | 2320 |
| 260 | Ga0495647_0431043 | 3300046681 | Bacteria | 608 |
| 261 | Ga0495647_0431793 | 3300046681 | Unclassified | 608 |
| 262 | Ga0495658_0035208 | 3300046683 | Bacteria | 2753 |
| 263 | Ga0495671_0458953 | 3300046692 | Bacteria | 609 |
| 264 | Ga0495674_0356885 | 3300047319 | Bacteria | 1186 |
| 265 | Ga0495684_0482823 | 3300047471 | Bacteria | 855 |
| 266 | Ga0496101_1335377 | 3300048904 | Bacteria | 560 |
| 267 | Ga0496104_0049740 | 3300048907 | Bacteria | 3953 |
| 268 | Ga0496107_0096408 | 3300048910 | Bacteria | 2165 |
| 269 | Ga0496108_0021323 | 3300048911 | Bacteria | 5325 |
| 270 | Ga0496109_0075692 | 3300048912 | Bacteria | 3095 |
| 271 | Ga0496111_0899453 | 3300048914 | Bacteria | 637 |
| 272 | Ga0496112_0019555 | 3300048915 | Bacteria | 6394 |
| 273 | Ga0496113_0340728 | 3300048916 | Bacteria | 1202 |
| 274 | Ga0496116_0000008 | 3300048919 | Bacteria | 726753 |
| 275 | Ga0496121_0000012 | 3300048924 | Bacteria | 653131 |
| 276 | Ga0496126_0366918 | 3300048929 | Bacteria | 1175 |
| 277 | Ga0501031_0301993 | 3300049568 | Bacteria | 1037 |
| 278 | Ga0501036_0103730 | 3300049572 | Bacteria | 2405 |
| 279 | Ga0501040_0106898 | 3300049576 | Bacteria | 1955 |
| 280 | Ga0501041_0168398 | 3300049577 | Bacteria | 1370 |
| 281 | Ga0501068_0852716 | 3300049584 | Bacteria | 598 |
| 282 | Ga0501072_0139290 | 3300049588 | Bacteria | 1934 |
| 283 | Ga0501076_0394031 | 3300049592 | Bacteria | 1138 |
| 284 | Ga0501079_0376093 | 3300049741 | Bacteria | 1114 |
| 285 | Ga0501080_0269138 | 3300049742 | Bacteria | 1551 |
| 286 | Ga0501081_0017289 | 3300049743 | Bacteria | 4771 |
| 287 | nmdc:mga0yw44_51176_c1 | 3300050492 | Bacteria | 2500 |
| 288 | nmdc:mga05p37_1351935_c1 | 3300050507 | Bacteria | 722 |
| 289 | nmdc:mga05p37_183607_c1 | 3300050507 | Bacteria | 2544 |
| 290 | nmdc:mga05p37_325846_c1 | 3300050507 | Bacteria | 1816 |
| 291 | nmdc:mga05p37_334900_c1 | 3300050507 | Bacteria | 1786 |
| 292 | nmdc:mga05p37_4371_c1 | 3300050507 | Bacteria | 16503 |
| 293 | nmdc:mga05p37_552838_c1 | 3300050507 | Bacteria | 1310 |
| 294 | nmdc:mga05p37_84957_c1 | 3300050507 | Bacteria | 3899 |
| 295 | nmdc:mga09592_11223_c1 | 3300050508 | Bacteria | 7290 |
| 296 | nmdc:mga0qj67_1195667_c1 | 3300050509 | Unclassified | 592 |
| 297 | nmdc:mga0qj67_31455_c1 | 3300050509 | Bacteria | 4133 |
| 298 | nmdc:mga06r32_16884_c1 | 3300050510 | Bacteria | 6659 |
| 299 | nmdc:mga06r32_199164_c1 | 3300050510 | Bacteria | 1991 |
| 300 | nmdc:mga08y16_3332_c1 | 3300050511 | Bacteria | 16637 |
| 301 | nmdc:mga08y16_74686_c1 | 3300050511 | Bacteria | 3533 |
| 302 | nmdc:mga08y16_7530_c1 | 3300050511 | Bacteria | 11402 |
| 303 | nmdc:mga0n895_1197340_c1 | 3300050512 | Bacteria | 734 |
| 304 | nmdc:mga0n895_1417_c1 | 3300050512 | Bacteria | 17917 |
| 305 | nmdc:mga0n895_64766_c1 | 3300050512 | Bacteria | 3616 |
| 306 | nmdc:mga0rr50_32369_c1 | 3300050513 | Bacteria | 3725 |
| 307 | nmdc:mga0rr50_5496_c1 | 3300050513 | Bacteria | 7568 |
| 308 | nmdc:mga08x19_300806_c1 | 3300050514 | Bacteria | 1114 |
| 309 | nmdc:mga0a205_34690_c1 | 3300050515 | Bacteria | 4841 |
| 310 | nmdc:mga0a205_426215_c1 | 3300050515 | Bacteria | 1188 |
| 311 | nmdc:mga0a205_670_c1 | 3300050515 | Bacteria | 27277 |
| 312 | Ga0495619_0486820 | 3300053085 | Unclassified | 849 |
| 313 | Ga0495619_0738293 | 3300053085 | Bacteria | 668 |
| 314 | Ga0501084_0114202 | 3300054114 | Bacteria | 2270 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_10471428 | Ga0114129_104714282 | 106 |
| 2 | 3300050507 | nmdc:mga05p37_334900_c1 | nmdc:mga05p37_334900_c1_480_869 | 106 |
| 3 | 3300005340 | Ga0070689_100409901 | Ga0070689_1004099012 | 107 |
| 4 | 3300005365 | Ga0070688_100028387 | Ga0070688_1000283872 | 107 |
| 5 | 3300005618 | Ga0068864_101022756 | Ga0068864_1010227562 | 107 |
| 6 | 3300009094 | Ga0111539_10171380 | Ga0111539_101713802 | 107 |
| 7 | 3300025936 | Ga0207670_10258977 | Ga0207670_102589772 | 107 |
| 8 | 3300005440 | Ga0070705_100738117 | Ga0070705_1007381172 | 113 |
| 9 | 3300005546 | Ga0070696_100442657 | Ga0070696_1004426571 | 113 |
| 10 | 3300026116 | Ga0207674_10734240 | Ga0207674_107342402 | 113 |
| 11 | 3300036712 | Ga0316584_0024523 | Ga0316584_0024523_2046_2396 | 113 |
| 12 | 3300009147 | Ga0114129_10598679 | Ga0114129_105986792 | 114 |
| 13 | 3300050507 | nmdc:mga05p37_552838_c1 | nmdc:mga05p37_552838_c1_140_508 | 114 |
| 14 | iso_pu_bacteria | 2643221588 | 2643951113 | 115 |
| 15 | 3300026075 | Ga0207708_10294022 | Ga0207708_102940222 | 116 |
| 16 | 3300005844 | Ga0068862_101223587 | Ga0068862_1012235872 | 117 |
| 17 | 3300009553 | Ga0105249_10756261 | Ga0105249_107562612 | 117 |
| 18 | 3300025940 | Ga0207691_11576606 | Ga0207691_115766062 | 117 |
| 19 | 3300025961 | Ga0207712_10164147 | Ga0207712_101641472 | 117 |
| 20 | 3300028380 | Ga0268265_10155591 | Ga0268265_101555912 | 117 |
| 21 | 3300009174 | Ga0105241_11346217 | Ga0105241_113462171 | 118 |
| 22 | 3300031727 | Ga0316576_10098058 | Ga0316576_100980582 | 118 |
| 23 | 3300037471 | Ga0395905_0131694 | Ga0395905_0131694_596_976 | 118 |
| 24 | 3300046535 | Ga0495586_0241432 | Ga0495586_0241432_250_609 | 118 |
| 25 | 3300048919 | Ga0496116_0000008 | Ga0496116_0000008_468283_468654 | 118 |
| 26 | 3300048924 | Ga0496121_0000012 | Ga0496121_0000012_247098_247469 | 118 |
| 27 | 3300048929 | Ga0496126_0366918 | Ga0496126_0366918_285_656 | 118 |
| 28 | 3300050492 | nmdc:mga0yw44_51176_c1 | nmdc:mga0yw44_51176_c1_1152_1514 | 118 |
| 29 | 3300050507 | nmdc:mga05p37_325846_c1 | nmdc:mga05p37_325846_c1_1147_1551 | 118 |
| 30 | 3300005328 | Ga0070676_11220812 | Ga0070676_112208122 | 119 |
| 31 | 3300005335 | Ga0070666_10219665 | Ga0070666_102196652 | 119 |
| 32 | 3300005338 | Ga0068868_100437536 | Ga0068868_1004375362 | 119 |
| 33 | 3300005459 | Ga0068867_100498412 | Ga0068867_1004984122 | 119 |
| 34 | 3300005459 | Ga0068867_100700124 | Ga0068867_1007001241 | 119 |
| 35 | 3300005544 | Ga0070686_100756042 | Ga0070686_1007560421 | 119 |
| 36 | 3300005578 | Ga0068854_100006245 | Ga0068854_1000062457 | 119 |
| 37 | 3300005616 | Ga0068852_100609255 | Ga0068852_1006092552 | 119 |
| 38 | 3300005718 | Ga0068866_10018483 | Ga0068866_100184833 | 119 |
| 39 | 3300005719 | Ga0068861_101386623 | Ga0068861_1013866232 | 119 |
| 40 | 3300006058 | Ga0075432_10303132 | Ga0075432_103031321 | 119 |
| 41 | 3300006237 | Ga0097621_100232331 | Ga0097621_1002323312 | 119 |
| 42 | 3300006358 | Ga0068871_100028855 | Ga0068871_1000288553 | 119 |
| 43 | 3300006847 | Ga0075431_100014651 | Ga0075431_10001465113 | 119 |
| 44 | 3300006881 | Ga0068865_100054384 | Ga0068865_1000543842 | 119 |
| 45 | 3300009098 | Ga0105245_10541644 | Ga0105245_105416442 | 119 |
| 46 | 3300009148 | Ga0105243_10878435 | Ga0105243_108784352 | 119 |
| 47 | 3300009176 | Ga0105242_10001709 | Ga0105242_1000170917 | 119 |
| 48 | 3300009177 | Ga0105248_10318929 | Ga0105248_103189292 | 119 |
| 49 | 3300013297 | Ga0157378_10386098 | Ga0157378_103860982 | 119 |
| 50 | 3300014326 | Ga0157380_10383038 | Ga0157380_103830383 | 119 |
| 51 | 3300014969 | Ga0157376_10151427 | Ga0157376_101514272 | 119 |
| 52 | 3300025899 | Ga0207642_10117920 | Ga0207642_101179202 | 119 |
| 53 | 3300025899 | Ga0207642_10667906 | Ga0207642_106679061 | 119 |
| 54 | 3300025923 | Ga0207681_10031852 | Ga0207681_100318525 | 119 |
| 55 | 3300025934 | Ga0207686_10124584 | Ga0207686_101245842 | 119 |
| 56 | 3300025938 | Ga0207704_10246879 | Ga0207704_102468791 | 119 |
| 57 | 3300025981 | Ga0207640_10007509 | Ga0207640_100075093 | 119 |
| 58 | 3300026023 | Ga0207677_10478128 | Ga0207677_104781282 | 119 |
| 59 | 3300026023 | Ga0207677_11058804 | Ga0207677_110588041 | 119 |
| 60 | 3300026089 | Ga0207648_10421942 | Ga0207648_104219421 | 119 |
| 61 | 3300026118 | Ga0207675_101764016 | Ga0207675_1017640162 | 119 |
| 62 | 3300027907 | Ga0207428_10001962 | Ga0207428_1000196224 | 119 |
| 63 | 3300031249 | Ga0265339_10255332 | Ga0265339_102553322 | 119 |
| 64 | 3300031727 | Ga0316576_10931084 | Ga0316576_109310841 | 119 |
| 65 | 3300031728 | Ga0316578_10096020 | Ga0316578_100960202 | 119 |
| 66 | 3300035398 | Ga0316574_0398391 | Ga0316574_0398391_38_436 | 119 |
| 67 | 3300041404 | Ga0439436_0141315 | Ga0439436_0141315_157_522 | 119 |
| 68 | 3300042436 | Ga0439435_0161820 | Ga0439435_0161820_21_380 | 119 |
| 69 | 3300046664 | Ga0495659_0362169 | Ga0495659_0362169_232_591 | 119 |
| 70 | 3300049568 | Ga0501031_0301993 | Ga0501031_0301993_641_1000 | 119 |
| 71 | 3300049572 | Ga0501036_0103730 | Ga0501036_0103730_972_1331 | 119 |
| 72 | 3300049576 | Ga0501040_0106898 | Ga0501040_0106898_1169_1528 | 119 |
| 73 | 3300049577 | Ga0501041_0168398 | Ga0501041_0168398_519_878 | 119 |
| 74 | 3300049584 | Ga0501068_0852716 | Ga0501068_0852716_104_463 | 119 |
| 75 | 3300049588 | Ga0501072_0139290 | Ga0501072_0139290_1085_1444 | 119 |
| 76 | 3300049592 | Ga0501076_0394031 | Ga0501076_0394031_307_666 | 119 |
| 77 | 3300049741 | Ga0501079_0376093 | Ga0501079_0376093_219_578 | 119 |
| 78 | 3300049742 | Ga0501080_0269138 | Ga0501080_0269138_1114_1473 | 119 |
| 79 | 3300049743 | Ga0501081_0017289 | Ga0501081_0017289_4060_4419 | 119 |
| 80 | 3300050509 | nmdc:mga0qj67_31455_c1 | nmdc:mga0qj67_31455_c1_1869_2228 | 119 |
| 81 | 3300050510 | nmdc:mga06r32_16884_c1 | nmdc:mga06r32_16884_c1_5245_5604 | 119 |
| 82 | 3300053085 | Ga0495619_0486820 | Ga0495619_0486820_450_809 | 119 |
| 83 | 3300054114 | Ga0501084_0114202 | Ga0501084_0114202_1195_1554 | 119 |
| 84 | 3300005334 | Ga0068869_100043445 | Ga0068869_1000434453 | 120 |
| 85 | 3300005334 | Ga0068869_100161984 | Ga0068869_1001619842 | 120 |
| 86 | 3300005353 | Ga0070669_100431335 | Ga0070669_1004313351 | 120 |
| 87 | 3300005354 | Ga0070675_100621504 | Ga0070675_1006215041 | 120 |
| 88 | 3300005354 | Ga0070675_100728996 | Ga0070675_1007289962 | 120 |
| 89 | 3300005364 | Ga0070673_101299297 | Ga0070673_1012992972 | 120 |
| 90 | 3300005441 | Ga0070700_100111304 | Ga0070700_1001113042 | 120 |
| 91 | 3300005441 | Ga0070700_101657680 | Ga0070700_1016576802 | 120 |
| 92 | 3300005458 | Ga0070681_11112631 | Ga0070681_111126312 | 120 |
| 93 | 3300005546 | Ga0070696_101104535 | Ga0070696_1011045351 | 120 |
| 94 | 3300005549 | Ga0070704_100452353 | Ga0070704_1004523532 | 120 |
| 95 | 3300005616 | Ga0068852_100715649 | Ga0068852_1007156492 | 120 |
| 96 | 3300005719 | Ga0068861_100159029 | Ga0068861_1001590291 | 120 |
| 97 | 3300005719 | Ga0068861_101852974 | Ga0068861_1018529742 | 120 |
| 98 | 3300006852 | Ga0075433_10005477 | Ga0075433_100054771 | 120 |
| 99 | 3300006852 | Ga0075433_10128596 | Ga0075433_101285964 | 120 |
| 100 | 3300006871 | Ga0075434_100000111 | Ga0075434_10000011114 | 120 |
| 101 | 3300006871 | Ga0075434_100052052 | Ga0075434_1000520522 | 120 |
| 102 | 3300006871 | Ga0075434_102166387 | Ga0075434_1021663871 | 120 |
| 103 | 3300006880 | Ga0075429_100990651 | Ga0075429_1009906512 | 120 |
| 104 | 3300007076 | Ga0075435_100115632 | Ga0075435_1001156322 | 120 |
| 105 | 3300009094 | Ga0111539_10005517 | Ga0111539_1000551715 | 120 |
| 106 | 3300009094 | Ga0111539_10007638 | Ga0111539_100076381 | 120 |
| 107 | 3300009094 | Ga0111539_10207172 | Ga0111539_102071722 | 120 |
| 108 | 3300009147 | Ga0114129_10009269 | Ga0114129_1000926919 | 120 |
| 109 | 3300009147 | Ga0114129_10059640 | Ga0114129_100596404 | 120 |
| 110 | 3300009177 | Ga0105248_10021387 | Ga0105248_100213873 | 120 |
| 111 | 3300009177 | Ga0105248_10178533 | Ga0105248_101785333 | 120 |
| 112 | 3300009177 | Ga0105248_11486278 | Ga0105248_114862781 | 120 |
| 113 | 3300014969 | Ga0157376_10205766 | Ga0157376_102057663 | 120 |
| 114 | 3300025903 | Ga0207680_10454081 | Ga0207680_104540812 | 120 |
| 115 | 3300025903 | Ga0207680_10712591 | Ga0207680_107125911 | 120 |
| 116 | 3300025926 | Ga0207659_10453838 | Ga0207659_104538381 | 120 |
| 117 | 3300025932 | Ga0207690_10434730 | Ga0207690_104347302 | 120 |
| 118 | 3300025941 | Ga0207711_10107824 | Ga0207711_101078243 | 120 |
| 119 | 3300025942 | Ga0207689_10066242 | Ga0207689_100662423 | 120 |
| 120 | 3300025945 | Ga0207679_12155703 | Ga0207679_121557032 | 120 |
| 121 | 3300026075 | Ga0207708_11599999 | Ga0207708_115999992 | 120 |
| 122 | 3300026118 | Ga0207675_100081783 | Ga0207675_1000817831 | 120 |
| 123 | 3300026118 | Ga0207675_100127871 | Ga0207675_1001278713 | 120 |
| 124 | 3300026142 | Ga0207698_10832890 | Ga0207698_108328902 | 120 |
| 125 | 3300027360 | Ga0209969_1066445 | Ga0209969_10664451 | 120 |
| 126 | 3300027526 | Ga0209968_1055625 | Ga0209968_10556252 | 120 |
| 127 | 3300027907 | Ga0207428_10394634 | Ga0207428_103946342 | 120 |
| 128 | 3300027907 | Ga0207428_10553107 | Ga0207428_105531072 | 120 |
| 129 | 3300031727 | Ga0316576_10810978 | Ga0316576_108109782 | 120 |
| 130 | 3300031995 | Ga0307409_101118903 | Ga0307409_1011189031 | 120 |
| 131 | 3300035089 | Ga0373944_0283474 | Ga0373944_0283474_47_409 | 120 |
| 132 | 3300035171 | Ga0373946_0418495 | Ga0373946_0418495_127_492 | 120 |
| 133 | 3300035725 | Ga0373947_0590685 | Ga0373947_0590685_180_542 | 120 |
| 134 | 3300037068 | Ga0373925_0326437 | Ga0373925_0326437_574_936 | 120 |
| 135 | 3300037418 | Ga0395900_0200268 | Ga0395900_0200268_1502_1864 | 120 |
| 136 | 3300044901 | Ga0466960_0611683 | Ga0466960_0611683_229_591 | 120 |
| 137 | 3300045051 | Ga0451576_1315855 | Ga0451576_1315855_13_375 | 120 |
| 138 | 3300045976 | Ga0466967_0713225 | Ga0466967_0713225_555_932 | 120 |
| 139 | 3300046459 | Ga0495629_0179420 | Ga0495629_0179420_1010_1372 | 120 |
| 140 | 3300046473 | Ga0495582_0313676 | Ga0495582_0313676_255_617 | 120 |
| 141 | 3300046499 | Ga0495594_0327569 | Ga0495594_0327569_463_825 | 120 |
| 142 | 3300046664 | Ga0495659_0524034 | Ga0495659_0524034_80_448 | 120 |
| 143 | 3300046681 | Ga0495647_0021569 | Ga0495647_0021569_136_498 | 120 |
| 144 | 3300046683 | Ga0495658_0035208 | Ga0495658_0035208_1148_1510 | 120 |
| 145 | 3300046692 | Ga0495671_0458953 | Ga0495671_0458953_24_386 | 120 |
| 146 | 3300050507 | nmdc:mga05p37_4371_c1 | nmdc:mga05p37_4371_c1_8385_8747 | 120 |
| 147 | 3300050507 | nmdc:mga05p37_84957_c1 | nmdc:mga05p37_84957_c1_2976_3338 | 120 |
| 148 | 3300050511 | nmdc:mga08y16_74686_c1 | nmdc:mga08y16_74686_c1_137_502 | 120 |
| 149 | 3300050511 | nmdc:mga08y16_7530_c1 | nmdc:mga08y16_7530_c1_1079_1441 | 120 |
| 150 | 3300050512 | nmdc:mga0n895_1197340_c1 | nmdc:mga0n895_1197340_c1_227_592 | 120 |
| 151 | 3300050512 | nmdc:mga0n895_1417_c1 | nmdc:mga0n895_1417_c1_3203_3565 | 120 |
| 152 | 3300050513 | nmdc:mga0rr50_32369_c1 | nmdc:mga0rr50_32369_c1_610_972 | 120 |
| 153 | 3300050515 | nmdc:mga0a205_34690_c1 | nmdc:mga0a205_34690_c1_1399_1761 | 120 |
| 154 | 3300050515 | nmdc:mga0a205_670_c1 | nmdc:mga0a205_670_c1_8218_8580 | 120 |
| 155 | 3300005328 | Ga0070676_10008377 | Ga0070676_100083777 | 121 |
| 156 | 3300005331 | Ga0070670_100004141 | Ga0070670_1000041412 | 121 |
| 157 | 3300005333 | Ga0070677_10060218 | Ga0070677_100602182 | 121 |
| 158 | 3300005333 | Ga0070677_10423330 | Ga0070677_104233302 | 121 |
| 159 | 3300005334 | Ga0068869_100022305 | Ga0068869_1000223056 | 121 |
| 160 | 3300005335 | Ga0070666_11398224 | Ga0070666_113982241 | 121 |
| 161 | 3300005338 | Ga0068868_100219293 | Ga0068868_1002192932 | 121 |
| 162 | 3300005343 | Ga0070687_100155763 | Ga0070687_1001557632 | 121 |
| 163 | 3300005344 | Ga0070661_100476828 | Ga0070661_1004768282 | 121 |
| 164 | 3300005344 | Ga0070661_101060619 | Ga0070661_1010606191 | 121 |
| 165 | 3300005354 | Ga0070675_100001994 | Ga0070675_1000019943 | 121 |
| 166 | 3300005354 | Ga0070675_100108584 | Ga0070675_1001085842 | 121 |
| 167 | 3300005355 | Ga0070671_100018769 | Ga0070671_1000187694 | 121 |
| 168 | 3300005356 | Ga0070674_100089513 | Ga0070674_1000895132 | 121 |
| 169 | 3300005356 | Ga0070674_100324898 | Ga0070674_1003248982 | 121 |
| 170 | 3300005364 | Ga0070673_100013186 | Ga0070673_1000131866 | 121 |
| 171 | 3300005364 | Ga0070673_100107543 | Ga0070673_1001075432 | 121 |
| 172 | 3300005441 | Ga0070700_100002609 | Ga0070700_1000026097 | 121 |
| 173 | 3300005456 | Ga0070678_100075523 | Ga0070678_1000755233 | 121 |
| 174 | 3300005459 | Ga0068867_100000456 | Ga0068867_10000045613 | 121 |
| 175 | 3300005466 | Ga0070685_11041481 | Ga0070685_110414812 | 121 |
| 176 | 3300005564 | Ga0070664_100299917 | Ga0070664_1002999172 | 121 |
| 177 | 3300005564 | Ga0070664_100642626 | Ga0070664_1006426262 | 121 |
| 178 | 3300005615 | Ga0070702_100205837 | Ga0070702_1002058372 | 121 |
| 179 | 3300005617 | Ga0068859_102743521 | Ga0068859_1027435211 | 121 |
| 180 | 3300005618 | Ga0068864_100451202 | Ga0068864_1004512022 | 121 |
| 181 | 3300005718 | Ga0068866_10033873 | Ga0068866_100338732 | 121 |
| 182 | 3300005719 | Ga0068861_100100016 | Ga0068861_1001000162 | 121 |
| 183 | 3300005834 | Ga0068851_10027302 | Ga0068851_100273022 | 121 |
| 184 | 3300005840 | Ga0068870_10364694 | Ga0068870_103646942 | 121 |
| 185 | 3300005840 | Ga0068870_10493724 | Ga0068870_104937242 | 121 |
| 186 | 3300005840 | Ga0068870_10670093 | Ga0068870_106700932 | 121 |
| 187 | 3300005841 | Ga0068863_101096430 | Ga0068863_1010964302 | 121 |
| 188 | 3300005842 | Ga0068858_100542288 | Ga0068858_1005422883 | 121 |
| 189 | 3300005842 | Ga0068858_102039019 | Ga0068858_1020390191 | 121 |
| 190 | 3300005843 | Ga0068860_100274031 | Ga0068860_1002740312 | 121 |
| 191 | 3300005985 | Ga0081539_10143676 | Ga0081539_101436763 | 121 |
| 192 | 3300006237 | Ga0097621_101599250 | Ga0097621_1015992502 | 121 |
| 193 | 3300006871 | Ga0075434_100065708 | Ga0075434_1000657083 | 121 |
| 194 | 3300006881 | Ga0068865_100005360 | Ga0068865_1000053607 | 121 |
| 195 | 3300006931 | Ga0097620_102744718 | Ga0097620_1027447181 | 121 |
| 196 | 3300007076 | Ga0075435_100021136 | Ga0075435_1000211362 | 121 |
| 197 | 3300007788 | Ga0099795_10040465 | Ga0099795_100404652 | 121 |
| 198 | 3300009148 | Ga0105243_10077914 | Ga0105243_100779142 | 121 |
| 199 | 3300009176 | Ga0105242_10009038 | Ga0105242_100090384 | 121 |
| 200 | 3300009177 | Ga0105248_11353148 | Ga0105248_113531481 | 121 |
| 201 | 3300009177 | Ga0105248_11423401 | Ga0105248_114234012 | 121 |
| 202 | 3300009545 | Ga0105237_11665956 | Ga0105237_116659561 | 121 |
| 203 | 3300009551 | Ga0105238_10008566 | Ga0105238_100085669 | 121 |
| 204 | 3300009553 | Ga0105249_11289584 | Ga0105249_112895842 | 121 |
| 205 | 3300010159 | Ga0099796_10217396 | Ga0099796_102173962 | 121 |
| 206 | 3300011119 | Ga0105246_11017395 | Ga0105246_110173952 | 121 |
| 207 | 3300013297 | Ga0157378_10541280 | Ga0157378_105412802 | 121 |
| 208 | 3300013308 | Ga0157375_10785718 | Ga0157375_107857182 | 121 |
| 209 | 3300014325 | Ga0163163_10021891 | Ga0163163_100218917 | 121 |
| 210 | 3300014326 | Ga0157380_10009513 | Ga0157380_100095134 | 121 |
| 211 | 3300014326 | Ga0157380_10173437 | Ga0157380_101734373 | 121 |
| 212 | 3300014326 | Ga0157380_10203043 | Ga0157380_102030432 | 121 |
| 213 | 3300014745 | Ga0157377_10295590 | Ga0157377_102955902 | 121 |
| 214 | 3300014745 | Ga0157377_10492724 | Ga0157377_104927242 | 121 |
| 215 | 3300025321 | Ga0207656_10064145 | Ga0207656_100641452 | 121 |
| 216 | 3300025893 | Ga0207682_10103534 | Ga0207682_101035342 | 121 |
| 217 | 3300025899 | Ga0207642_10142506 | Ga0207642_101425062 | 121 |
| 218 | 3300025900 | Ga0207710_10047175 | Ga0207710_100471752 | 121 |
| 219 | 3300025903 | Ga0207680_10514688 | Ga0207680_105146882 | 121 |
| 220 | 3300025903 | Ga0207680_10541873 | Ga0207680_105418732 | 121 |
| 221 | 3300025907 | Ga0207645_10022014 | Ga0207645_100220143 | 121 |
| 222 | 3300025907 | Ga0207645_10525287 | Ga0207645_105252871 | 121 |
| 223 | 3300025908 | Ga0207643_10010780 | Ga0207643_100107803 | 121 |
| 224 | 3300025908 | Ga0207643_10033240 | Ga0207643_100332403 | 121 |
| 225 | 3300025913 | Ga0207695_10354709 | Ga0207695_103547091 | 121 |
| 226 | 3300025918 | Ga0207662_10176630 | Ga0207662_101766302 | 121 |
| 227 | 3300025918 | Ga0207662_10222526 | Ga0207662_102225262 | 121 |
| 228 | 3300025920 | Ga0207649_11205323 | Ga0207649_112053231 | 121 |
| 229 | 3300025923 | Ga0207681_10006840 | Ga0207681_100068402 | 121 |
| 230 | 3300025924 | Ga0207694_10014775 | Ga0207694_100147756 | 121 |
| 231 | 3300025924 | Ga0207694_10163152 | Ga0207694_101631522 | 121 |
| 232 | 3300025925 | Ga0207650_10008496 | Ga0207650_100084969 | 121 |
| 233 | 3300025926 | Ga0207659_10017594 | Ga0207659_100175942 | 121 |
| 234 | 3300025926 | Ga0207659_10037910 | Ga0207659_100379103 | 121 |
| 235 | 3300025933 | Ga0207706_10204344 | Ga0207706_102043442 | 121 |
| 236 | 3300025934 | Ga0207686_10006011 | Ga0207686_100060114 | 121 |
| 237 | 3300025934 | Ga0207686_10412909 | Ga0207686_104129092 | 121 |
| 238 | 3300025935 | Ga0207709_10039919 | Ga0207709_100399192 | 121 |
| 239 | 3300025937 | Ga0207669_10050682 | Ga0207669_100506822 | 121 |
| 240 | 3300025937 | Ga0207669_10991228 | Ga0207669_109912282 | 121 |
| 241 | 3300025938 | Ga0207704_10001077 | Ga0207704_100010777 | 121 |
| 242 | 3300025940 | Ga0207691_10024349 | Ga0207691_100243492 | 121 |
| 243 | 3300025941 | Ga0207711_10008147 | Ga0207711_100081472 | 121 |
| 244 | 3300025941 | Ga0207711_10358549 | Ga0207711_103585491 | 121 |
| 245 | 3300025941 | Ga0207711_10589762 | Ga0207711_105897622 | 121 |
| 246 | 3300025942 | Ga0207689_10000796 | Ga0207689_1000079625 | 121 |
| 247 | 3300025945 | Ga0207679_10382584 | Ga0207679_103825842 | 121 |
| 248 | 3300025949 | Ga0207667_10463147 | Ga0207667_104631472 | 121 |
| 249 | 3300025960 | Ga0207651_10007612 | Ga0207651_100076122 | 121 |
| 250 | 3300025960 | Ga0207651_10016934 | Ga0207651_100169343 | 121 |
| 251 | 3300025981 | Ga0207640_10136937 | Ga0207640_101369372 | 121 |
| 252 | 3300025981 | Ga0207640_10197613 | Ga0207640_101976132 | 121 |
| 253 | 3300025981 | Ga0207640_10316006 | Ga0207640_103160063 | 121 |
| 254 | 3300025981 | Ga0207640_10518979 | Ga0207640_105189792 | 121 |
| 255 | 3300026035 | Ga0207703_10049883 | Ga0207703_100498832 | 121 |
| 256 | 3300026035 | Ga0207703_10388849 | Ga0207703_103888492 | 121 |
| 257 | 3300026035 | Ga0207703_10412407 | Ga0207703_104124073 | 121 |
| 258 | 3300026067 | Ga0207678_10524456 | Ga0207678_105244561 | 121 |
| 259 | 3300026075 | Ga0207708_10007174 | Ga0207708_1000717411 | 121 |
| 260 | 3300026088 | Ga0207641_10817914 | Ga0207641_108179142 | 121 |
| 261 | 3300026089 | Ga0207648_10000077 | Ga0207648_1000007771 | 121 |
| 262 | 3300026095 | Ga0207676_10354338 | Ga0207676_103543382 | 121 |
| 263 | 3300026095 | Ga0207676_10415435 | Ga0207676_104154352 | 121 |
| 264 | 3300026118 | Ga0207675_100120986 | Ga0207675_1001209862 | 121 |
| 265 | 3300026118 | Ga0207675_100446513 | Ga0207675_1004465132 | 121 |
| 266 | 3300026121 | Ga0207683_10050276 | Ga0207683_100502763 | 121 |
| 267 | 3300026121 | Ga0207683_10224547 | Ga0207683_102245471 | 121 |
| 268 | 3300027907 | Ga0207428_10001495 | Ga0207428_1000149521 | 121 |
| 269 | 3300028381 | Ga0268264_10138542 | Ga0268264_101385422 | 121 |
| 270 | 3300028381 | Ga0268264_10155989 | Ga0268264_101559892 | 121 |
| 271 | 3300034817 | Ga0373948_0000326 | Ga0373948_0000326_1195_1560 | 121 |
| 272 | 3300034820 | Ga0373959_0001480 | Ga0373959_0001480_2998_3363 | 121 |
| 273 | 3300034957 | Ga0373938_0000842 | Ga0373938_0000842_390_755 | 121 |
| 274 | 3300035084 | Ga0373928_0001434 | Ga0373928_0001434_560_925 | 121 |
| 275 | 3300035085 | Ga0373929_0001509 | Ga0373929_0001509_2750_3115 | 121 |
| 276 | 3300035088 | Ga0373940_0000163 | Ga0373940_0000163_1149_1514 | 121 |
| 277 | 3300035090 | Ga0373949_0002817 | Ga0373949_0002817_3655_4020 | 121 |
| 278 | 3300035091 | Ga0373951_0002196 | Ga0373951_0002196_4079_4444 | 121 |
| 279 | 3300035092 | Ga0373952_0000063 | Ga0373952_0000063_1632_1997 | 121 |
| 280 | 3300035112 | Ga0373932_0006409 | Ga0373932_0006409_1136_1501 | 121 |
| 281 | 3300035114 | Ga0373939_0002345 | Ga0373939_0002345_2324_2689 | 121 |
| 282 | 3300035115 | Ga0373941_0000667 | Ga0373941_0000667_5088_5453 | 121 |
| 283 | 3300035121 | Ga0373960_0001427 | Ga0373960_0001427_3808_4173 | 121 |
| 284 | 3300035207 | Ga0373942_0001136 | Ga0373942_0001136_5606_5971 | 121 |
| 285 | 3300035241 | Ga0373961_0006444 | Ga0373961_0006444_1219_1584 | 121 |
| 286 | 3300035242 | Ga0373962_0004599 | Ga0373962_0004599_1246_1611 | 121 |
| 287 | 3300035691 | Ga0373931_0016193 | Ga0373931_0016193_777_1142 | 121 |
| 288 | 3300041512 | Ga0451853_1510120 | Ga0451853_1510120_1891_2256 | 121 |
| 289 | 3300045051 | Ga0451576_0012707 | Ga0451576_0012707_702_1067 | 121 |
| 290 | 3300045051 | Ga0451576_1870463 | Ga0451576_1870463_154_522 | 121 |
| 291 | 3300046642 | Ga0495634_0288119 | Ga0495634_0288119_489_857 | 121 |
| 292 | 3300046663 | Ga0495635_0419802 | Ga0495635_0419802_51_482 | 121 |
| 293 | 3300046681 | Ga0495647_0431043 | Ga0495647_0431043_166_597 | 121 |
| 294 | 3300046681 | Ga0495647_0431793 | Ga0495647_0431793_16_384 | 121 |
| 295 | 3300047319 | Ga0495674_0356885 | Ga0495674_0356885_731_1099 | 121 |
| 296 | 3300047471 | Ga0495684_0482823 | Ga0495684_0482823_159_527 | 121 |
| 297 | 3300048904 | Ga0496101_1335377 | Ga0496101_1335377_97_462 | 121 |
| 298 | 3300048907 | Ga0496104_0049740 | Ga0496104_0049740_2088_2456 | 121 |
| 299 | 3300048910 | Ga0496107_0096408 | Ga0496107_0096408_194_562 | 121 |
| 300 | 3300048911 | Ga0496108_0021323 | Ga0496108_0021323_321_689 | 121 |
| 301 | 3300048912 | Ga0496109_0075692 | Ga0496109_0075692_267_635 | 121 |
| 302 | 3300048914 | Ga0496111_0899453 | Ga0496111_0899453_100_468 | 121 |
| 303 | 3300048915 | Ga0496112_0019555 | Ga0496112_0019555_902_1270 | 121 |
| 304 | 3300048916 | Ga0496113_0340728 | Ga0496113_0340728_659_1027 | 121 |
| 305 | 3300050507 | nmdc:mga05p37_1351935_c1 | nmdc:mga05p37_1351935_c1_277_645 | 121 |
| 306 | 3300050507 | nmdc:mga05p37_183607_c1 | nmdc:mga05p37_183607_c1_2099_2467 | 121 |
| 307 | 3300050508 | nmdc:mga09592_11223_c1 | nmdc:mga09592_11223_c1_97_465 | 121 |
| 308 | 3300050509 | nmdc:mga0qj67_1195667_c1 | nmdc:mga0qj67_1195667_c1_78_446 | 121 |
| 309 | 3300050510 | nmdc:mga06r32_199164_c1 | nmdc:mga06r32_199164_c1_1546_1914 | 121 |
| 310 | 3300050511 | nmdc:mga08y16_3332_c1 | nmdc:mga08y16_3332_c1_5461_5829 | 121 |
| 311 | 3300050512 | nmdc:mga0n895_64766_c1 | nmdc:mga0n895_64766_c1_846_1211 | 121 |
| 312 | 3300050513 | nmdc:mga0rr50_5496_c1 | nmdc:mga0rr50_5496_c1_2958_3323 | 121 |
| 313 | 3300050514 | nmdc:mga08x19_300806_c1 | nmdc:mga08x19_300806_c1_112_480 | 121 |
| 314 | 3300050515 | nmdc:mga0a205_426215_c1 | nmdc:mga0a205_426215_c1_236_604 | 121 |
| 315 | 3300053085 | Ga0495619_0738293 | Ga0495619_0738293_121_552 | 121 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p8n-assembly1.cif.gz_B | tmhydabc- t. maritima hydrogenase with bridge closed | 0.8668 | 20 | 115 |
| 7p92-assembly1.cif.gz_B | tmhydabc- t. maritima bifurcating hydrogenase with bridge domain up | 0.8652 | 17 | 112 |
| 8oh5-assembly1.cif.gz_B | cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) | 0.8553 | 21 | 117 |
| 7p5h-assembly1.cif.gz_b | tmhydabc- d2 map | 0.8549 | 17 | 112 |
| 7q4v-assembly1.cif.gz_B | electron bifurcating hydrogenase - hydabc from a. woodii | 0.8471 | 18 | 115 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5abrB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.792 | 19 | 115 | 3.40.30.10 |
| af_I1M6F2_186_285_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7594 | 20 | 114 | 3.40.30.10 |
| af_Q7XQA0_31_116_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.737 | 20 | 105 | 3.40.30.10 |
| 5abrB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7361 | 19 | 115 | 3.40.30.10 |
| 1m2dB00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7201 | 20 | 115 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1HFJ2-F1-model_v4 | Ferredoxin | 0.9531 | 35 | 121 |
|
| AF-A0A7V4H1E3-F1-model_v4 | Uncharacterized protein | 0.9417 | 37 | 121 |
|
| AF-A0A7W0FX34-F1-model_v4 | (2Fe-2S) ferredoxin domain-containing protein | 0.9392 | 4 | 117 |
|
| AF-A0A382NT38-F1-model_v4 | Ferredoxin | 0.9344 | 6 | 117 |
|
| AF-A0A518DNR2-F1-model_v4 | Ferredoxin, 2Fe-2S | 0.9339 | 7 | 121 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar