F403212

General Info

Members Datasets Scaffolds Average Seq Length
315 195 309 233

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10133657|Ga0207665_101336572
Length 265
Sequence MSGQDVRIKSSPDGEFAAYLATPASGRGPGLVVIQEIFGVNKVMRQIADEFAARGYFALAPDLFWRLEPGVQLTDRTDAEWKRAFDLMGRFDQDTGIKDIQTSINYLRHTVAGCTGKVGAVGYCLGGLLAFLTATRTDCDAAVGYYGVNIQDKLGEAAKLRKPLMLHIAAKDEYVPPEAQKKIVDGLKNNPLVTVHTYPEMNHAFARAGGAHYDKACADLANGHVKPSPPRGAGRRSTSVPAQCPDSDVRESLCEFRNQRDASNL

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
3 2643221583 Caulobacter sp. Root655 Isolate Unclassified
4 2643221584 Caulobacter sp. Root656 Isolate Unclassified
5 2818991435 Caulobacter henricii 536 Isolate Unclassified
6 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
97 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
100 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
151 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
187 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
188 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
189 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
190 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
191 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
192 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
193 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 0
Isolates 1.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.81
Nodule 0
Rhizoplane 1.59
Rhizosphere 88.57
Stem 0
Stem Tuber 0
Unclassified 6.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10020896 3300003322 Bacteria 2779
2 Ga0070683_100538511 3300005329 Bacteria 1116
3 Ga0070666_10000196 3300005335 Bacteria 41189
4 Ga0070680_100001064 3300005336 Bacteria 19679
5 Ga0070689_100376926 3300005340 Bacteria 1195
6 Ga0070691_10000339 3300005341 Bacteria 16574
7 Ga0070661_100001212 3300005344 Bacteria 18170
8 Ga0070674_100247194 3300005356 Bacteria 1399
9 Ga0070667_100009342 3300005367 Bacteria 8132
10 Ga0070709_10000408 3300005434 Bacteria 26266
11 Ga0070709_10014232 3300005434 Bacteria 4497
12 Ga0070714_100006162 3300005435 Bacteria 9221
13 Ga0070714_100353188 3300005435 Bacteria 1381
14 Ga0070713_100000333 3300005436 Bacteria 30842
15 Ga0070713_100033161 3300005436 Bacteria 4134
16 Ga0070713_100690922 3300005436 Bacteria 974
17 Ga0070710_10435069 3300005437 Bacteria 886
18 Ga0070711_100523590 3300005439 Bacteria 980
19 Ga0070663_100282450 3300005455 Bacteria 1323
20 Ga0070681_10000002 3300005458 Bacteria 821814
21 Ga0070681_10412143 3300005458 Bacteria 1263
22 Ga0070679_100001917 3300005530 Bacteria 18660
23 Ga0070684_100128685 3300005535 Bacteria 2283
24 Ga0068853_100000904 3300005539 Bacteria 20669
25 Ga0070695_100063839 3300005545 Bacteria 2395
26 Ga0070665_100077022 3300005548 Bacteria 3341
27 Ga0068855_100000106 3300005563 Bacteria 103864
28 Ga0070664_100813223 3300005564 Bacteria 874
29 Ga0068857_100001587 3300005577 Bacteria 18219
30 Ga0068854_100028475 3300005578 Bacteria 3861
31 Ga0068854_100685355 3300005578 Unclassified 883
32 Ga0068856_100000601 3300005614 Bacteria 39402
33 Ga0068856_100001518 3300005614 Bacteria 24335
34 Ga0068852_100046182 3300005616 Bacteria 3710
35 Ga0068852_100268642 3300005616 Bacteria 1640
36 Ga0068852_100337674 3300005616 Bacteria 1467
37 Ga0068859_100520107 3300005617 Bacteria 1285
38 Ga0068858_100216951 3300005842 Bacteria 1811
39 Ga0068860_100013072 3300005843 Bacteria 8148
40 Ga0068860_100210757 3300005843 Bacteria 1885
41 Ga0081539_10082540 3300005985 Bacteria 1684
42 Ga0070716_100033698 3300006173 Bacteria 2803
43 Ga0070712_100000023 3300006175 Bacteria 80972
44 Ga0070712_100000803 3300006175 Bacteria 18648
45 Ga0097621_100072189 3300006237 Bacteria 2855
46 Ga0075370_10117890 3300006353 Bacteria 1544
47 Ga0068871_100062297 3300006358 Bacteria 3048
48 Ga0075434_100056843 3300006871 Bacteria 3889
49 Ga0075436_100000211 3300006914 Bacteria 36106
50 Ga0075436_100006135 3300006914 Bacteria 8254
51 Ga0075436_100102365 3300006914 Bacteria 1995
52 Ga0097620_100519992 3300006931 Bacteria 1285
53 Ga0075435_100002305 3300007076 Bacteria 12619
54 Ga0075435_100087640 3300007076 Bacteria 2565
55 Ga0105240_10000653 3300009093 Bacteria 63948
56 Ga0105240_10042023 3300009093 Bacteria 5828
57 Ga0105240_10119371 3300009093 Bacteria 3176
58 Ga0105240_10934768 3300009093 Bacteria 931
59 Ga0105241_10014169 3300009174 Bacteria 5842
60 Ga0105242_10008803 3300009176 Bacteria 7744
61 Ga0105242_10218957 3300009176 Bacteria 1700
62 Ga0105248_10000001 3300009177 Bacteria 1881304
63 Ga0105248_10019614 3300009177 Bacteria 7484
64 Ga0105237_10030554 3300009545 Bacteria 5470
65 Ga0105237_10171638 3300009545 Bacteria 2169
66 Ga0105238_10006744 3300009551 Bacteria 11467
67 Ga0105238_10055471 3300009551 Bacteria 3977
68 Ga0105239_10001093 3300010375 Bacteria 37498
69 Ga0105239_10009490 3300010375 Bacteria 10958
70 Ga0105239_10075543 3300010375 Bacteria 3705
71 Ga0157373_10001642 3300013100 Bacteria 17076
72 Ga0157370_10012463 3300013104 Bacteria 8814
73 Ga0157370_10584141 3300013104 Bacteria 1023
74 Ga0157369_10014455 3300013105 Bacteria 8911
75 Ga0157369_10084124 3300013105 Bacteria 3401
76 Ga0157369_10114415 3300013105 Bacteria 2865
77 Ga0157378_10600975 3300013297 Bacteria 1111
78 Ga0163162_10680218 3300013306 Bacteria 1151
79 Ga0163162_10916763 3300013306 Bacteria 989
80 Ga0157372_10004309 3300013307 Bacteria 15209
81 Ga0157372_10021146 3300013307 Bacteria 7027
82 Ga0157372_10048127 3300013307 Bacteria 4739
83 Ga0157372_10121683 3300013307 Bacteria 2998
84 Ga0157372_10519575 3300013307 Bacteria 1388
85 Ga0157380_10115753 3300014326 Bacteria 2262
86 Ga0157379_10008855 3300014968 Bacteria 8774
87 Ga0157379_10009508 3300014968 Bacteria 8466
88 Ga0213874_10046680 3300021377 Bacteria 1315
89 Ga0213876_10000243 3300021384 Bacteria 52043
90 Ga0213876_10038503 3300021384 Bacteria 2524
91 Ga0213876_10354510 3300021384 Bacteria 780
92 Ga0213871_10027877 3300021441 Unclassified 1454
93 Ga0209050_1007846 3300025298 Bacteria 5863
94 Ga0207692_10427533 3300025898 Bacteria 830
95 Ga0207680_10001529 3300025903 Bacteria 10892
96 Ga0207699_10000280 3300025906 Bacteria 27852
97 Ga0207699_10099142 3300025906 Bacteria 1845
98 Ga0207654_10031535 3300025911 Bacteria 2920
99 Ga0207654_10174639 3300025911 Bacteria 1398
100 Ga0207707_10000002 3300025912 Bacteria 1142054
101 Ga0207695_10000012 3300025913 Bacteria 840961
102 Ga0207695_10107929 3300025913 Bacteria 2769
103 Ga0207695_10600948 3300025913 Bacteria 981
104 Ga0207693_10000018 3300025915 Bacteria 138365
105 Ga0207693_10000534 3300025915 Bacteria 34415
106 Ga0207663_10019060 3300025916 Bacteria 3857
107 Ga0207660_10002350 3300025917 Bacteria 12453
108 Ga0207660_10279848 3300025917 Bacteria 1324
109 Ga0207649_10000026 3300025920 Bacteria 177395
110 Ga0207649_10223396 3300025920 Bacteria 1343
111 Ga0207652_10000052 3300025921 Bacteria 119002
112 Ga0207652_10183281 3300025921 Bacteria 1882
113 Ga0207694_10000006 3300025924 Bacteria 631109
114 Ga0207700_10000026 3300025928 Bacteria 139690
115 Ga0207700_10198883 3300025928 Bacteria 1688
116 Ga0207664_10055790 3300025929 Bacteria 3136
117 Ga0207690_10422970 3300025932 Bacteria 1066
118 Ga0207709_10500723 3300025935 Bacteria 948
119 Ga0207665_10133657 3300025939 Bacteria 1763
120 Ga0207665_10223562 3300025939 Bacteria 1381
121 Ga0207711_10000001 3300025941 Bacteria 1325674
122 Ga0207711_10085430 3300025941 Bacteria 2765
123 Ga0207667_10000232 3300025949 Bacteria 77277
124 Ga0207667_10106293 3300025949 Bacteria 2895
125 Ga0207658_10497375 3300025986 Bacteria 1085
126 Ga0207703_10192929 3300026035 Bacteria 1806
127 Ga0207639_10010285 3300026041 Bacteria 6476
128 Ga0207639_10122370 3300026041 Bacteria 2139
129 Ga0207678_10203895 3300026067 Bacteria 1691
130 Ga0207702_10000021 3300026078 Bacteria 196115
131 Ga0207702_10001285 3300026078 Bacteria 25172
132 Ga0207702_10328294 3300026078 Unclassified 1459
133 Ga0207674_10000134 3300026116 Bacteria 86377
134 Ga0207698_10012717 3300026142 Bacteria 5522
135 Ga0207698_10104748 3300026142 Bacteria 2355
136 Ga0207698_10140812 3300026142 Bacteria 2078
137 Ga0207428_10359546 3300027907 Bacteria 1070
138 Ga0268266_10558484 3300028379 Bacteria 1097
139 Ga0268265_10405105 3300028380 Bacteria 1262
140 Ga0268264_10057058 3300028381 Bacteria 3265
141 Ga0268264_10149590 3300028381 Bacteria 2092
142 Ga0268264_10742926 3300028381 Bacteria 977
143 Ga0265334_10006845 3300028573 Bacteria 4896
144 Ga0265318_10000364 3300028577 Bacteria 35727
145 Ga0265338_10000011 3300028800 Bacteria 433370
146 Ga0265338_10040105 3300028800 Bacteria 4403
147 Ga0265338_10130086 3300028800 Bacteria 1990
148 Ga0265338_10478220 3300028800 Bacteria 879
149 Ga0265330_10006116 3300031235 Bacteria 5961
150 Ga0265330_10094192 3300031235 Bacteria 1284
151 Ga0265330_10111406 3300031235 Bacteria 1169
152 Ga0265332_10012108 3300031238 Bacteria 3827
153 Ga0265320_10019132 3300031240 Bacteria 3752
154 Ga0265325_10000009 3300031241 Bacteria 184273
155 Ga0265325_10000365 3300031241 Bacteria 31743
156 Ga0265329_10013098 3300031242 Bacteria 2965
157 Ga0265340_10000018 3300031247 Bacteria 90851
158 Ga0265340_10012022 3300031247 Bacteria 4577
159 Ga0265340_10013717 3300031247 Bacteria 4250
160 Ga0265339_10000376 3300031249 Bacteria 35061
161 Ga0265339_10006173 3300031249 Bacteria 7895
162 Ga0265339_10033858 3300031249 Bacteria 2874
163 Ga0265339_10075899 3300031249 Bacteria 1784
164 Ga0265331_10000008 3300031250 Bacteria 324311
165 Ga0265331_10000067 3300031250 Bacteria 158073
166 Ga0265331_10014580 3300031250 Bacteria 4177
167 Ga0265331_10028534 3300031250 Bacteria 2790
168 Ga0265327_10000036 3300031251 Bacteria 312827
169 Ga0265327_10026001 3300031251 Bacteria 3399
170 Ga0265316_10028831 3300031344 Bacteria 4573
171 Ga0265316_10038462 3300031344 Bacteria 3854
172 Ga0265316_10041943 3300031344 Bacteria 3659
173 Ga0265316_10067244 3300031344 Bacteria 2771
174 Ga0265316_10155288 3300031344 Bacteria 1713
175 Ga0265316_10209312 3300031344 Bacteria 1443
176 Ga0265316_10329231 3300031344 Unclassified 1108
177 Ga0265313_10012587 3300031595 Bacteria 5149
178 Ga0265313_10032892 3300031595 Bacteria 2642
179 Ga0265313_10104428 3300031595 Bacteria 1253
180 Ga0265313_10173301 3300031595 Bacteria 910
181 Ga0265314_10013871 3300031711 Bacteria 6486
182 Ga0265314_10082275 3300031711 Bacteria 2118
183 Ga0265314_10161679 3300031711 Unclassified 1362
184 Ga0265314_10175798 3300031711 Bacteria 1288
185 Ga0265342_10004869 3300031712 Bacteria 10396
186 Ga0307516_10108247 3300031730 Bacteria 2587
187 Ga0373923_0150034 3300035111 Bacteria 1058
188 Ga0373956_0016666 3300035119 Bacteria 3088
189 Ga0316574_0028704 3300035398 Bacteria 3357
190 Ga0373931_0021725 3300035691 Bacteria 3222
191 Ga0373931_0285363 3300035691 Bacteria 1015
192 Ga0373935_0062606 3300035692 Bacteria 2383
193 Ga0373935_0205217 3300035692 Bacteria 1363
194 Ga0373927_0362483 3300035695 Unclassified 955
195 Ga0373933_0040295 3300035724 Bacteria 2751
196 Ga0373933_0084613 3300035724 Bacteria 1949
197 Ga0373937_0017402 3300036401 Bacteria 6402
198 Ga0373937_0049046 3300036401 Bacteria 3866
199 Ga0373925_0295422 3300037068 Bacteria 1307
200 Ga0373925_0384285 3300037068 Bacteria 1143
201 Ga0436365_0178921 3300039437 Bacteria 2144
202 Ga0436365_1579660 3300039437 Bacteria 78435
203 Ga0436365_1776492 3300039437 Bacteria 8696
204 Ga0436360_0169384 3300039438 Bacteria 1804
205 Ga0436360_1164596 3300039438 Bacteria 1110
206 Ga0436360_1373288 3300039438 Unclassified 2736
207 Ga0436363_1194000 3300039450 Bacteria 1644
208 Ga0436363_1516729 3300039450 Bacteria 2974
209 Ga0436362_0121486 3300039453 Bacteria 2377
210 Ga0451853_1643176 3300041512 Bacteria 1564
211 Ga0439441_033965 3300042001 Bacteria 1000
212 Ga0466967_0627300 3300045976 Bacteria 1062
213 Ga0495650_0000168 3300046471 Bacteria 145714
214 Ga0495650_0031576 3300046471 Bacteria 2381
215 Ga0495580_0027348 3300046472 Bacteria 4151
216 Ga0495580_0093546 3300046472 Bacteria 2092
217 Ga0495664_0230953 3300046477 Bacteria 1120
218 Ga0495583_0000003 3300046506 Bacteria 709273
219 Ga0495583_0175233 3300046506 Bacteria 880
220 Ga0495606_0002273 3300046507 Bacteria 22733
221 Ga0495610_0001080 3300046512 Bacteria 24952
222 Ga0495616_0201565 3300046513 Bacteria 874
223 Ga0495637_0025183 3300046520 Bacteria 2683
224 Ga0495643_0070609 3300046522 Bacteria 1834
225 Ga0495648_0027724 3300046524 Bacteria 3787
226 Ga0495652_0128074 3300046529 Bacteria 2014
227 Ga0495652_0163827 3300046529 Bacteria 1723
228 Ga0495654_0000085 3300046530 Bacteria 107010
229 Ga0495640_0074606 3300046533 Bacteria 2268
230 Ga0495645_0030306 3300046543 Bacteria 3939
231 Ga0495667_0298968 3300046559 Bacteria 1020
232 Ga0495625_0003963 3300046660 Bacteria 14216
233 Ga0495625_0021560 3300046660 Bacteria 4957
234 Ga0495625_0022304 3300046660 Bacteria 4857
235 Ga0495625_0059818 3300046660 Bacteria 2701
236 Ga0495625_0076509 3300046660 Bacteria 2340
237 Ga0495657_0056080 3300046675 Bacteria 2626
238 Ga0495589_0000827 3300046794 Bacteria 19436
239 Ga0495600_0254317 3300046809 Bacteria 1117
240 Ga0495660_0003895 3300046810 Bacteria 9125
241 Ga0495672_0016768 3300047320 Bacteria 4917
242 Ga0495679_004760 3300047446 Bacteria 6151
243 Ga0495673_0000341 3300047469 Bacteria 59080
244 Ga0495673_0002678 3300047469 Bacteria 12281
245 Ga0495686_0066265 3300047472 Bacteria 2231
246 Ga0495602_0071798 3300048088 Bacteria 2955
247 Ga0496103_0288932 3300048906 Bacteria 1055
248 Ga0496104_0733566 3300048907 Unclassified 895
249 Ga0496106_0456752 3300048909 Bacteria 1026
250 Ga0496107_0007325 3300048910 Bacteria 7606
251 Ga0496115_0132815 3300048918 Bacteria 2052
252 Ga0496121_0000607 3300048924 Bacteria 67089
253 Ga0496126_0000463 3300048929 Bacteria 80860
254 Ga0496126_0092391 3300048929 Bacteria 2659
255 Ga0495682_0006550 3300049460 Bacteria 4706
256 Ga0501033_0341222 3300049570 Bacteria 1050
257 Ga0501034_0056242 3300049571 Bacteria 3960
258 Ga0501034_0066918 3300049571 Bacteria 3606
259 Ga0501036_0564307 3300049572 Bacteria 945
260 Ga0501043_0015978 3300049579 Bacteria 5884
261 Ga0501046_0121801 3300049580 Bacteria 1984
262 Ga0501047_0001549 3300049581 Bacteria 22497
263 Ga0501047_0015786 3300049581 Bacteria 7198
264 Ga0501047_0067454 3300049581 Bacteria 3448
265 Ga0501047_0134697 3300049581 Bacteria 2351
266 Ga0501047_0537882 3300049581 Bacteria 993
267 Ga0501067_0004328 3300049583 Bacteria 7819
268 Ga0501067_0033066 3300049583 Bacteria 2871
269 Ga0501067_0115803 3300049583 Bacteria 1491
270 Ga0501068_0006707 3300049584 Bacteria 6361
271 Ga0501069_0252179 3300049585 Bacteria 1029
272 Ga0501070_0029410 3300049586 Bacteria 4606
273 Ga0501070_0282415 3300049586 Bacteria 1354
274 Ga0501072_0004532 3300049588 Bacteria 10558
275 Ga0501073_0173541 3300049589 Bacteria 1492
276 Ga0501073_0407733 3300049589 Bacteria 939
277 Ga0501075_0291226 3300049591 Bacteria 1244
278 Ga0501079_0013322 3300049741 Bacteria 6269
279 Ga0501079_0281309 3300049741 Bacteria 1301
280 Ga0501080_0001520 3300049742 Bacteria 19580
281 Ga0501080_0051217 3300049742 Bacteria 3841
282 Ga0501081_0440948 3300049743 Bacteria 967
283 Ga0501083_0106267 3300049744 Bacteria 1848
284 Ga0501035_0002157 3300049822 Bacteria 19534
285 Ga0501035_0020690 3300049822 Bacteria 6047
286 Ga0501044_0040992 3300049823 Bacteria 4821
287 Ga0501044_0103381 3300049823 Bacteria 2863
288 Ga0501044_0196843 3300049823 Bacteria 1975
289 nmdc:mga0qj67_463536_c1 3300050509 Bacteria 1020
290 nmdc:mga08y16_224038_c1 3300050511 Bacteria 1946
291 nmdc:mga0n895_126812_c1 3300050512 Bacteria 2576
292 nmdc:mga0rr50_11670_c1 3300050513 Bacteria 5638
293 nmdc:mga0rr50_4886_c1 3300050513 Bacteria 7928
294 nmdc:mga08x19_104971_c1 3300050514 Bacteria 1878
295 nmdc:mga08x19_54_c1 3300050514 Bacteria 121662
296 Ga0500556_0000814 3300053104 Bacteria 18111
297 Ga0500618_000159 3300053125 Bacteria 56114
298 Ga0500655_000936 3300053133 Bacteria 5648
299 Ga0500655_003759 3300053133 Bacteria 2735
300 Ga0500658_0005645 3300053134 Bacteria 4654
301 Ga0500577_0000311 3300053142 Bacteria 12547
302 Ga0500627_0039884 3300053158 Bacteria 2012
303 Ga0500611_011940 3300053727 Bacteria 1451
304 Ga0500645_001203 3300053730 Bacteria 13732
305 Ga0500645_031742 3300053730 Bacteria 1586
306 Ga0501084_0000057 3300054114 Bacteria 87821
307 Ga0501084_0117660 3300054114 Bacteria 2234
308 Ga0501082_0022189 3300060353 Bacteria 5471
309 Ga0501082_0233721 3300060353 Bacteria 1600

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021384 Ga0213876_10038503 Ga0213876_100385032 214
2 3300039437 Ga0436365_1776492 Ga0436365_1776492_5964_6668 214
3 3300039453 Ga0436362_0121486 Ga0436362_0121486_998_1702 214
4 3300046506 Ga0495583_0000003 Ga0495583_0000003_529913_530608 214
5 3300021441 Ga0213871_10027877 Ga0213871_100278772 223
6 3300039438 Ga0436360_1373288 Ga0436360_1373288_847_1530 223
7 iso_pu_bacteria 2510917020 2511124969 227
8 iso_pu_bacteria 2643221552 2643781774 227
9 iso_pu_bacteria 2643221583 2643924077 227
10 iso_pu_bacteria 2643221584 2643931963 227
11 iso_pu_bacteria 2818991435 2819538258 227
12 iso_pu_bacteria 2818991454 2819647172 227
13 3300031251 Ga0265327_10026001 Ga0265327_100260012 230
14 3300035398 Ga0316574_0028704 Ga0316574_0028704_484_1176 230
15 3300039438 Ga0436360_0169384 Ga0436360_0169384_1004_1702 230
16 3300039438 Ga0436360_1164596 Ga0436360_1164596_351_1046 230
17 3300060353 Ga0501082_0022189 Ga0501082_0022189_2727_3425 230
18 3300003322 rootL2_10020896 rootL2_100208963 231
19 3300005329 Ga0070683_100538511 Ga0070683_1005385112 231
20 3300005335 Ga0070666_10000196 Ga0070666_1000019614 231
21 3300005336 Ga0070680_100001064 Ga0070680_10000106410 231
22 3300005340 Ga0070689_100376926 Ga0070689_1003769262 231
23 3300005341 Ga0070691_10000339 Ga0070691_100003394 231
24 3300005344 Ga0070661_100001212 Ga0070661_10000121212 231
25 3300005356 Ga0070674_100247194 Ga0070674_1002471942 231
26 3300005367 Ga0070667_100009342 Ga0070667_1000093426 231
27 3300005434 Ga0070709_10000408 Ga0070709_1000040811 231
28 3300005434 Ga0070709_10014232 Ga0070709_100142322 231
29 3300005435 Ga0070714_100006162 Ga0070714_1000061626 231
30 3300005435 Ga0070714_100353188 Ga0070714_1003531882 231
31 3300005436 Ga0070713_100000333 Ga0070713_10000033316 231
32 3300005436 Ga0070713_100033161 Ga0070713_1000331613 231
33 3300005436 Ga0070713_100690922 Ga0070713_1006909221 231
34 3300005437 Ga0070710_10435069 Ga0070710_104350691 231
35 3300005439 Ga0070711_100523590 Ga0070711_1005235902 231
36 3300005455 Ga0070663_100282450 Ga0070663_1002824501 231
37 3300005458 Ga0070681_10000002 Ga0070681_10000002750 231
38 3300005458 Ga0070681_10412143 Ga0070681_104121432 231
39 3300005530 Ga0070679_100001917 Ga0070679_1000019172 231
40 3300005535 Ga0070684_100128685 Ga0070684_1001286852 231
41 3300005539 Ga0068853_100000904 Ga0068853_10000090422 231
42 3300005545 Ga0070695_100063839 Ga0070695_1000638391 231
43 3300005548 Ga0070665_100077022 Ga0070665_1000770222 231
44 3300005563 Ga0068855_100000106 Ga0068855_10000010626 231
45 3300005564 Ga0070664_100813223 Ga0070664_1008132232 231
46 3300005577 Ga0068857_100001587 Ga0068857_1000015875 231
47 3300005578 Ga0068854_100028475 Ga0068854_1000284753 231
48 3300005578 Ga0068854_100685355 Ga0068854_1006853551 231
49 3300005614 Ga0068856_100000601 Ga0068856_10000060137 231
50 3300005614 Ga0068856_100001518 Ga0068856_10000151811 231
51 3300005616 Ga0068852_100046182 Ga0068852_1000461824 231
52 3300005616 Ga0068852_100268642 Ga0068852_1002686422 231
53 3300005616 Ga0068852_100337674 Ga0068852_1003376741 231
54 3300005617 Ga0068859_100520107 Ga0068859_1005201071 231
55 3300005842 Ga0068858_100216951 Ga0068858_1002169512 231
56 3300005843 Ga0068860_100013072 Ga0068860_1000130727 231
57 3300005843 Ga0068860_100210757 Ga0068860_1002107572 231
58 3300005985 Ga0081539_10082540 Ga0081539_100825402 231
59 3300006173 Ga0070716_100033698 Ga0070716_1000336983 231
60 3300006175 Ga0070712_100000023 Ga0070712_10000002366 231
61 3300006175 Ga0070712_100000803 Ga0070712_10000080310 231
62 3300006237 Ga0097621_100072189 Ga0097621_1000721895 231
63 3300006353 Ga0075370_10117890 Ga0075370_101178901 231
64 3300006358 Ga0068871_100062297 Ga0068871_1000622972 231
65 3300006871 Ga0075434_100056843 Ga0075434_1000568432 231
66 3300006914 Ga0075436_100000211 Ga0075436_10000021115 231
67 3300006914 Ga0075436_100006135 Ga0075436_1000061354 231
68 3300006914 Ga0075436_100102365 Ga0075436_1001023652 231
69 3300006931 Ga0097620_100519992 Ga0097620_1005199921 231
70 3300007076 Ga0075435_100002305 Ga0075435_1000023054 231
71 3300007076 Ga0075435_100087640 Ga0075435_1000876402 231
72 3300009093 Ga0105240_10000653 Ga0105240_1000065336 231
73 3300009093 Ga0105240_10042023 Ga0105240_100420235 231
74 3300009093 Ga0105240_10119371 Ga0105240_101193714 231
75 3300009093 Ga0105240_10934768 Ga0105240_109347682 231
76 3300009174 Ga0105241_10014169 Ga0105241_100141692 231
77 3300009176 Ga0105242_10008803 Ga0105242_100088032 231
78 3300009176 Ga0105242_10218957 Ga0105242_102189572 231
79 3300009177 Ga0105248_10000001 Ga0105248_100000011553 231
80 3300009177 Ga0105248_10019614 Ga0105248_100196142 231
81 3300009545 Ga0105237_10030554 Ga0105237_100305545 231
82 3300009545 Ga0105237_10171638 Ga0105237_101716382 231
83 3300009551 Ga0105238_10006744 Ga0105238_100067442 231
84 3300009551 Ga0105238_10055471 Ga0105238_100554711 231
85 3300010375 Ga0105239_10001093 Ga0105239_1000109324 231
86 3300010375 Ga0105239_10009490 Ga0105239_100094906 231
87 3300010375 Ga0105239_10075543 Ga0105239_100755433 231
88 3300013100 Ga0157373_10001642 Ga0157373_1000164210 231
89 3300013104 Ga0157370_10012463 Ga0157370_100124632 231
90 3300013104 Ga0157370_10584141 Ga0157370_105841412 231
91 3300013105 Ga0157369_10014455 Ga0157369_1001445511 231
92 3300013105 Ga0157369_10084124 Ga0157369_100841242 231
93 3300013105 Ga0157369_10114415 Ga0157369_101144153 231
94 3300013297 Ga0157378_10600975 Ga0157378_106009752 231
95 3300013306 Ga0163162_10680218 Ga0163162_106802182 231
96 3300013306 Ga0163162_10916763 Ga0163162_109167631 231
97 3300013307 Ga0157372_10004309 Ga0157372_1000430911 231
98 3300013307 Ga0157372_10021146 Ga0157372_100211463 231
99 3300013307 Ga0157372_10048127 Ga0157372_100481274 231
100 3300013307 Ga0157372_10121683 Ga0157372_101216832 231
101 3300013307 Ga0157372_10519575 Ga0157372_105195752 231
102 3300014326 Ga0157380_10115753 Ga0157380_101157531 231
103 3300014968 Ga0157379_10008855 Ga0157379_100088554 231
104 3300014968 Ga0157379_10009508 Ga0157379_100095086 231
105 3300021377 Ga0213874_10046680 Ga0213874_100466802 231
106 3300021384 Ga0213876_10000243 Ga0213876_1000024321 231
107 3300021384 Ga0213876_10354510 Ga0213876_103545101 231
108 3300025298 Ga0209050_1007846 Ga0209050_10078463 231
109 3300025898 Ga0207692_10427533 Ga0207692_104275332 231
110 3300025903 Ga0207680_10001529 Ga0207680_100015294 231
111 3300025906 Ga0207699_10000280 Ga0207699_1000028020 231
112 3300025906 Ga0207699_10099142 Ga0207699_100991422 231
113 3300025911 Ga0207654_10031535 Ga0207654_100315352 231
114 3300025911 Ga0207654_10174639 Ga0207654_101746392 231
115 3300025912 Ga0207707_10000002 Ga0207707_10000002208 231
116 3300025913 Ga0207695_10000012 Ga0207695_10000012367 231
117 3300025913 Ga0207695_10107929 Ga0207695_101079292 231
118 3300025913 Ga0207695_10600948 Ga0207695_106009481 231
119 3300025915 Ga0207693_10000018 Ga0207693_10000018129 231
120 3300025915 Ga0207693_10000534 Ga0207693_1000053410 231
121 3300025916 Ga0207663_10019060 Ga0207663_100190603 231
122 3300025917 Ga0207660_10002350 Ga0207660_100023509 231
123 3300025917 Ga0207660_10279848 Ga0207660_102798482 231
124 3300025920 Ga0207649_10000026 Ga0207649_1000002612 231
125 3300025920 Ga0207649_10223396 Ga0207649_102233962 231
126 3300025921 Ga0207652_10000052 Ga0207652_1000005237 231
127 3300025921 Ga0207652_10183281 Ga0207652_101832812 231
128 3300025924 Ga0207694_10000006 Ga0207694_10000006299 231
129 3300025928 Ga0207700_10000026 Ga0207700_1000002650 231
130 3300025928 Ga0207700_10198883 Ga0207700_101988832 231
131 3300025929 Ga0207664_10055790 Ga0207664_100557903 231
132 3300025932 Ga0207690_10422970 Ga0207690_104229702 231
133 3300025935 Ga0207709_10500723 Ga0207709_105007232 231
134 3300025939 Ga0207665_10133657 Ga0207665_101336572 231
135 3300025939 Ga0207665_10223562 Ga0207665_102235621 231
136 3300025941 Ga0207711_10000001 Ga0207711_10000001320 231
137 3300025941 Ga0207711_10085430 Ga0207711_100854303 231
138 3300025949 Ga0207667_10000232 Ga0207667_1000023281 231
139 3300025949 Ga0207667_10106293 Ga0207667_101062932 231
140 3300025986 Ga0207658_10497375 Ga0207658_104973752 231
141 3300026035 Ga0207703_10192929 Ga0207703_101929292 231
142 3300026041 Ga0207639_10010285 Ga0207639_100102855 231
143 3300026041 Ga0207639_10122370 Ga0207639_101223702 231
144 3300026067 Ga0207678_10203895 Ga0207678_102038953 231
145 3300026078 Ga0207702_10000021 Ga0207702_10000021197 231
146 3300026078 Ga0207702_10001285 Ga0207702_1000128510 231
147 3300026078 Ga0207702_10328294 Ga0207702_103282941 231
148 3300026116 Ga0207674_10000134 Ga0207674_1000013435 231
149 3300026142 Ga0207698_10012717 Ga0207698_100127174 231
150 3300026142 Ga0207698_10104748 Ga0207698_101047482 231
151 3300026142 Ga0207698_10140812 Ga0207698_101408122 231
152 3300027907 Ga0207428_10359546 Ga0207428_103595462 231
153 3300028379 Ga0268266_10558484 Ga0268266_105584842 231
154 3300028380 Ga0268265_10405105 Ga0268265_104051052 231
155 3300028381 Ga0268264_10057058 Ga0268264_100570584 231
156 3300028381 Ga0268264_10149590 Ga0268264_101495902 231
157 3300028381 Ga0268264_10742926 Ga0268264_107429262 231
158 3300028573 Ga0265334_10006845 Ga0265334_100068451 231
159 3300028577 Ga0265318_10000364 Ga0265318_100003642 231
160 3300028800 Ga0265338_10000011 Ga0265338_10000011185 231
161 3300028800 Ga0265338_10040105 Ga0265338_100401053 231
162 3300028800 Ga0265338_10130086 Ga0265338_101300862 231
163 3300028800 Ga0265338_10478220 Ga0265338_104782201 231
164 3300031235 Ga0265330_10006116 Ga0265330_100061164 231
165 3300031235 Ga0265330_10094192 Ga0265330_100941922 231
166 3300031235 Ga0265330_10111406 Ga0265330_101114062 231
167 3300031238 Ga0265332_10012108 Ga0265332_100121084 231
168 3300031240 Ga0265320_10019132 Ga0265320_100191323 231
169 3300031241 Ga0265325_10000009 Ga0265325_1000000964 231
170 3300031241 Ga0265325_10000365 Ga0265325_100003658 231
171 3300031242 Ga0265329_10013098 Ga0265329_100130981 231
172 3300031247 Ga0265340_10000018 Ga0265340_1000001819 231
173 3300031247 Ga0265340_10012022 Ga0265340_100120222 231
174 3300031247 Ga0265340_10013717 Ga0265340_100137172 231
175 3300031249 Ga0265339_10000376 Ga0265339_1000037628 231
176 3300031249 Ga0265339_10006173 Ga0265339_100061734 231
177 3300031249 Ga0265339_10033858 Ga0265339_100338583 231
178 3300031249 Ga0265339_10075899 Ga0265339_100758993 231
179 3300031250 Ga0265331_10000008 Ga0265331_10000008137 231
180 3300031250 Ga0265331_10000067 Ga0265331_1000006746 231
181 3300031250 Ga0265331_10014580 Ga0265331_100145802 231
182 3300031250 Ga0265331_10028534 Ga0265331_100285342 231
183 3300031251 Ga0265327_10000036 Ga0265327_1000003617 231
184 3300031344 Ga0265316_10028831 Ga0265316_100288312 231
185 3300031344 Ga0265316_10038462 Ga0265316_100384622 231
186 3300031344 Ga0265316_10041943 Ga0265316_100419433 231
187 3300031344 Ga0265316_10067244 Ga0265316_100672442 231
188 3300031344 Ga0265316_10155288 Ga0265316_101552882 231
189 3300031344 Ga0265316_10209312 Ga0265316_102093121 231
190 3300031344 Ga0265316_10329231 Ga0265316_103292312 231
191 3300031595 Ga0265313_10012587 Ga0265313_100125873 231
192 3300031595 Ga0265313_10032892 Ga0265313_100328923 231
193 3300031595 Ga0265313_10104428 Ga0265313_101044282 231
194 3300031595 Ga0265313_10173301 Ga0265313_101733012 231
195 3300031711 Ga0265314_10013871 Ga0265314_100138712 231
196 3300031711 Ga0265314_10082275 Ga0265314_100822752 231
197 3300031711 Ga0265314_10161679 Ga0265314_101616792 231
198 3300031711 Ga0265314_10175798 Ga0265314_101757982 231
199 3300031712 Ga0265342_10004869 Ga0265342_1000486910 231
200 3300031730 Ga0307516_10108247 Ga0307516_101082472 231
201 3300035111 Ga0373923_0150034 Ga0373923_0150034_256_960 231
202 3300035119 Ga0373956_0016666 Ga0373956_0016666_1836_2540 231
203 3300035691 Ga0373931_0021725 Ga0373931_0021725_413_1117 231
204 3300035691 Ga0373931_0285363 Ga0373931_0285363_131_835 231
205 3300035692 Ga0373935_0062606 Ga0373935_0062606_1651_2355 231
206 3300035692 Ga0373935_0205217 Ga0373935_0205217_196_900 231
207 3300035695 Ga0373927_0362483 Ga0373927_0362483_183_887 231
208 3300035724 Ga0373933_0040295 Ga0373933_0040295_1726_2430 231
209 3300035724 Ga0373933_0084613 Ga0373933_0084613_601_1305 231
210 3300036401 Ga0373937_0017402 Ga0373937_0017402_3837_4541 231
211 3300036401 Ga0373937_0049046 Ga0373937_0049046_1032_1736 231
212 3300037068 Ga0373925_0295422 Ga0373925_0295422_180_884 231
213 3300037068 Ga0373925_0384285 Ga0373925_0384285_246_950 231
214 3300039437 Ga0436365_0178921 Ga0436365_0178921_523_1221 231
215 3300039437 Ga0436365_1579660 Ga0436365_1579660_33975_34673 231
216 3300039450 Ga0436363_1194000 Ga0436363_1194000_581_1279 231
217 3300039450 Ga0436363_1516729 Ga0436363_1516729_2162_2887 231
218 3300041512 Ga0451853_1643176 Ga0451853_1643176_601_1296 231
219 3300042001 Ga0439441_033965 Ga0439441_033965_155_850 231
220 3300045976 Ga0466967_0627300 Ga0466967_0627300_103_846 231
221 3300046471 Ga0495650_0000168 Ga0495650_0000168_60293_60988 231
222 3300046471 Ga0495650_0031576 Ga0495650_0031576_251_946 231
223 3300046472 Ga0495580_0027348 Ga0495580_0027348_1221_1919 231
224 3300046472 Ga0495580_0093546 Ga0495580_0093546_1066_1770 231
225 3300046477 Ga0495664_0230953 Ga0495664_0230953_405_1103 231
226 3300046506 Ga0495583_0175233 Ga0495583_0175233_94_801 231
227 3300046507 Ga0495606_0002273 Ga0495606_0002273_12917_13612 231
228 3300046512 Ga0495610_0001080 Ga0495610_0001080_10792_11499 231
229 3300046513 Ga0495616_0201565 Ga0495616_0201565_98_793 231
230 3300046520 Ga0495637_0025183 Ga0495637_0025183_1948_2643 231
231 3300046522 Ga0495643_0070609 Ga0495643_0070609_595_1302 231
232 3300046524 Ga0495648_0027724 Ga0495648_0027724_1007_1702 231
233 3300046529 Ga0495652_0128074 Ga0495652_0128074_842_1540 231
234 3300046529 Ga0495652_0163827 Ga0495652_0163827_125_823 231
235 3300046530 Ga0495654_0000085 Ga0495654_0000085_57484_58179 231
236 3300046533 Ga0495640_0074606 Ga0495640_0074606_628_1326 231
237 3300046543 Ga0495645_0030306 Ga0495645_0030306_2277_2975 231
238 3300046559 Ga0495667_0298968 Ga0495667_0298968_29_727 231
239 3300046660 Ga0495625_0003963 Ga0495625_0003963_11599_12294 231
240 3300046660 Ga0495625_0021560 Ga0495625_0021560_1364_2071 231
241 3300046660 Ga0495625_0022304 Ga0495625_0022304_1657_2352 231
242 3300046660 Ga0495625_0059818 Ga0495625_0059818_158_853 231
243 3300046660 Ga0495625_0076509 Ga0495625_0076509_1324_2019 231
244 3300046675 Ga0495657_0056080 Ga0495657_0056080_619_1323 231
245 3300046794 Ga0495589_0000827 Ga0495589_0000827_15715_16410 231
246 3300046809 Ga0495600_0254317 Ga0495600_0254317_20_718 231
247 3300046810 Ga0495660_0003895 Ga0495660_0003895_7237_7941 231
248 3300047320 Ga0495672_0016768 Ga0495672_0016768_3381_4088 231
249 3300047446 Ga0495679_004760 Ga0495679_004760_1742_2437 231
250 3300047469 Ga0495673_0000341 Ga0495673_0000341_48094_48789 231
251 3300047469 Ga0495673_0002678 Ga0495673_0002678_1563_2258 231
252 3300047472 Ga0495686_0066265 Ga0495686_0066265_1355_2050 231
253 3300048088 Ga0495602_0071798 Ga0495602_0071798_1726_2430 231
254 3300048906 Ga0496103_0288932 Ga0496103_0288932_176_880 231
255 3300048907 Ga0496104_0733566 Ga0496104_0733566_64_768 231
256 3300048909 Ga0496106_0456752 Ga0496106_0456752_11_715 231
257 3300048910 Ga0496107_0007325 Ga0496107_0007325_5581_6288 231
258 3300048918 Ga0496115_0132815 Ga0496115_0132815_490_1188 231
259 3300048924 Ga0496121_0000607 Ga0496121_0000607_63703_64410 231
260 3300048929 Ga0496126_0000463 Ga0496126_0000463_42471_43175 231
261 3300048929 Ga0496126_0092391 Ga0496126_0092391_944_1639 231
262 3300049460 Ga0495682_0006550 Ga0495682_0006550_2793_3491 231
263 3300049570 Ga0501033_0341222 Ga0501033_0341222_12_710 231
264 3300049571 Ga0501034_0056242 Ga0501034_0056242_2921_3619 231
265 3300049571 Ga0501034_0066918 Ga0501034_0066918_1344_2042 231
266 3300049572 Ga0501036_0564307 Ga0501036_0564307_33_734 231
267 3300049579 Ga0501043_0015978 Ga0501043_0015978_4866_5564 231
268 3300049580 Ga0501046_0121801 Ga0501046_0121801_1142_1843 231
269 3300049581 Ga0501047_0001549 Ga0501047_0001549_5384_6082 231
270 3300049581 Ga0501047_0015786 Ga0501047_0015786_5723_6424 231
271 3300049581 Ga0501047_0067454 Ga0501047_0067454_1173_1874 231
272 3300049581 Ga0501047_0134697 Ga0501047_0134697_677_1375 231
273 3300049581 Ga0501047_0537882 Ga0501047_0537882_173_871 231
274 3300049583 Ga0501067_0004328 Ga0501067_0004328_6833_7531 231
275 3300049583 Ga0501067_0033066 Ga0501067_0033066_1252_1953 231
276 3300049583 Ga0501067_0115803 Ga0501067_0115803_118_816 231
277 3300049584 Ga0501068_0006707 Ga0501068_0006707_94_792 231
278 3300049585 Ga0501069_0252179 Ga0501069_0252179_248_949 231
279 3300049586 Ga0501070_0029410 Ga0501070_0029410_1351_2052 231
280 3300049586 Ga0501070_0282415 Ga0501070_0282415_333_1031 231
281 3300049588 Ga0501072_0004532 Ga0501072_0004532_886_1584 231
282 3300049589 Ga0501073_0173541 Ga0501073_0173541_262_960 231
283 3300049589 Ga0501073_0407733 Ga0501073_0407733_70_768 231
284 3300049591 Ga0501075_0291226 Ga0501075_0291226_412_1110 231
285 3300049741 Ga0501079_0013322 Ga0501079_0013322_792_1493 231
286 3300049741 Ga0501079_0281309 Ga0501079_0281309_120_818 231
287 3300049742 Ga0501080_0001520 Ga0501080_0001520_10620_11318 231
288 3300049742 Ga0501080_0051217 Ga0501080_0051217_1127_1825 231
289 3300049743 Ga0501081_0440948 Ga0501081_0440948_178_876 231
290 3300049744 Ga0501083_0106267 Ga0501083_0106267_489_1187 231
291 3300049822 Ga0501035_0002157 Ga0501035_0002157_4550_5251 231
292 3300049822 Ga0501035_0020690 Ga0501035_0020690_129_827 231
293 3300049823 Ga0501044_0040992 Ga0501044_0040992_3346_4047 231
294 3300049823 Ga0501044_0103381 Ga0501044_0103381_473_1171 231
295 3300049823 Ga0501044_0196843 Ga0501044_0196843_692_1390 231
296 3300050509 nmdc:mga0qj67_463536_c1 nmdc:mga0qj67_463536_c1_231_929 231
297 3300050511 nmdc:mga08y16_224038_c1 nmdc:mga08y16_224038_c1_1215_1913 231
298 3300050512 nmdc:mga0n895_126812_c1 nmdc:mga0n895_126812_c1_98_802 231
299 3300050513 nmdc:mga0rr50_11670_c1 nmdc:mga0rr50_11670_c1_2934_3638 231
300 3300050513 nmdc:mga0rr50_4886_c1 nmdc:mga0rr50_4886_c1_6563_7267 231
301 3300050514 nmdc:mga08x19_104971_c1 nmdc:mga08x19_104971_c1_234_938 231
302 3300050514 nmdc:mga08x19_54_c1 nmdc:mga08x19_54_c1_76785_77489 231
303 3300053104 Ga0500556_0000814 Ga0500556_0000814_2344_3039 231
304 3300053125 Ga0500618_000159 Ga0500618_000159_18250_18945 231
305 3300053133 Ga0500655_000936 Ga0500655_000936_4876_5574 231
306 3300053133 Ga0500655_003759 Ga0500655_003759_654_1352 231
307 3300053134 Ga0500658_0005645 Ga0500658_0005645_2013_2720 231
308 3300053142 Ga0500577_0000311 Ga0500577_0000311_10323_11018 231
309 3300053158 Ga0500627_0039884 Ga0500627_0039884_102_797 231
310 3300053727 Ga0500611_011940 Ga0500611_011940_284_994 231
311 3300053730 Ga0500645_001203 Ga0500645_001203_163_858 231
312 3300053730 Ga0500645_031742 Ga0500645_031742_163_870 231
313 3300054114 Ga0501084_0000057 Ga0501084_0000057_45892_46590 231
314 3300054114 Ga0501084_0117660 Ga0501084_0117660_274_975 231
315 3300060353 Ga0501082_0233721 Ga0501082_0233721_299_997 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

16

227

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u2f-assembly1.cif.gz_A crystal structure of dienelactone hydrolase b-1 variant (q35h, f38l, y64h, q110l, c123s, y137c, y145c, n154d, e199g, s208g and g211d) at 1.80 a resolution 0.976 5 231
4u2e-assembly1.cif.gz_A crystal structure of dienelactone hydrolase s-3 variant (q35h, f38l, q110l, c123s, y137c, y145c, n154d, e199g, s208g, g211d and k234n) at 1.70 a resolution 0.9756 5 231
1ggv-assembly1.cif.gz_A crystal structure of the c123s mutant of dienelactone hydrolase (dlh) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf) 0.9753 5 229
4u2c-assembly1.cif.gz_A crystal structure of dienelactone hydrolase a-6 variant (s7t, a24v, q35h, f38l, q110l, c123s, y145c, e199g and s208g) at 1.95 a resolution 0.9752 5 231
1din-assembly1.cif.gz_A dienelactone hydrolase at 2.8 angstroms 0.9751 5 231
ID Description Score Start End Superfamily
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9726 5 231 3.40.50.1820
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9521 5 231 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8836 1 230 3.40.50.1820
af_Q5AI87_1_234_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8799 16 230 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8667 3 231 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2R7LSD3-F1-model_v4 Carboxymethylenebutenolidase 0.9987 22 231 GO:0016787
AF-A0A2Z4UNW1-F1-model_v4 Carboxymethylenebutenolidase (EC 3.1.1.45) 0.9942 1 230 GO:0008806
AF-A0A2R7LSD3-F1-model_v4 Carboxymethylenebutenolidase 0.9939 22 231 GO:0016787
AF-A0A2D9XPE6-F1-model_v4 Carboxymethylenebutenolidase 0.9913 3 231 GO:0016787
AF-G4M6N3-F1-model_v4 Dienelactone hydrolase family 0.9898 1 231 GO:0016787

Feature Viewer

pLDDT pTM Quality
96.63 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map