F403194

General Info

Members Datasets Scaffolds Average Seq Length
315 261 630 54

Family's Representative Sequence

Representative Sequence 3300025908|Ga0207643_10010084|Ga0207643_100100845
Length 60
Sequence MNSDPDNSXXDPFQQGQRAAAQNIPAEANPYRDGSDEHALWAAGHEKVAGAREANESEGG

Samples

Sample ID Description Type Environment
1 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
107 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
108 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
109 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
123 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
124 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
125 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
126 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
213 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
214 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
215 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
216 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
217 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
218 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
219 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
220 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
221 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
224 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
225 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
226 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
227 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
228 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
229 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
230 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
231 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
232 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
233 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
234 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
235 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
236 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
237 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
238 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
239 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
240 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
241 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
242 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
243 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
244 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
245 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
246 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
247 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
248 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
249 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
250 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
251 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
252 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
253 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
254 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
255 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
256 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
257 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
258 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
259 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
260 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
261 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.94
Metatranscriptomes 0
Isolates 12.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.48
Nodule 7.3
Rhizoplane 4.76
Rhizosphere 70.48
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207643_10010084 3300025908 Bacteria 5080
2 JGI25406J46586_10000165 3300003203 Bacteria 29331
3 JGI25406J46586_10000169 3300003203 Bacteria 29128
4 JGI25153J46596_10000647 3300003215 Bacteria 21244
5 JGI25153J46596_10035057 3300003215 Bacteria 1631
6 rootL2_10116353 3300003322 Bacteria 2786
7 rootH1_10098009 3300003323 Bacteria 1391
8 JGI25404J52841_10072972 3300003659 Bacteria 717
9 Ga0055539_1020652 3300003752 Bacteria 785
10 Ga0068869_101667428 3300005334 Bacteria 569
11 Ga0070680_100081900 3300005336 Bacteria 2663
12 Ga0068868_101743180 3300005338 Bacteria 587
13 Ga0070660_100172933 3300005339 Bacteria 1745
14 Ga0070691_10147209 3300005341 Bacteria 1205
15 Ga0070691_10332576 3300005341 Bacteria 839
16 Ga0070668_101150754 3300005347 Bacteria 702
17 Ga0070669_100301138 3300005353 Bacteria 1289
18 Ga0070675_100492363 3300005354 Bacteria 1104
19 Ga0070674_101450658 3300005356 Bacteria 615
20 Ga0070659_101681356 3300005366 Bacteria 567
21 Ga0070700_100766262 3300005441 Bacteria 774
22 Ga0070663_100886992 3300005455 Bacteria 770
23 Ga0070678_100430824 3300005456 Bacteria 1151
24 Ga0070662_100719124 3300005457 Bacteria 846
25 Ga0070685_11629555 3300005466 Bacteria 500
26 Ga0070679_101431851 3300005530 Bacteria 637
27 Ga0068853_100067626 3300005539 Bacteria 3104
28 Ga0068853_101147738 3300005539 Bacteria 750
29 Ga0070672_100151191 3300005543 Bacteria 1920
30 Ga0068855_100070379 3300005563 Bacteria 4070
31 Ga0068856_100304038 3300005614 Bacteria 1613
32 Ga0068852_100057850 3300005616 Bacteria 3355
33 Ga0068864_101941278 3300005618 Bacteria 594
34 Ga0068870_11147394 3300005840 Bacteria 561
35 Ga0068860_102029571 3300005843 Bacteria 596
36 Ga0068862_100182871 3300005844 Bacteria 1882
37 Ga0081540_1006991 3300005983 Bacteria 8121
38 Ga0081540_1289174 3300005983 Bacteria 564
39 Ga0081539_10000255 3300005985 Bacteria 123054
40 Ga0070715_10454860 3300006163 Bacteria 723
41 Ga0070716_100537490 3300006173 Bacteria 869
42 Ga0070712_101099269 3300006175 Bacteria 690
43 Ga0075369_10274526 3300006186 Bacteria 785
44 Ga0075366_10229150 3300006195 Bacteria 1132
45 Ga0075366_10724617 3300006195 Bacteria 618
46 Ga0097621_102400638 3300006237 Bacteria 505
47 Ga0099794_10004724 3300007265 Bacteria 5397
48 Ga0105244_10562390 3300009036 Bacteria 524
49 Ga0105240_11724025 3300009093 Bacteria 654
50 Ga0111539_10944090 3300009094 Bacteria 1003
51 Ga0105245_10836815 3300009098 Bacteria 960
52 Ga0114129_10419508 3300009147 Bacteria 1760
53 Ga0105243_10904748 3300009148 Bacteria 878
54 Ga0105238_10230960 3300009551 Bacteria 1827
55 Ga0099796_10027255 3300010159 Bacteria 1823
56 Ga0105239_11045423 3300010375 Bacteria 939
57 Ga0105246_10358504 3300011119 Bacteria 1197
58 Ga0157371_11626544 3300013102 Unclassified 506
59 Ga0157370_10806343 3300013104 Bacteria 854
60 Ga0157378_12535273 3300013297 Bacteria 565
61 Ga0157372_11703255 3300013307 Bacteria 725
62 Ga0157375_10467946 3300013308 Bacteria 1426
63 Ga0157380_10258623 3300014326 Bacteria 1580
64 Ga0209677_103566 3300025253 Bacteria 4955
65 Ga0209758_1024636 3300025297 Bacteria 2674
66 Ga0209758_1036882 3300025297 Bacteria 1899
67 Ga0209758_1066338 3300025297 Bacteria 1160
68 Ga0209758_1091919 3300025297 Bacteria 886
69 Ga0209257_1029073 3300025304 Bacteria 1806
70 Ga0207685_10242921 3300025905 Bacteria 867
71 Ga0207705_10551189 3300025909 Bacteria 896
72 Ga0207705_11067489 3300025909 Bacteria 623
73 Ga0207705_11237159 3300025909 Bacteria 572
74 Ga0207693_10211648 3300025915 Bacteria 1524
75 Ga0207663_10692419 3300025916 Bacteria 806
76 Ga0207660_10387306 3300025917 Bacteria 1124
77 Ga0207660_11737597 3300025917 Bacteria 501
78 Ga0207657_10010762 3300025919 Bacteria 9105
79 Ga0207652_10070986 3300025921 Bacteria 3025
80 Ga0207650_11165276 3300025925 Bacteria 656
81 Ga0207659_11676528 3300025926 Bacteria 542
82 Ga0207700_10166051 3300025928 Bacteria 1837
83 Ga0207664_10781526 3300025929 Bacteria 859
84 Ga0207690_10931590 3300025932 Bacteria 721
85 Ga0207709_10649976 3300025935 Bacteria 839
86 Ga0207704_11051908 3300025938 Bacteria 690
87 Ga0207691_10127936 3300025940 Bacteria 2246
88 Ga0207667_10180610 3300025949 Bacteria 2167
89 Ga0207667_10391882 3300025949 Bacteria 1414
90 Ga0207640_10180071 3300025981 Bacteria 1584
91 Ga0207677_11140730 3300026023 Bacteria 712
92 Ga0207703_11494494 3300026035 Bacteria 650
93 Ga0207678_10459538 3300026067 Bacteria 1107
94 Ga0207708_10070872 3300026075 Bacteria 2669
95 Ga0207641_11208112 3300026088 Bacteria 756
96 Ga0207676_11576074 3300026095 Bacteria 654
97 Ga0207674_10652504 3300026116 Bacteria 1016
98 Ga0207683_10247515 3300026121 Bacteria 1626
99 Ga0207698_10150779 3300026142 Bacteria 2017
100 Ga0209588_1153809 3300027671 Bacteria 728
101 Ga0268266_11174238 3300028379 Bacteria 742
102 Ga0268265_11734536 3300028380 Bacteria 630
103 Ga0265334_10126509 3300028573 Bacteria 911
104 Ga0307515_10182925 3300028794 Bacteria 2038
105 Ga0307516_10023962 3300031730 Bacteria 6242
106 Ga0307405_10379047 3300031731 Bacteria 1100
107 Ga0307413_10525046 3300031824 Bacteria 955
108 Ga0307410_11238499 3300031852 Bacteria 651
109 Ga0307410_11338663 3300031852 Bacteria 627
110 Ga0307406_11110158 3300031901 Bacteria 683
111 Ga0307406_11363262 3300031901 Bacteria 621
112 Ga0307407_10629912 3300031903 Bacteria 801
113 Ga0307412_10331958 3300031911 Bacteria 1214
114 Ga0307416_100349063 3300032002 Bacteria 1496
115 Ga0307411_10589173 3300032005 Bacteria 954
116 Ga0307415_102255667 3300032126 Bacteria 533
117 Ga0373934_0001991 3300035086 Bacteria 7499
118 Ga0373934_0422868 3300035086 Bacteria 558
119 Ga0373923_0009615 3300035111 Bacteria 3496
120 Ga0373936_0032173 3300035113 Bacteria 2074
121 Ga0373945_0005237 3300035116 Bacteria 4146
122 Ga0373953_0002044 3300035117 Bacteria 6010
123 Ga0373954_0001997 3300035118 Bacteria 8473
124 Ga0373954_0069901 3300035118 Bacteria 1667
125 Ga0373956_0000896 3300035119 Bacteria 12334
126 Ga0373957_0003097 3300035120 Bacteria 4851
127 Ga0373943_0028686 3300035170 Bacteria 2624
128 Ga0373946_0015389 3300035171 Bacteria 2900
129 Ga0373955_0018962 3300035172 Bacteria 3431
130 Ga0373955_0108818 3300035172 Bacteria 1600
131 Ga0373924_0008078 3300035410 Bacteria 3811
132 Ga0373931_0265575 3300035691 Bacteria 1049
133 Ga0373935_0000495 3300035692 Bacteria 20438
134 Ga0373927_0000308 3300035695 Bacteria 38418
135 Ga0373933_0002192 3300035724 Bacteria 11160
136 Ga0373947_0005725 3300035725 Bacteria 7249
137 Ga0373947_0035566 3300035725 Bacteria 2949
138 Ga0373937_0805149 3300036401 Bacteria 887
139 Ga0373925_0026337 3300037068 Bacteria 4255
140 Ga0395899_0203494 3300037312 Bacteria 1379
141 Ga0451789_0668692 3300041443 Bacteria 504
142 Ga0451802_0945258 3300041460 Bacteria 685
143 Ga0451807_2338190 3300041486 Bacteria 1785
144 Ga0451855_0773600 3300041511 Bacteria 542
145 Ga0466972_0000174 3300044658 Bacteria 49914
146 Ga0466968_0251782 3300044735 Bacteria 839
147 Ga0466957_0268831 3300044842 Bacteria 1138
148 Ga0466959_0479095 3300045049 Bacteria 842
149 Ga0466967_1154750 3300045976 Bacteria 772
150 Ga0495592_0035125 3300046454 Bacteria 3777
151 Ga0495592_0408807 3300046454 Bacteria 858
152 Ga0495603_0004869 3300046455 Bacteria 8028
153 Ga0495603_0139517 3300046455 Bacteria 1410
154 Ga0495603_0265552 3300046455 Bacteria 988
155 Ga0495629_0000170 3300046459 Bacteria 57733
156 Ga0495629_0039554 3300046459 Bacteria 3319
157 Ga0495641_0002571 3300046461 Bacteria 14249
158 Ga0495651_0005295 3300046462 Bacteria 9835
159 Ga0495653_0002268 3300046463 Bacteria 15218
160 Ga0495580_0016736 3300046472 Bacteria 5503
161 Ga0495580_0132458 3300046472 Bacteria 1729
162 Ga0495582_0000053 3300046473 Bacteria 58155
163 Ga0495582_0651843 3300046473 Bacteria 609
164 Ga0495639_0017358 3300046475 Bacteria 3125
165 Ga0495639_0129085 3300046475 Bacteria 1209
166 Ga0495662_0001239 3300046476 Bacteria 12579
167 Ga0495664_0139331 3300046477 Bacteria 1470
168 Ga0495584_0261087 3300046491 Bacteria 880
169 Ga0495584_0652561 3300046491 Bacteria 536
170 Ga0495584_0672483 3300046491 Bacteria 528
171 Ga0495594_0000267 3300046499 Bacteria 25600
172 Ga0495594_0055687 3300046499 Bacteria 2181
173 Ga0495608_0004701 3300046511 Bacteria 9768
174 Ga0495618_0044831 3300046514 Bacteria 2789
175 Ga0495628_0006138 3300046516 Bacteria 10511
176 Ga0495628_0082136 3300046516 Bacteria 2503
177 Ga0495630_0036321 3300046517 Bacteria 3684
178 Ga0495630_0374736 3300046517 Bacteria 1090
179 Ga0495666_0026158 3300046526 Bacteria 2879
180 Ga0495652_0001842 3300046529 Bacteria 22526
181 Ga0495652_0057077 3300046529 Bacteria 3313
182 Ga0495665_0000132 3300046531 Bacteria 35776
183 Ga0495640_0001291 3300046533 Bacteria 19684
184 Ga0495640_0006962 3300046533 Bacteria 8903
185 Ga0495587_0021057 3300046536 Bacteria 4021
186 Ga0495587_0335042 3300046536 Bacteria 844
187 Ga0495598_0316627 3300046537 Bacteria 593
188 Ga0495645_0022585 3300046543 Bacteria 4552
189 Ga0495622_0001348 3300046557 Bacteria 12543
190 Ga0495667_0000849 3300046559 Bacteria 19760
191 Ga0495667_0124182 3300046559 Bacteria 1666
192 Ga0495634_0002240 3300046642 Bacteria 16205
193 Ga0495634_0050855 3300046642 Bacteria 2781
194 Ga0495635_0000488 3300046663 Bacteria 25029
195 Ga0495635_0005559 3300046663 Bacteria 8772
196 Ga0495588_0034113 3300046674 Bacteria 2574
197 Ga0495657_0028691 3300046675 Bacteria 3910
198 Ga0495599_0005045 3300046678 Bacteria 7854
199 Ga0495599_0218091 3300046678 Bacteria 1168
200 Ga0495599_0413951 3300046678 Bacteria 801
201 Ga0495623_0005993 3300046679 Bacteria 7906
202 Ga0495646_0524580 3300046680 Bacteria 607
203 Ga0495647_0003052 3300046681 Bacteria 5338
204 Ga0495658_0007931 3300046683 Bacteria 5257
205 Ga0495658_0353933 3300046683 Bacteria 933
206 Ga0495613_0006627 3300046689 Bacteria 8651
207 Ga0495613_0512511 3300046689 Bacteria 806
208 Ga0495624_0013743 3300046690 Bacteria 5514
209 Ga0495624_0045282 3300046690 Bacteria 2802
210 Ga0495624_0707801 3300046690 Bacteria 598
211 Ga0495671_0294503 3300046692 Bacteria 781
212 Ga0495600_0006590 3300046809 Bacteria 7071
213 Ga0495581_0001133 3300047315 Bacteria 14586
214 Ga0495604_0010508 3300047317 Bacteria 7339
215 Ga0495604_0773437 3300047317 Bacteria 606
216 Ga0495636_0339910 3300047318 Bacteria 707
217 Ga0495674_0001834 3300047319 Bacteria 20944
218 Ga0495674_0058108 3300047319 Bacteria 3383
219 Ga0495676_0008173 3300047321 Bacteria 9598
220 Ga0495680_0012051 3300047322 Bacteria 7629
221 Ga0495680_0085425 3300047322 Bacteria 2376
222 Ga0495675_0003618 3300047444 Bacteria 9322
223 Ga0495673_0143187 3300047469 Bacteria 930
224 Ga0495684_0001692 3300047471 Bacteria 17729
225 Ga0495684_0020744 3300047471 Bacteria 5063
226 Ga0495686_0069372 3300047472 Bacteria 2173
227 Ga0495593_0000177 3300047673 Bacteria 32957
228 Ga0495593_0126063 3300047673 Bacteria 1301
229 Ga0495602_0016485 3300048088 Bacteria 7431
230 Ga0495614_0142705 3300048089 Bacteria 1065
231 Ga0496101_0917008 3300048904 Bacteria 690
232 Ga0496102_1045835 3300048905 Bacteria 737
233 Ga0496104_0289847 3300048907 Unclassified 1549
234 Ga0496105_0292465 3300048908 Bacteria 1311
235 Ga0496106_1475501 3300048909 Bacteria 524
236 Ga0496108_0653241 3300048911 Bacteria 914
237 Ga0496109_0383659 3300048912 Bacteria 1327
238 Ga0496110_0448887 3300048913 Bacteria 1175
239 Ga0496111_0266097 3300048914 Bacteria 1272
240 Ga0496112_0000016 3300048915 Bacteria 194634
241 Ga0496112_0259020 3300048915 Bacteria 1689
242 Ga0496112_0266458 3300048915 Bacteria 1662
243 Ga0496119_0267992 3300048922 Bacteria 854
244 Ga0496121_0000330 3300048924 Bacteria 98687
245 Ga0496126_0268186 3300048929 Bacteria 1417
246 Ga0501036_0273939 3300049572 Bacteria 1413
247 Ga0501067_0056760 3300049583 Bacteria 2169
248 Ga0501045_0208496 3300049824 Bacteria 1456
249 nmdc:mga03683_55134_c1 3300050489 Bacteria 912
250 nmdc:mga03n38_165837_c1 3300050490 Bacteria 1121
251 nmdc:mga00v17_169271_c1 3300050491 Bacteria 1408
252 nmdc:mga0k408_36102_c1 3300050493 Bacteria 2836
253 nmdc:mga06z11_431305_c1 3300050494 Bacteria 795
254 nmdc:mga07m45_563541_c1 3300050496 Bacteria 658
255 nmdc:mga05p37_308551_c1 3300050507 Bacteria 1876
256 nmdc:mga08y16_577422_c1 3300050511 Bacteria 1135
257 nmdc:mga0sz30_236961_c1 3300050516 Bacteria 812
258 Ga0495601_0712162 3300053077 Bacteria 640
259 Ga0495612_0618353 3300053078 Bacteria 501
260 Ga0495595_0001136 3300053084 Bacteria 10309
261 Ga0495619_0005748 3300053085 Bacteria 7857
262 Ga0495619_0073351 3300053085 Bacteria 2294
263 Ga0500554_076590 3300053102 Bacteria 1096
264 Ga0500595_000977 3300053119 Bacteria 16054
265 Ga0500652_225616 3300053131 Bacteria 751
266 Ga0500568_0015205 3300053139 Bacteria 3450
267 Ga0500577_0000183 3300053142 Bacteria 16294
268 Ga0500590_299403 3300053148 Bacteria 606
269 Ga0500638_012785 3300053162 Bacteria 3773
270 Ga0500636_0047685 3300053177 Bacteria 2523
271 Ga0500636_0118406 3300053177 Bacteria 1488
272 Ga0500637_0000941 3300053178 Bacteria 11795
273 Ga0500601_000128 3300053737 Bacteria 15442
274 Ga0500601_003172 3300053737 Bacteria 1778
275 Ga0501084_1519702 3300054114 Bacteria 560
276 Ga0500661_000091 3300055283 Bacteria 14401
277 Ga0500661_061528 3300055283 Bacteria 679
278 2511398939 2511231028 Bacteria 8046582
279 2513696066 2513237101 Bacteria 7952346
280 2514011307 2513237161 Bacteria 8871253
281 2524438957 2524023205 Bacteria 8918781
282 2745074925 2744054633 Bacteria 8678936
283 2793060077 2791355196 Bacteria 7323613
284 2824608958 2824600985 Bacteria 8488197
285 2824609944 2824609381 Bacteria 8672835
286 2824687636 2824679649 Bacteria 8248951
287 2824774208 2824773399 Bacteria 8360218
288 2841952557 2841949485 Bacteria 8680857
289 2841967567 2841966195 Bacteria 8673214
290 2847934608 2847930680 Bacteria 9342022
291 2849080602 2849076700 Bacteria 7039503
292 2874610735 2874604998 Bacteria 7834745
293 2874623291 2874620515 Bacteria 8290088
294 2874635916 2874628541 Bacteria 8630250
295 2876766602 2876761206 Bacteria 10111113
296 2876811705 2876808645 Bacteria 8824342
297 2879088190 2879083081 Bacteria 8587928
298 2879118811 2879110137 Bacteria 8907982
299 2888388145 2888388044 Bacteria 7304136
300 2904670111 2904666416 Bacteria 8226587
301 2906650673 2906643746 Bacteria 8722424
302 2922362104 2922361189 Bacteria 7436256
303 2922395067 2922393267 Bacteria 8285685
304 2935911867 2935908558 Bacteria 8568796
305 2935928896 2935926038 Bacteria 8601059
306 2935938541 2935934488 Bacteria 8602579
307 2935945567 2935942939 Bacteria 8599779
308 2935954826 2935951376 Bacteria 8602333
309 2935970713 2935967501 Bacteria 8603075
310 2941537911 2941531003 Bacteria 7653939
311 8006964681 8006964411 Bacteria 8966052
312 8006991965 8006984368 Bacteria 9651211
313 8006999903 8006994254 Bacteria 8309700
314 8019688520 8019687851 Bacteria 8712826
315 8056970064 8056967851 Bacteria 9038162
316 Ga0207643_10010084
317 JGI25406J46586_10000165
318 JGI25406J46586_10000169
319 JGI25153J46596_10000647
320 JGI25153J46596_10035057
321 rootL2_10116353
322 rootH1_10098009
323 JGI25404J52841_10072972
324 Ga0055539_1020652
325 Ga0068869_101667428
326 Ga0070680_100081900
327 Ga0068868_101743180
328 Ga0070660_100172933
329 Ga0070691_10147209
330 Ga0070691_10332576
331 Ga0070668_101150754
332 Ga0070669_100301138
333 Ga0070675_100492363
334 Ga0070674_101450658
335 Ga0070659_101681356
336 Ga0070700_100766262
337 Ga0070663_100886992
338 Ga0070678_100430824
339 Ga0070662_100719124
340 Ga0070685_11629555
341 Ga0070679_101431851
342 Ga0068853_100067626
343 Ga0068853_101147738
344 Ga0070672_100151191
345 Ga0068855_100070379
346 Ga0068856_100304038
347 Ga0068852_100057850
348 Ga0068864_101941278
349 Ga0068870_11147394
350 Ga0068860_102029571
351 Ga0068862_100182871
352 Ga0081540_1006991
353 Ga0081540_1289174
354 Ga0081539_10000255
355 Ga0070715_10454860
356 Ga0070716_100537490
357 Ga0070712_101099269
358 Ga0075369_10274526
359 Ga0075366_10229150
360 Ga0075366_10724617
361 Ga0097621_102400638
362 Ga0099794_10004724
363 Ga0105244_10562390
364 Ga0105240_11724025
365 Ga0111539_10944090
366 Ga0105245_10836815
367 Ga0114129_10419508
368 Ga0105243_10904748
369 Ga0105238_10230960
370 Ga0099796_10027255
371 Ga0105239_11045423
372 Ga0105246_10358504
373 Ga0157371_11626544
374 Ga0157370_10806343
375 Ga0157378_12535273
376 Ga0157372_11703255
377 Ga0157375_10467946
378 Ga0157380_10258623
379 Ga0209677_103566
380 Ga0209758_1024636
381 Ga0209758_1036882
382 Ga0209758_1066338
383 Ga0209758_1091919
384 Ga0209257_1029073
385 Ga0207685_10242921
386 Ga0207705_10551189
387 Ga0207705_11067489
388 Ga0207705_11237159
389 Ga0207693_10211648
390 Ga0207663_10692419
391 Ga0207660_10387306
392 Ga0207660_11737597
393 Ga0207657_10010762
394 Ga0207652_10070986
395 Ga0207650_11165276
396 Ga0207659_11676528
397 Ga0207700_10166051
398 Ga0207664_10781526
399 Ga0207690_10931590
400 Ga0207709_10649976
401 Ga0207704_11051908
402 Ga0207691_10127936
403 Ga0207667_10180610
404 Ga0207667_10391882
405 Ga0207640_10180071
406 Ga0207677_11140730
407 Ga0207703_11494494
408 Ga0207678_10459538
409 Ga0207708_10070872
410 Ga0207641_11208112
411 Ga0207676_11576074
412 Ga0207674_10652504
413 Ga0207683_10247515
414 Ga0207698_10150779
415 Ga0209588_1153809
416 Ga0268266_11174238
417 Ga0268265_11734536
418 Ga0265334_10126509
419 Ga0307515_10182925
420 Ga0307516_10023962
421 Ga0307405_10379047
422 Ga0307413_10525046
423 Ga0307410_11238499
424 Ga0307410_11338663
425 Ga0307406_11110158
426 Ga0307406_11363262
427 Ga0307407_10629912
428 Ga0307412_10331958
429 Ga0307416_100349063
430 Ga0307411_10589173
431 Ga0307415_102255667
432 Ga0373934_0001991
433 Ga0373934_0422868
434 Ga0373923_0009615
435 Ga0373936_0032173
436 Ga0373945_0005237
437 Ga0373953_0002044
438 Ga0373954_0001997
439 Ga0373954_0069901
440 Ga0373956_0000896
441 Ga0373957_0003097
442 Ga0373943_0028686
443 Ga0373946_0015389
444 Ga0373955_0018962
445 Ga0373955_0108818
446 Ga0373924_0008078
447 Ga0373931_0265575
448 Ga0373935_0000495
449 Ga0373927_0000308
450 Ga0373933_0002192
451 Ga0373947_0005725
452 Ga0373947_0035566
453 Ga0373937_0805149
454 Ga0373925_0026337
455 Ga0395899_0203494
456 Ga0451789_0668692
457 Ga0451802_0945258
458 Ga0451807_2338190
459 Ga0451855_0773600
460 Ga0466972_0000174
461 Ga0466968_0251782
462 Ga0466957_0268831
463 Ga0466959_0479095
464 Ga0466967_1154750
465 Ga0495592_0035125
466 Ga0495592_0408807
467 Ga0495603_0004869
468 Ga0495603_0139517
469 Ga0495603_0265552
470 Ga0495629_0000170
471 Ga0495629_0039554
472 Ga0495641_0002571
473 Ga0495651_0005295
474 Ga0495653_0002268
475 Ga0495580_0016736
476 Ga0495580_0132458
477 Ga0495582_0000053
478 Ga0495582_0651843
479 Ga0495639_0017358
480 Ga0495639_0129085
481 Ga0495662_0001239
482 Ga0495664_0139331
483 Ga0495584_0261087
484 Ga0495584_0652561
485 Ga0495584_0672483
486 Ga0495594_0000267
487 Ga0495594_0055687
488 Ga0495608_0004701
489 Ga0495618_0044831
490 Ga0495628_0006138
491 Ga0495628_0082136
492 Ga0495630_0036321
493 Ga0495630_0374736
494 Ga0495666_0026158
495 Ga0495652_0001842
496 Ga0495652_0057077
497 Ga0495665_0000132
498 Ga0495640_0001291
499 Ga0495640_0006962
500 Ga0495587_0021057
501 Ga0495587_0335042
502 Ga0495598_0316627
503 Ga0495645_0022585
504 Ga0495622_0001348
505 Ga0495667_0000849
506 Ga0495667_0124182
507 Ga0495634_0002240
508 Ga0495634_0050855
509 Ga0495635_0000488
510 Ga0495635_0005559
511 Ga0495588_0034113
512 Ga0495657_0028691
513 Ga0495599_0005045
514 Ga0495599_0218091
515 Ga0495599_0413951
516 Ga0495623_0005993
517 Ga0495646_0524580
518 Ga0495647_0003052
519 Ga0495658_0007931
520 Ga0495658_0353933
521 Ga0495613_0006627
522 Ga0495613_0512511
523 Ga0495624_0013743
524 Ga0495624_0045282
525 Ga0495624_0707801
526 Ga0495671_0294503
527 Ga0495600_0006590
528 Ga0495581_0001133
529 Ga0495604_0010508
530 Ga0495604_0773437
531 Ga0495636_0339910
532 Ga0495674_0001834
533 Ga0495674_0058108
534 Ga0495676_0008173
535 Ga0495680_0012051
536 Ga0495680_0085425
537 Ga0495675_0003618
538 Ga0495673_0143187
539 Ga0495684_0001692
540 Ga0495684_0020744
541 Ga0495686_0069372
542 Ga0495593_0000177
543 Ga0495593_0126063
544 Ga0495602_0016485
545 Ga0495614_0142705
546 Ga0496101_0917008
547 Ga0496102_1045835
548 Ga0496104_0289847
549 Ga0496105_0292465
550 Ga0496106_1475501
551 Ga0496108_0653241
552 Ga0496109_0383659
553 Ga0496110_0448887
554 Ga0496111_0266097
555 Ga0496112_0000016
556 Ga0496112_0259020
557 Ga0496112_0266458
558 Ga0496119_0267992
559 Ga0496121_0000330
560 Ga0496126_0268186
561 Ga0501036_0273939
562 Ga0501067_0056760
563 Ga0501045_0208496
564 nmdc:mga03683_55134_c1
565 nmdc:mga03n38_165837_c1
566 nmdc:mga00v17_169271_c1
567 nmdc:mga0k408_36102_c1
568 nmdc:mga06z11_431305_c1
569 nmdc:mga07m45_563541_c1
570 nmdc:mga05p37_308551_c1
571 nmdc:mga08y16_577422_c1
572 nmdc:mga0sz30_236961_c1
573 Ga0495601_0712162
574 Ga0495612_0618353
575 Ga0495595_0001136
576 Ga0495619_0005748
577 Ga0495619_0073351
578 Ga0500554_076590
579 Ga0500595_000977
580 Ga0500652_225616
581 Ga0500568_0015205
582 Ga0500577_0000183
583 Ga0500590_299403
584 Ga0500638_012785
585 Ga0500636_0047685
586 Ga0500636_0118406
587 Ga0500637_0000941
588 Ga0500601_000128
589 Ga0500601_003172
590 Ga0501084_1519702
591 Ga0500661_000091
592 Ga0500661_061528
593 2511398939
594 2513696066
595 2514011307
596 2524438957
597 2745074925
598 2793060077
599 2824608958
600 2824609944
601 2824687636
602 2824774208
603 2841952557
604 2841967567
605 2847934608
606 2849080602
607 2874610735
608 2874623291
609 2874635916
610 2876766602
611 2876811705
612 2879088190
613 2879118811
614 2888388145
615 2904670111
616 2906650673
617 2922362104
618 2922395067
619 2935911867
620 2935928896
621 2935938541
622 2935945567
623 2935954826
624 2935970713
625 2941537911
626 8006964681
627 8006991965
628 8006999903
629 8019688520
630 8056970064

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jrm-assembly1.cif.gz_A solution nmr structure of ribosome modulation factor vp1593 from vibrio parahaemolyticus. northeast structural genomics target vpr55 0.8413 5 48
2ioy-assembly2.cif.gz_B crystal structure of thermoanaerobacter tengcongensis ribose binding protein 0.753 4 44
6hb0-assembly2.cif.gz_B crystal structure of msmeg_1712 from mycobacterium smegmatis 0.7128 4 44
3m9x-assembly1.cif.gz_A open liganded crystal structure of xylose binding protein from escherichia coli 0.7029 4 48
2jrm-assembly1.cif.gz_A solution nmr structure of ribosome modulation factor vp1593 from vibrio parahaemolyticus. northeast structural genomics target vpr55 0.6922 5 48
ID Description Score Start End Superfamily
2jrmA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;ribosome modulation factor like domain 0.8413 5 48 1.10.10.620
af_G5EEY5_36_153_1.20.920.10 Mainly Alpha;Up-down Bundle;Histone Acetyltransferase; Chain A;Bromodomain-like 0.7616 22 50 1.20.920.10
af_E9QIL2_1_138_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.7548 21 41 2.30.42.10
5dteD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7377 4 44 3.40.50.2300
af_P37387_122_310_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7056 4 48 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A5B8CSV3-F1-model_v4 Uncharacterized protein 1.012 5 37
AF-A0A3D5CX93-F1-model_v4 Uncharacterized protein 1.011 5 37
AF-A0A354V2W7-F1-model_v4 Uncharacterized protein 1.006 8 48
AF-A0A840ZN06-F1-model_v4 Uncharacterized protein 1.005 5 41
AF-A0A1Y6KDT0-F1-model_v4 Uncharacterized protein 1.004 1 53

Map