F403115

General Info

Members Datasets Scaffolds Average Seq Length
315 212 630 112

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10096724|Ga0075366_100967242
Length 121
Sequence MTLRRTPARPAKPGADLLQGTLDMLVLQTLRLGAAHGYTIARLIEQRSDAFLQVEQGSLYPALNRLEDRGWVDSYWATSENNRRARYYRLTPKGRRQLQAESEQWDQLVRAIGLVMRPVQE

Samples

Sample ID Description Type Environment
1 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
169 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
181 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
182 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
183 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
184 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
195 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
202 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
203 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.21
Nodule 0
Rhizoplane 1.59
Rhizosphere 88.25
Stem 0
Stem Tuber 0
Unclassified 20.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075366_10096724 3300006195 Bacteria 1770
2 MBSR1b_contig_5118228 2162886012 Unclassified 1721
3 JGI24743J22301_10055596 3300001991 Bacteria 811
4 Ga0065704_10309549 3300005289 Unclassified 871
5 Ga0065715_10095938 3300005293 Bacteria 3977
6 Ga0065715_10309690 3300005293 Bacteria 1023
7 Ga0065707_10016588 3300005295 Bacteria 2073
8 Ga0065707_10107742 3300005295 Bacteria 2541
9 Ga0070658_10325963 3300005327 Bacteria 1312
10 Ga0070676_10057740 3300005328 Bacteria 2298
11 Ga0070676_10916965 3300005328 Bacteria 653
12 Ga0070683_100061801 3300005329 Bacteria 3482
13 Ga0070690_100027983 3300005330 Bacteria 3488
14 Ga0070690_100047038 3300005330 Bacteria 2744
15 Ga0070670_100000904 3300005331 Bacteria 23331
16 Ga0070670_100073857 3300005331 Bacteria 2929
17 Ga0070670_100084768 3300005331 Bacteria 2722
18 Ga0070677_10059244 3300005333 Bacteria 1574
19 Ga0068869_100003001 3300005334 Bacteria 10258
20 Ga0070680_100004935 3300005336 Bacteria 10044
21 Ga0070682_100050092 3300005337 Bacteria 2606
22 Ga0068868_100128908 3300005338 Bacteria 2069
23 Ga0068868_100171096 3300005338 Bacteria 1798
24 Ga0070660_100065396 3300005339 Bacteria 2830
25 Ga0070689_100030409 3300005340 Bacteria 4099
26 Ga0070689_101129972 3300005340 Unclassified 701
27 Ga0070689_101348488 3300005340 Unclassified 643
28 Ga0070691_10011441 3300005341 Bacteria 4052
29 Ga0070687_100166676 3300005343 Bacteria 1307
30 Ga0070661_100012169 3300005344 Bacteria 6016
31 Ga0070692_10002896 3300005345 Bacteria 6806
32 Ga0070668_100229706 3300005347 Unclassified 1533
33 Ga0070668_101027425 3300005347 Bacteria 742
34 Ga0070669_100002771 3300005353 Bacteria 12642
35 Ga0070675_100035351 3300005354 Bacteria 4059
36 Ga0070675_100113016 3300005354 Bacteria 2300
37 Ga0070675_101848592 3300005354 Bacteria 557
38 Ga0070671_100116047 3300005355 Bacteria 2251
39 Ga0070671_100122993 3300005355 Bacteria 2184
40 Ga0070673_100041394 3300005364 Bacteria 3543
41 Ga0070673_100603531 3300005364 Unclassified 1001
42 Ga0070688_100477193 3300005365 Bacteria 937
43 Ga0070659_100003006 3300005366 Bacteria 12008
44 Ga0070667_100497374 3300005367 Bacteria 1117
45 Ga0070703_10024336 3300005406 Bacteria 1789
46 Ga0070709_11193741 3300005434 Unclassified 611
47 Ga0070713_100086910 3300005436 Unclassified 2682
48 Ga0070701_10015940 3300005438 Bacteria 3483
49 Ga0070700_101412204 3300005441 Unclassified 589
50 Ga0070694_100120282 3300005444 Bacteria 1883
51 Ga0070708_101753126 3300005445 Bacteria 577
52 Ga0070663_102177770 3300005455 Bacteria 500
53 Ga0070662_100074550 3300005457 Bacteria 2511
54 Ga0070681_10001026 3300005458 Bacteria 23676
55 Ga0068867_100020600 3300005459 Bacteria 4698
56 Ga0070707_101387456 3300005468 Unclassified 669
57 Ga0070698_100263690 3300005471 Unclassified 1655
58 Ga0070698_101365277 3300005471 Bacteria 659
59 Ga0070679_100003753 3300005530 Bacteria 13931
60 Ga0070684_100802846 3300005535 Bacteria 880
61 Ga0070672_100064589 3300005543 Bacteria 2892
62 Ga0070672_100451440 3300005543 Unclassified 1107
63 Ga0070686_100020442 3300005544 Bacteria 3916
64 Ga0070686_100293137 3300005544 Bacteria 1204
65 Ga0070695_100008201 3300005545 Bacteria 6195
66 Ga0070695_100460190 3300005545 Bacteria 976
67 Ga0070693_100002182 3300005547 Bacteria 8970
68 Ga0070665_100313883 3300005548 Bacteria 1572
69 Ga0070665_100710312 3300005548 Unclassified 1018
70 Ga0070704_100545021 3300005549 Bacteria 1013
71 Ga0068855_100394702 3300005563 Bacteria 1517
72 Ga0070664_100013994 3300005564 Bacteria 6543
73 Ga0070664_100041600 3300005564 Bacteria 3878
74 Ga0070664_100679413 3300005564 Bacteria 958
75 Ga0068857_100051900 3300005577 Bacteria 3639
76 Ga0068857_100073897 3300005577 Unclassified 3038
77 Ga0068857_100107681 3300005577 Unclassified 2503
78 Ga0068854_100452571 3300005578 Bacteria 1072
79 Ga0068856_100007153 3300005614 Bacteria 10883
80 Ga0068856_102244576 3300005614 Unclassified 554
81 Ga0070702_100002041 3300005615 Bacteria 8541
82 Ga0068852_100012654 3300005616 Bacteria 6416
83 Ga0068852_101304515 3300005616 Bacteria 748
84 Ga0068859_100005430 3300005617 Bacteria 12965
85 Ga0068859_100016484 3300005617 Bacteria 7421
86 Ga0068859_100267438 3300005617 Bacteria 1801
87 Ga0068859_101143332 3300005617 Bacteria 857
88 Ga0068859_102248591 3300005617 Bacteria 602
89 Ga0068864_100002595 3300005618 Bacteria 14928
90 Ga0068864_100059880 3300005618 Bacteria 3296
91 Ga0068866_10185862 3300005718 Bacteria 1231
92 Ga0068861_101404443 3300005719 Bacteria 682
93 Ga0068861_102185218 3300005719 Unclassified 554
94 Ga0068851_10150928 3300005834 Bacteria 1270
95 Ga0068870_10206734 3300005840 Bacteria 1193
96 Ga0068870_10407332 3300005840 Unclassified 886
97 Ga0068863_100018332 3300005841 Bacteria 6701
98 Ga0068863_100423151 3300005841 Bacteria 1305
99 Ga0068858_100232840 3300005842 Bacteria 1746
100 Ga0068858_101038700 3300005842 Bacteria 804
101 Ga0068862_100029872 3300005844 Bacteria 4593
102 Ga0081455_10077920 3300005937 Bacteria 2725
103 Ga0081455_10604381 3300005937 Bacteria 714
104 Ga0075365_10164938 3300006038 Unclassified 1545
105 Ga0075365_10221271 3300006038 Bacteria 1328
106 Ga0075368_10182342 3300006042 Bacteria 885
107 Ga0075363_100561978 3300006048 Unclassified 681
108 Ga0075364_10001050 3300006051 Bacteria 14693
109 Ga0075364_10002130 3300006051 Bacteria 11077
110 Ga0075364_10048514 3300006051 Bacteria 2767
111 Ga0070716_101452020 3300006173 Bacteria 559
112 Ga0075362_10003268 3300006177 Bacteria 5634
113 Ga0075367_10013736 3300006178 Bacteria 4365
114 Ga0075367_10049647 3300006178 Bacteria 2474
115 Ga0075369_10105657 3300006186 Unclassified 1266
116 Ga0075366_10032248 3300006195 Bacteria 3085
117 Ga0075366_10190545 3300006195 Bacteria 1246
118 Ga0075370_10074058 3300006353 Unclassified 1951
119 Ga0068871_100012899 3300006358 Bacteria 6189
120 Ga0075428_100005713 3300006844 Bacteria 13827
121 Ga0075430_100584791 3300006846 Bacteria 921
122 Ga0075431_100031738 3300006847 Bacteria 5442
123 Ga0075433_10885420 3300006852 Unclassified 779
124 Ga0075434_102238243 3300006871 Unclassified 550
125 Ga0075429_100593960 3300006880 Unclassified 970
126 Ga0075436_100240250 3300006914 Bacteria 1288
127 Ga0075436_100255628 3300006914 Unclassified 1248
128 Ga0075436_100261875 3300006914 Bacteria 1233
129 Ga0075436_100740291 3300006914 Bacteria 730
130 Ga0097620_100005430 3300006931 Bacteria 12965
131 Ga0097620_100016484 3300006931 Bacteria 7421
132 Ga0097620_100267434 3300006931 Bacteria 1801
133 Ga0097620_101142923 3300006931 Bacteria 857
134 Ga0097620_102248483 3300006931 Bacteria 602
135 Ga0075435_100186455 3300007076 Bacteria 1754
136 Ga0075435_100238365 3300007076 Bacteria 1546
137 Ga0105240_10203177 3300009093 Bacteria 2321
138 Ga0105240_10800803 3300009093 Bacteria 1021
139 Ga0111539_10011599 3300009094 Bacteria 11059
140 Ga0111539_10193734 3300009094 Unclassified 2371
141 Ga0111539_10259252 3300009094 Bacteria 2024
142 Ga0111539_10939310 3300009094 Bacteria 1006
143 Ga0105245_10003237 3300009098 Bacteria 14586
144 Ga0105245_10935791 3300009098 Bacteria 909
145 Ga0114129_10002789 3300009147 Bacteria 24359
146 Ga0114129_11973376 3300009147 Bacteria 706
147 Ga0105243_10120896 3300009148 Bacteria 2207
148 Ga0105243_12233988 3300009148 Unclassified 584
149 Ga0105241_10008003 3300009174 Bacteria 7775
150 Ga0105242_10149451 3300009176 Bacteria 2036
151 Ga0105248_10006379 3300009177 Bacteria 12943
152 Ga0105248_10049888 3300009177 Bacteria 4693
153 Ga0105248_10988207 3300009177 Bacteria 951
154 Ga0105238_10247382 3300009551 Bacteria 1761
155 Ga0105249_10003255 3300009553 Bacteria 14068
156 Ga0105249_10197627 3300009553 Unclassified 1966
157 Ga0099796_10399777 3300010159 Unclassified 602
158 Ga0105239_10590562 3300010375 Bacteria 1266
159 Ga0105239_12059043 3300010375 Bacteria 663
160 Ga0105246_10042631 3300011119 Bacteria 3074
161 Ga0105246_10428405 3300011119 Bacteria 1106
162 Ga0157373_10031191 3300013100 Bacteria 3836
163 Ga0157371_10013707 3300013102 Bacteria 6148
164 Ga0157369_11482468 3300013105 Unclassified 690
165 Ga0157378_11801650 3300013297 Bacteria 660
166 Ga0157372_10118778 3300013307 Bacteria 3034
167 Ga0157372_10143349 3300013307 Unclassified 2755
168 Ga0163163_10014307 3300014325 Bacteria 7293
169 Ga0163163_10221968 3300014325 Unclassified 1939
170 Ga0163163_10284276 3300014325 Bacteria 1706
171 Ga0163163_10634287 3300014325 Bacteria 1132
172 Ga0157377_10000886 3300014745 Bacteria 12486
173 Ga0157377_10095956 3300014745 Unclassified 1758
174 Ga0157379_10158632 3300014968 Bacteria 2042
175 Ga0157376_10000608 3300014969 Bacteria 23136
176 Ga0157376_11925696 3300014969 Unclassified 628
177 Ga0163161_10829376 3300017792 Bacteria 779
178 Ga0213875_10002568 3300021388 Bacteria 10817
179 Ga0207656_10154645 3300025321 Bacteria 1088
180 Ga0207642_10038193 3300025899 Bacteria 2076
181 Ga0207688_10756132 3300025901 Unclassified 615
182 Ga0207699_10233805 3300025906 Bacteria 1260
183 Ga0207645_10167273 3300025907 Bacteria 1440
184 Ga0207705_10511443 3300025909 Bacteria 933
185 Ga0207654_10017587 3300025911 Bacteria 3741
186 Ga0207707_10003652 3300025912 Bacteria 13646
187 Ga0207660_10017990 3300025917 Bacteria 4707
188 Ga0207662_11008773 3300025918 Bacteria 591
189 Ga0207649_10160263 3300025920 Bacteria 1558
190 Ga0207652_10758630 3300025921 Bacteria 863
191 Ga0207681_10004599 3300025923 Bacteria 8488
192 Ga0207694_10432138 3300025924 Bacteria 1098
193 Ga0207650_10077514 3300025925 Unclassified 2513
194 Ga0207650_10140952 3300025925 Bacteria 1895
195 Ga0207659_10029882 3300025926 Bacteria 3718
196 Ga0207687_10048031 3300025927 Bacteria 2961
197 Ga0207700_10111563 3300025928 Bacteria 2201
198 Ga0207644_10113853 3300025931 Bacteria 2049
199 Ga0207644_10391600 3300025931 Bacteria 1134
200 Ga0207690_10059730 3300025932 Bacteria 2584
201 Ga0207706_10089377 3300025933 Bacteria 2708
202 Ga0207686_10740123 3300025934 Bacteria 784
203 Ga0207709_10247552 3300025935 Bacteria 1300
204 Ga0207670_10048466 3300025936 Bacteria 2835
205 Ga0207670_11238634 3300025936 Unclassified 632
206 Ga0207670_11688040 3300025936 Unclassified 539
207 Ga0207691_10005247 3300025940 Bacteria 12508
208 Ga0207691_10583001 3300025940 Unclassified 947
209 Ga0207711_10011374 3300025941 Bacteria 7396
210 Ga0207711_10011816 3300025941 Bacteria 7256
211 Ga0207689_10012602 3300025942 Bacteria 7222
212 Ga0207661_10003472 3300025944 Bacteria 10947
213 Ga0207679_10019836 3300025945 Bacteria 4526
214 Ga0207679_11302010 3300025945 Bacteria 667
215 Ga0207651_10021017 3300025960 Bacteria 3955
216 Ga0207712_10037191 3300025961 Bacteria 3320
217 Ga0207712_10206811 3300025961 Bacteria 1560
218 Ga0207668_10419933 3300025972 Unclassified 1135
219 Ga0207677_10023493 3300026023 Bacteria 3811
220 Ga0207677_10153900 3300026023 Bacteria 1778
221 Ga0207703_10087473 3300026035 Bacteria 2613
222 Ga0207708_10427948 3300026075 Unclassified 1099
223 Ga0207702_10022890 3300026078 Bacteria 5184
224 Ga0207641_11161436 3300026088 Bacteria 771
225 Ga0207676_10016173 3300026095 Bacteria 5399
226 Ga0207676_10044063 3300026095 Bacteria 3440
227 Ga0207676_10866606 3300026095 Bacteria 884
228 Ga0207674_10000013 3300026116 Bacteria 187953
229 Ga0207674_10084599 3300026116 Unclassified 3170
230 Ga0207674_10091037 3300026116 Unclassified 3041
231 Ga0207698_10006644 3300026142 Bacteria 7233
232 Ga0207698_10455276 3300026142 Bacteria 1236
233 Ga0209983_1016706 3300027665 Bacteria 1517
234 Ga0209813_10110545 3300027866 Bacteria 946
235 Ga0207428_10022063 3300027907 Bacteria 5378
236 Ga0268265_10070641 3300028380 Unclassified 2716
237 Ga0268265_11063968 3300028380 Bacteria 802
238 Ga0265323_10004836 3300028653 Bacteria 5768
239 Ga0265325_10235541 3300031241 Bacteria 833
240 Ga0265316_10110932 3300031344 Bacteria 2077
241 Ga0307408_100668950 3300031548 Bacteria 930
242 Ga0307408_102357209 3300031548 Unclassified 516
243 Ga0307405_11144276 3300031731 Bacteria 671
244 Ga0307413_10029601 3300031824 Bacteria 3066
245 Ga0307406_11125348 3300031901 Unclassified 679
246 Ga0307407_10275622 3300031903 Bacteria 1163
247 Ga0307412_10586333 3300031911 Bacteria 942
248 Ga0307412_10704482 3300031911 Bacteria 867
249 Ga0307412_11934852 3300031911 Unclassified 545
250 Ga0307416_100217623 3300032002 Unclassified 1829
251 Ga0307416_100373701 3300032002 Bacteria 1452
252 Ga0307416_102860739 3300032002 Unclassified 577
253 Ga0307411_10313819 3300032005 Bacteria 1263
254 Ga0307411_12180105 3300032005 Bacteria 519
255 Ga0307415_100034805 3300032126 Bacteria 3284
256 Ga0373930_0138789 3300034816 Bacteria 603
257 Ga0373949_0302601 3300035090 Bacteria 508
258 Ga0373941_0066525 3300035115 Bacteria 1186
259 Ga0373954_0060060 3300035118 Unclassified 1793
260 Ga0373956_0365596 3300035119 Bacteria 688
261 Ga0373955_0109291 3300035172 Bacteria 1597
262 Ga0373942_0082533 3300035207 Unclassified 957
263 Ga0373962_0142839 3300035242 Bacteria 779
264 Ga0373931_0121606 3300035691 Bacteria 1493
265 Ga0373931_1246176 3300035691 Bacteria 510
266 Ga0373937_0177588 3300036401 Bacteria 1999
267 Ga0436364_1471477 3300037853 Bacteria 27952
268 Ga0436365_0366134 3300039437 Bacteria 669
269 Ga0451789_0538019 3300041443 Unclassified 509
270 Ga0451807_2597508 3300041486 Bacteria 548
271 Ga0439443_089911 3300042003 Unclassified 579
272 Ga0439444_0029742 3300042437 Unclassified 1019
273 Ga0439459_0066914 3300042438 Bacteria 823
274 Ga0466967_0156027 3300045976 Unclassified 2138
275 Ga0495645_0046882 3300046543 Bacteria 3150
276 Ga0495668_0245832 3300046616 Bacteria 980
277 Ga0495623_0299444 3300046679 Unclassified 889
278 Ga0496105_0749250 3300048908 Bacteria 746
279 Ga0496112_0205459 3300048915 Bacteria 1928
280 Ga0496112_0807106 3300048915 Bacteria 863
281 Ga0501034_0014728 3300049571 Bacteria 8048
282 Ga0501075_0858818 3300049591 Bacteria 690
283 Ga0501076_0544707 3300049592 Bacteria 957
284 Ga0501216_130851 3300049660 Bacteria 582
285 Ga0501268_071438 3300049765 Bacteria 703
286 nmdc:mga03683_3095_c1 3300050489 Bacteria 5291
287 nmdc:mga03n38_814298_c1 3300050490 Unclassified 544
288 nmdc:mga00v17_20225_c1 3300050491 Bacteria 3811
289 nmdc:mga00v17_8515_c1 3300050491 Bacteria 5521
290 nmdc:mga0yw44_306276_c1 3300050492 Bacteria 1065
291 nmdc:mga0yw44_451691_c1 3300050492 Unclassified 871
292 nmdc:mga0k408_107143_c1 3300050493 Bacteria 1651
293 nmdc:mga0k408_159072_c1 3300050493 Bacteria 1345
294 nmdc:mga0k408_3387_c1 3300050493 Bacteria 8447
295 nmdc:mga06z11_133655_c1 3300050494 Unclassified 1396
296 nmdc:mga06z11_80556_c1 3300050494 Bacteria 1746
297 nmdc:mga04h51_36818_c1 3300050495 Bacteria 1576
298 nmdc:mga07m45_13286_c1 3300050496 Bacteria 4366
299 nmdc:mga05p37_2385_c1 3300050507 Bacteria 21856
300 nmdc:mga09592_507183_c1 3300050508 Unclassified 1038
301 nmdc:mga09592_593931_c1 3300050508 Unclassified 949
302 nmdc:mga06r32_1079515_c1 3300050510 Bacteria 752
303 nmdc:mga06r32_12795_c1 3300050510 Bacteria 7586
304 nmdc:mga08y16_1497734_c1 3300050511 Bacteria 635
305 nmdc:mga08y16_27792_c1 3300050511 Bacteria 5962
306 nmdc:mga08y16_806725_c1 3300050511 Bacteria 931
307 nmdc:mga0n895_2216673_c1 3300050512 Unclassified 504
308 nmdc:mga0n895_386326_c1 3300050512 Bacteria 1416
309 nmdc:mga0rr50_25503_c1 3300050513 Bacteria 4111
310 nmdc:mga0rr50_38570_c1 3300050513 Bacteria 3459
311 nmdc:mga08x19_251602_c1 3300050514 Bacteria 1220
312 nmdc:mga08x19_68267_c1 3300050514 Bacteria 2314
313 Ga0590071_097394 3300059421 Unclassified 739
314 Ga0590071_112869 3300059421 Bacteria 690
315 Ga0501082_1472035 3300060353 Bacteria 595
316 Ga0075366_10096724
317 MBSR1b_contig_5118228
318 JGI24743J22301_10055596
319 Ga0065704_10309549
320 Ga0065715_10095938
321 Ga0065715_10309690
322 Ga0065707_10016588
323 Ga0065707_10107742
324 Ga0070658_10325963
325 Ga0070676_10057740
326 Ga0070676_10916965
327 Ga0070683_100061801
328 Ga0070690_100027983
329 Ga0070690_100047038
330 Ga0070670_100000904
331 Ga0070670_100073857
332 Ga0070670_100084768
333 Ga0070677_10059244
334 Ga0068869_100003001
335 Ga0070680_100004935
336 Ga0070682_100050092
337 Ga0068868_100128908
338 Ga0068868_100171096
339 Ga0070660_100065396
340 Ga0070689_100030409
341 Ga0070689_101129972
342 Ga0070689_101348488
343 Ga0070691_10011441
344 Ga0070687_100166676
345 Ga0070661_100012169
346 Ga0070692_10002896
347 Ga0070668_100229706
348 Ga0070668_101027425
349 Ga0070669_100002771
350 Ga0070675_100035351
351 Ga0070675_100113016
352 Ga0070675_101848592
353 Ga0070671_100116047
354 Ga0070671_100122993
355 Ga0070673_100041394
356 Ga0070673_100603531
357 Ga0070688_100477193
358 Ga0070659_100003006
359 Ga0070667_100497374
360 Ga0070703_10024336
361 Ga0070709_11193741
362 Ga0070713_100086910
363 Ga0070701_10015940
364 Ga0070700_101412204
365 Ga0070694_100120282
366 Ga0070708_101753126
367 Ga0070663_102177770
368 Ga0070662_100074550
369 Ga0070681_10001026
370 Ga0068867_100020600
371 Ga0070707_101387456
372 Ga0070698_100263690
373 Ga0070698_101365277
374 Ga0070679_100003753
375 Ga0070684_100802846
376 Ga0070672_100064589
377 Ga0070672_100451440
378 Ga0070686_100020442
379 Ga0070686_100293137
380 Ga0070695_100008201
381 Ga0070695_100460190
382 Ga0070693_100002182
383 Ga0070665_100313883
384 Ga0070665_100710312
385 Ga0070704_100545021
386 Ga0068855_100394702
387 Ga0070664_100013994
388 Ga0070664_100041600
389 Ga0070664_100679413
390 Ga0068857_100051900
391 Ga0068857_100073897
392 Ga0068857_100107681
393 Ga0068854_100452571
394 Ga0068856_100007153
395 Ga0068856_102244576
396 Ga0070702_100002041
397 Ga0068852_100012654
398 Ga0068852_101304515
399 Ga0068859_100005430
400 Ga0068859_100016484
401 Ga0068859_100267438
402 Ga0068859_101143332
403 Ga0068859_102248591
404 Ga0068864_100002595
405 Ga0068864_100059880
406 Ga0068866_10185862
407 Ga0068861_101404443
408 Ga0068861_102185218
409 Ga0068851_10150928
410 Ga0068870_10206734
411 Ga0068870_10407332
412 Ga0068863_100018332
413 Ga0068863_100423151
414 Ga0068858_100232840
415 Ga0068858_101038700
416 Ga0068862_100029872
417 Ga0081455_10077920
418 Ga0081455_10604381
419 Ga0075365_10164938
420 Ga0075365_10221271
421 Ga0075368_10182342
422 Ga0075363_100561978
423 Ga0075364_10001050
424 Ga0075364_10002130
425 Ga0075364_10048514
426 Ga0070716_101452020
427 Ga0075362_10003268
428 Ga0075367_10013736
429 Ga0075367_10049647
430 Ga0075369_10105657
431 Ga0075366_10032248
432 Ga0075366_10190545
433 Ga0075370_10074058
434 Ga0068871_100012899
435 Ga0075428_100005713
436 Ga0075430_100584791
437 Ga0075431_100031738
438 Ga0075433_10885420
439 Ga0075434_102238243
440 Ga0075429_100593960
441 Ga0075436_100240250
442 Ga0075436_100255628
443 Ga0075436_100261875
444 Ga0075436_100740291
445 Ga0097620_100005430
446 Ga0097620_100016484
447 Ga0097620_100267434
448 Ga0097620_101142923
449 Ga0097620_102248483
450 Ga0075435_100186455
451 Ga0075435_100238365
452 Ga0105240_10203177
453 Ga0105240_10800803
454 Ga0111539_10011599
455 Ga0111539_10193734
456 Ga0111539_10259252
457 Ga0111539_10939310
458 Ga0105245_10003237
459 Ga0105245_10935791
460 Ga0114129_10002789
461 Ga0114129_11973376
462 Ga0105243_10120896
463 Ga0105243_12233988
464 Ga0105241_10008003
465 Ga0105242_10149451
466 Ga0105248_10006379
467 Ga0105248_10049888
468 Ga0105248_10988207
469 Ga0105238_10247382
470 Ga0105249_10003255
471 Ga0105249_10197627
472 Ga0099796_10399777
473 Ga0105239_10590562
474 Ga0105239_12059043
475 Ga0105246_10042631
476 Ga0105246_10428405
477 Ga0157373_10031191
478 Ga0157371_10013707
479 Ga0157369_11482468
480 Ga0157378_11801650
481 Ga0157372_10118778
482 Ga0157372_10143349
483 Ga0163163_10014307
484 Ga0163163_10221968
485 Ga0163163_10284276
486 Ga0163163_10634287
487 Ga0157377_10000886
488 Ga0157377_10095956
489 Ga0157379_10158632
490 Ga0157376_10000608
491 Ga0157376_11925696
492 Ga0163161_10829376
493 Ga0213875_10002568
494 Ga0207656_10154645
495 Ga0207642_10038193
496 Ga0207688_10756132
497 Ga0207699_10233805
498 Ga0207645_10167273
499 Ga0207705_10511443
500 Ga0207654_10017587
501 Ga0207707_10003652
502 Ga0207660_10017990
503 Ga0207662_11008773
504 Ga0207649_10160263
505 Ga0207652_10758630
506 Ga0207681_10004599
507 Ga0207694_10432138
508 Ga0207650_10077514
509 Ga0207650_10140952
510 Ga0207659_10029882
511 Ga0207687_10048031
512 Ga0207700_10111563
513 Ga0207644_10113853
514 Ga0207644_10391600
515 Ga0207690_10059730
516 Ga0207706_10089377
517 Ga0207686_10740123
518 Ga0207709_10247552
519 Ga0207670_10048466
520 Ga0207670_11238634
521 Ga0207670_11688040
522 Ga0207691_10005247
523 Ga0207691_10583001
524 Ga0207711_10011374
525 Ga0207711_10011816
526 Ga0207689_10012602
527 Ga0207661_10003472
528 Ga0207679_10019836
529 Ga0207679_11302010
530 Ga0207651_10021017
531 Ga0207712_10037191
532 Ga0207712_10206811
533 Ga0207668_10419933
534 Ga0207677_10023493
535 Ga0207677_10153900
536 Ga0207703_10087473
537 Ga0207708_10427948
538 Ga0207702_10022890
539 Ga0207641_11161436
540 Ga0207676_10016173
541 Ga0207676_10044063
542 Ga0207676_10866606
543 Ga0207674_10000013
544 Ga0207674_10084599
545 Ga0207674_10091037
546 Ga0207698_10006644
547 Ga0207698_10455276
548 Ga0209983_1016706
549 Ga0209813_10110545
550 Ga0207428_10022063
551 Ga0268265_10070641
552 Ga0268265_11063968
553 Ga0265323_10004836
554 Ga0265325_10235541
555 Ga0265316_10110932
556 Ga0307408_100668950
557 Ga0307408_102357209
558 Ga0307405_11144276
559 Ga0307413_10029601
560 Ga0307406_11125348
561 Ga0307407_10275622
562 Ga0307412_10586333
563 Ga0307412_10704482
564 Ga0307412_11934852
565 Ga0307416_100217623
566 Ga0307416_100373701
567 Ga0307416_102860739
568 Ga0307411_10313819
569 Ga0307411_12180105
570 Ga0307415_100034805
571 Ga0373930_0138789
572 Ga0373949_0302601
573 Ga0373941_0066525
574 Ga0373954_0060060
575 Ga0373956_0365596
576 Ga0373955_0109291
577 Ga0373942_0082533
578 Ga0373962_0142839
579 Ga0373931_0121606
580 Ga0373931_1246176
581 Ga0373937_0177588
582 Ga0436364_1471477
583 Ga0436365_0366134
584 Ga0451789_0538019
585 Ga0451807_2597508
586 Ga0439443_089911
587 Ga0439444_0029742
588 Ga0439459_0066914
589 Ga0466967_0156027
590 Ga0495645_0046882
591 Ga0495668_0245832
592 Ga0495623_0299444
593 Ga0496105_0749250
594 Ga0496112_0205459
595 Ga0496112_0807106
596 Ga0501034_0014728
597 Ga0501075_0858818
598 Ga0501076_0544707
599 Ga0501216_130851
600 Ga0501268_071438
601 nmdc:mga03683_3095_c1
602 nmdc:mga03n38_814298_c1
603 nmdc:mga00v17_20225_c1
604 nmdc:mga00v17_8515_c1
605 nmdc:mga0yw44_306276_c1
606 nmdc:mga0yw44_451691_c1
607 nmdc:mga0k408_107143_c1
608 nmdc:mga0k408_159072_c1
609 nmdc:mga0k408_3387_c1
610 nmdc:mga06z11_133655_c1
611 nmdc:mga06z11_80556_c1
612 nmdc:mga04h51_36818_c1
613 nmdc:mga07m45_13286_c1
614 nmdc:mga05p37_2385_c1
615 nmdc:mga09592_507183_c1
616 nmdc:mga09592_593931_c1
617 nmdc:mga06r32_1079515_c1
618 nmdc:mga06r32_12795_c1
619 nmdc:mga08y16_1497734_c1
620 nmdc:mga08y16_27792_c1
621 nmdc:mga08y16_806725_c1
622 nmdc:mga0n895_2216673_c1
623 nmdc:mga0n895_386326_c1
624 nmdc:mga0rr50_25503_c1
625 nmdc:mga0rr50_38570_c1
626 nmdc:mga08x19_251602_c1
627 nmdc:mga08x19_68267_c1
628 Ga0590071_097394
629 Ga0590071_112869
630 Ga0501082_1472035

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

26

100

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9273 14 110
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9016 7 106
7wjp-assembly1.cif.gz_A-2 structure of padr-like protein from listeria monocytogenes 0.8958 9 111
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.8892 7 106
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.889 5 110
ID Description Score Start End Superfamily
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9216 14 110 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8981 14 95 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8892 7 106 1.10.10.10
5x13A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.887 12 94 1.10.10.10
af_P64588_52_154_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8857 11 95 1.10.10.10
ID Description Score Start End GO Terms
AF-E8V6A6-F1-model_v4 Transcriptional regulator, PadR-like family 0.9892 11 111
AF-A0A7Y3IAF1-F1-model_v4 PadR family transcriptional regulator 0.9871 12 108
AF-A0A6J4S1B4-F1-model_v4 Transcriptional regulator, PadR family 0.9831 17 111
AF-A0A2V9ASX9-F1-model_v4 PadR family transcriptional regulator 0.9818 11 111
AF-A0A2U3KUY7-F1-model_v4 Transcriptional regulator, PadR-family 0.9815 11 111

Map