F403071

General Info

Members Datasets Scaffolds Average Seq Length
315 147 630 265

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100038421|Ga0070697_1000384215
Length 291
Sequence MTDAYDISRGVAAMQTGGARGASEAADADPAKNNLEPHAENFFEFRDVCKSFDENEVLKNVSFTVKRAETCVIMGRSGVGKSVSLKHIMGFMKADSGRILVDGEDVTDFTEQQFEEVRRKVTMVFQSGALFDSLTVGENIAFPLEKQPGLEYEDIDAYVAKLAKMLEVEEVLDKLPGELSTGMRRAVAMARAFAQNPDAILFDEPTTMVDPIMAGHMGDLILRLKDAFHRTSIVVTHDTHLAKKLADTIVFLQDGRVAFFGPWDDFENSKDPFLHNFRMQDALIPALDVTL

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
46 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
47 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
73 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
76 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
84 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
85 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
125 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 1.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.54
Rhizosphere 96.51
Stem 0
Stem Tuber 0
Unclassified 15.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100038421 3300005536 Bacteria 3867
2 Ga0070667_100146081 3300005367 Bacteria 2074
3 Ga0070713_100007566 3300005436 Bacteria 7636
4 Ga0070713_100032060 3300005436 Bacteria 4193
5 Ga0070713_100056527 3300005436 Unclassified 3264
6 Ga0070710_10108260 3300005437 Bacteria 1666
7 Ga0070710_10248552 3300005437 Unclassified 1142
8 Ga0070711_100004965 3300005439 Bacteria 7901
9 Ga0070711_100071753 3300005439 Bacteria 2442
10 Ga0070711_100358093 3300005439 Unclassified 1174
11 Ga0070705_100370090 3300005440 Bacteria 1051
12 Ga0070694_100081932 3300005444 Unclassified 2246
13 Ga0070708_100000446 3300005445 Bacteria 30890
14 Ga0070708_100099641 3300005445 Bacteria 2658
15 Ga0068867_100739951 3300005459 Bacteria 871
16 Ga0070706_100101277 3300005467 Bacteria 2677
17 Ga0070706_100486244 3300005467 Bacteria 1148
18 Ga0070707_100000272 3300005468 Bacteria 51273
19 Ga0070707_100005954 3300005468 Bacteria 11376
20 Ga0070707_100093189 3300005468 Bacteria 2916
21 Ga0070707_100155695 3300005468 Bacteria 2226
22 Ga0070707_100221765 3300005468 Unclassified 1841
23 Ga0070698_100004944 3300005471 Bacteria 14614
24 Ga0070698_100102869 3300005471 Bacteria 2827
25 Ga0070699_100255218 3300005518 Bacteria 1567
26 Ga0070699_100333095 3300005518 Bacteria 1365
27 Ga0070699_100415912 3300005518 Bacteria 1217
28 Ga0070697_100020769 3300005536 Bacteria 5200
29 Ga0070697_100152665 3300005536 Bacteria 1947
30 Ga0070697_100205637 3300005536 Unclassified 1674
31 Ga0070695_100259689 3300005545 Unclassified 1268
32 Ga0070693_100001203 3300005547 Bacteria 11648
33 Ga0070665_100000666 3300005548 Bacteria 46257
34 Ga0070704_100041402 3300005549 Bacteria 3179
35 Ga0068859_100225909 3300005617 Bacteria 1960
36 Ga0068859_100397403 3300005617 Bacteria 1474
37 Ga0068863_100011437 3300005841 Bacteria 8582
38 Ga0068863_100233056 3300005841 Bacteria 1776
39 Ga0068858_100268652 3300005842 Bacteria 1622
40 Ga0068860_100011020 3300005843 Bacteria 8915
41 Ga0081455_10226588 3300005937 Bacteria 1382
42 Ga0070717_10348935 3300006028 Bacteria 1323
43 Ga0070715_10230169 3300006163 Unclassified 958
44 Ga0070716_100000078 3300006173 Bacteria 37885
45 Ga0070716_100000483 3300006173 Bacteria 16475
46 Ga0070716_100020662 3300006173 Bacteria 3459
47 Ga0070716_100150529 3300006173 Bacteria 1496
48 Ga0070716_100182766 3300006173 Bacteria 1378
49 Ga0070712_100084324 3300006175 Bacteria 2310
50 Ga0070712_100166172 3300006175 Unclassified 1708
51 Ga0097621_100161669 3300006237 Bacteria 1925
52 Ga0068871_100014754 3300006358 Bacteria 5832
53 Ga0075434_100015969 3300006871 Bacteria 7214
54 Ga0075434_100196474 3300006871 Unclassified 2037
55 Ga0068865_100254657 3300006881 Unclassified 1387
56 Ga0075436_100023280 3300006914 Bacteria 4254
57 Ga0075436_100050868 3300006914 Bacteria 2859
58 Ga0075436_100080767 3300006914 Bacteria 2253
59 Ga0075436_100174108 3300006914 Bacteria 1520
60 Ga0097620_100225919 3300006931 Bacteria 1960
61 Ga0097620_100397398 3300006931 Bacteria 1474
62 Ga0075435_100041164 3300007076 Bacteria 3693
63 Ga0075435_100051065 3300007076 Bacteria 3330
64 Ga0099794_10003369 3300007265 Bacteria 6087
65 Ga0099794_10006695 3300007265 Bacteria 4681
66 Ga0099794_10010350 3300007265 Bacteria 3956
67 Ga0099794_10015103 3300007265 Bacteria 3401
68 Ga0099794_10017376 3300007265 Bacteria 3205
69 Ga0099794_10021744 3300007265 Bacteria 2917
70 Ga0099794_10037125 3300007265 Unclassified 2306
71 Ga0099794_10044050 3300007265 Bacteria 2132
72 Ga0099794_10044815 3300007265 Bacteria 2115
73 Ga0099794_10048109 3300007265 Unclassified 2046
74 Ga0099794_10081381 3300007265 Bacteria 1598
75 Ga0099794_10115793 3300007265 Bacteria 1346
76 Ga0099794_10161695 3300007265 Unclassified 1139
77 Ga0099795_10000337 3300007788 Bacteria 8432
78 Ga0099795_10029709 3300007788 Bacteria 1870
79 Ga0105247_10375715 3300009101 Bacteria 1006
80 Ga0105242_10239774 3300009176 Bacteria 1629
81 Ga0105242_10257090 3300009176 Unclassified 1576
82 Ga0105248_10183086 3300009177 Bacteria 2361
83 Ga0099796_10001025 3300010159 Bacteria 5288
84 Ga0099796_10033313 3300010159 Unclassified 1694
85 Ga0157374_10001694 3300013296 Bacteria 18453
86 Ga0157374_10126945 3300013296 Bacteria 2466
87 Ga0157378_10000053 3300013297 Bacteria 99982
88 Ga0157378_10003557 3300013297 Bacteria 13807
89 Ga0157378_10215354 3300013297 Bacteria 1823
90 Ga0163162_10207343 3300013306 Bacteria 2089
91 Ga0157372_10115617 3300013307 Unclassified 3076
92 Ga0157376_10000029 3300014969 Bacteria 201828
93 Ga0157376_10025571 3300014969 Unclassified 4652
94 Ga0224571_102602 3300022734 Unclassified 1150
95 Ga0228598_1005607 3300024227 Bacteria 2619
96 Ga0228598_1013476 3300024227 Unclassified 1619
97 Ga0207653_10066166 3300025885 Unclassified 1228
98 Ga0207692_10079879 3300025898 Unclassified 1746
99 Ga0207710_10235424 3300025900 Bacteria 912
100 Ga0207699_10097179 3300025906 Unclassified 1861
101 Ga0207684_10015923 3300025910 Bacteria 6462
102 Ga0207684_10128234 3300025910 Bacteria 2177
103 Ga0207684_10524687 3300025910 Bacteria 1014
104 Ga0207693_10015792 3300025915 Bacteria 6049
105 Ga0207693_10019792 3300025915 Bacteria 5351
106 Ga0207693_10243580 3300025915 Unclassified 1411
107 Ga0207663_10005372 3300025916 Bacteria 6445
108 Ga0207663_10058917 3300025916 Bacteria 2426
109 Ga0207646_10000294 3300025922 Bacteria 67765
110 Ga0207646_10000586 3300025922 Bacteria 47556
111 Ga0207646_10000927 3300025922 Bacteria 37748
112 Ga0207646_10130207 3300025922 Unclassified 2264
113 Ga0207700_10024466 3300025928 Bacteria 4179
114 Ga0207686_10183667 3300025934 Bacteria 1485
115 Ga0207709_10366463 3300025935 Bacteria 1092
116 Ga0207704_10222087 3300025938 Bacteria 1399
117 Ga0207665_10000014 3300025939 Bacteria 137803
118 Ga0207665_10037072 3300025939 Bacteria 3244
119 Ga0207665_10050147 3300025939 Bacteria 2806
120 Ga0207665_10395131 3300025939 Unclassified 1052
121 Ga0207711_10124152 3300025941 Bacteria 2308
122 Ga0207658_10158787 3300025986 Bacteria 1851
123 Ga0207641_10025042 3300026088 Bacteria 4920
124 Ga0209588_1001472 3300027671 Bacteria 6171
125 Ga0209588_1001731 3300027671 Bacteria 5776
126 Ga0209588_1003238 3300027671 Unclassified 4496
127 Ga0209588_1006629 3300027671 Bacteria 3375
128 Ga0209588_1007687 3300027671 Bacteria 3180
129 Ga0209588_1009671 3300027671 Unclassified 2884
130 Ga0209588_1013900 3300027671 Unclassified 2460
131 Ga0209588_1091120 3300027671 Unclassified 982
132 Ga0209588_1094834 3300027671 Bacteria 961
133 Ga0265354_1000143 3300028016 Bacteria 12935
134 Ga0268266_10014862 3300028379 Bacteria 6684
135 Ga0268264_10003766 3300028381 Bacteria 13011
136 Ga0268264_10037781 3300028381 Bacteria 3983
137 Ga0265319_1000770 3300028563 Bacteria 20820
138 Ga0265318_10000563 3300028577 Bacteria 26166
139 Ga0265338_10005291 3300028800 Bacteria 16896
140 Ga0265338_10028075 3300028800 Bacteria 5624
141 Ga0265338_10192841 3300028800 Bacteria 1543
142 Ga0265338_10211760 3300028800 Bacteria 1454
143 Ga0265770_1001881 3300030878 Bacteria 2862
144 Ga0265760_10015142 3300031090 Bacteria 2210
145 Ga0265760_10015348 3300031090 Bacteria 2195
146 Ga0265760_10032914 3300031090 Bacteria 1531
147 Ga0265328_10122728 3300031239 Bacteria 969
148 Ga0265320_10000328 3300031240 Bacteria 38910
149 Ga0265325_10001974 3300031241 Bacteria 14125
150 Ga0265325_10005997 3300031241 Bacteria 7437
151 Ga0265325_10020600 3300031241 Bacteria 3634
152 Ga0265329_10000518 3300031242 Bacteria 19897
153 Ga0265340_10009821 3300031247 Bacteria 5127
154 Ga0265340_10149719 3300031247 Bacteria 1064
155 Ga0265339_10002459 3300031249 Bacteria 13260
156 Ga0265331_10000021 3300031250 Bacteria 242632
157 Ga0265331_10012455 3300031250 Bacteria 4607
158 Ga0265331_10042036 3300031250 Bacteria 2219
159 Ga0265316_10020772 3300031344 Bacteria 5580
160 Ga0265316_10109405 3300031344 Bacteria 2094
161 Ga0265313_10000730 3300031595 Bacteria 33796
162 Ga0265313_10097451 3300031595 Unclassified 1310
163 Ga0265314_10012056 3300031711 Bacteria 7086
164 Ga0265342_10000032 3300031712 Bacteria 150633
165 Ga0316212_1001265 3300033547 Bacteria 3423
166 Ga0316212_1005171 3300033547 Unclassified 1896
167 Ga0373926_0008582 3300035083 Bacteria 3402
168 Ga0373926_0009689 3300035083 Bacteria 3218
169 Ga0373954_0016682 3300035118 Unclassified 3290
170 Ga0373946_0018587 3300035171 Bacteria 2671
171 Ga0373955_0003644 3300035172 Bacteria 6780
172 Ga0373955_0107187 3300035172 Bacteria 1612
173 Ga0373931_0062406 3300035691 Bacteria 2012
174 Ga0373935_0041693 3300035692 Bacteria 2884
175 Ga0373927_0017977 3300035695 Bacteria 4650
176 Ga0373927_0024735 3300035695 Bacteria 3924
177 Ga0373927_0367166 3300035695 Unclassified 949
178 Ga0373933_0000568 3300035724 Bacteria 23098
179 Ga0373933_0001282 3300035724 Bacteria 14787
180 Ga0373947_0001525 3300035725 Bacteria 14206
181 Ga0373947_0014667 3300035725 Bacteria 4495
182 Ga0373937_0000051 3300036401 Bacteria 104818
183 Ga0373937_0000942 3300036401 Bacteria 24733
184 Ga0373937_0037074 3300036401 Bacteria 4443
185 Ga0373937_0187810 3300036401 Bacteria 1941
186 Ga0373925_0000193 3300037068 Bacteria 66246
187 Ga0373925_0070469 3300037068 Bacteria 2643
188 Ga0373925_0403625 3300037068 Bacteria 1115
189 Ga0436365_0155377 3300039437 Bacteria 6768
190 Ga0451577_0196793 3300042876 Bacteria 1819
191 Ga0451577_0340822 3300042876 Bacteria 1359
192 Ga0453683_0004362 3300044673 Bacteria 10061
193 Ga0453683_0006940 3300044673 Bacteria 7721
194 Ga0453683_0012473 3300044673 Bacteria 5569
195 Ga0453684_0022220 3300044712 Bacteria 9427
196 Ga0453684_0638402 3300044712 Unclassified 1163
197 Ga0495592_0130627 3300046454 Bacteria 1757
198 Ga0495651_0008669 3300046462 Bacteria 7803
199 Ga0495651_0028254 3300046462 Bacteria 4372
200 Ga0495651_0051316 3300046462 Bacteria 3180
201 Ga0495651_0052268 3300046462 Bacteria 3147
202 Ga0495653_0003367 3300046463 Bacteria 12851
203 Ga0495653_0043580 3300046463 Bacteria 3488
204 Ga0495653_0304002 3300046463 Bacteria 1039
205 Ga0495653_0341308 3300046463 Bacteria 965
206 Ga0495580_0017563 3300046472 Bacteria 5347
207 Ga0495580_0029040 3300046472 Bacteria 4017
208 Ga0495580_0114924 3300046472 Bacteria 1869
209 Ga0495580_0201657 3300046472 Bacteria 1370
210 Ga0495580_0388700 3300046472 Bacteria 942
211 Ga0495582_0006938 3300046473 Bacteria 6300
212 Ga0495582_0018274 3300046473 Bacteria 3836
213 Ga0495582_0025033 3300046473 Bacteria 3269
214 Ga0495582_0111367 3300046473 Bacteria 1538
215 Ga0495582_0229337 3300046473 Unclassified 1063
216 Ga0495639_0018306 3300046475 Bacteria 3048
217 Ga0495662_0090438 3300046476 Bacteria 1492
218 Ga0495664_0032941 3300046477 Bacteria 3044
219 Ga0495664_0108837 3300046477 Unclassified 1672
220 Ga0495664_0189328 3300046477 Bacteria 1248
221 Ga0495594_0010002 3300046499 Bacteria 4914
222 Ga0495594_0147431 3300046499 Bacteria 1336
223 Ga0495608_0008749 3300046511 Bacteria 7082
224 Ga0495608_0031575 3300046511 Bacteria 3581
225 Ga0495618_0063302 3300046514 Bacteria 2348
226 Ga0495618_0113414 3300046514 Unclassified 1735
227 Ga0495628_0000743 3300046516 Bacteria 30199
228 Ga0495628_0028733 3300046516 Bacteria 4516
229 Ga0495628_0053411 3300046516 Bacteria 3189
230 Ga0495628_0087734 3300046516 Unclassified 2412
231 Ga0495628_0645137 3300046516 Bacteria 752
232 Ga0495630_0032646 3300046517 Bacteria 3880
233 Ga0495630_0067222 3300046517 Unclassified 2694
234 Ga0495630_0069333 3300046517 Bacteria 2652
235 Ga0495630_0099568 3300046517 Unclassified 2199
236 Ga0495630_0258831 3300046517 Bacteria 1329
237 Ga0495666_0052146 3300046526 Bacteria 1964
238 Ga0495652_0001695 3300046529 Bacteria 23794
239 Ga0495652_0017164 3300046529 Bacteria 6463
240 Ga0495665_0006787 3300046531 Bacteria 6176
241 Ga0495665_0046239 3300046531 Bacteria 2311
242 Ga0495640_0001536 3300046533 Bacteria 18175
243 Ga0495586_0015627 3300046535 Bacteria 4039
244 Ga0495586_0041663 3300046535 Unclassified 2473
245 Ga0495587_0000381 3300046536 Bacteria 31640
246 Ga0495587_0000902 3300046536 Bacteria 19683
247 Ga0495587_0005351 3300046536 Bacteria 8395
248 Ga0495645_0027873 3300046543 Bacteria 4104
249 Ga0495645_0054295 3300046543 Bacteria 2911
250 Ga0495667_0033936 3300046559 Bacteria 3413
251 Ga0495667_0037629 3300046559 Bacteria 3224
252 Ga0495667_0039991 3300046559 Bacteria 3115
253 Ga0495667_0243224 3300046559 Bacteria 1146
254 Ga0495635_0221795 3300046663 Bacteria 1278
255 Ga0495657_0024181 3300046675 Bacteria 4331
256 Ga0495657_0038646 3300046675 Bacteria 3283
257 Ga0495657_0134661 3300046675 Unclassified 1545
258 Ga0495599_0019261 3300046678 Bacteria 4255
259 Ga0495599_0051603 3300046678 Bacteria 2577
260 Ga0495599_0236353 3300046678 Unclassified 1115
261 Ga0495623_0049796 3300046679 Bacteria 2655
262 Ga0495623_0055679 3300046679 Unclassified 2492
263 Ga0495646_0023695 3300046680 Bacteria 3863
264 Ga0495647_0001160 3300046681 Bacteria 8093
265 Ga0495658_0013870 3300046683 Bacteria 4107
266 Ga0495624_0112359 3300046690 Bacteria 1675
267 Ga0495624_0225709 3300046690 Bacteria 1135
268 Ga0495600_0005166 3300046809 Bacteria 7847
269 Ga0495581_0003326 3300047315 Bacteria 9234
270 Ga0495604_0003883 3300047317 Bacteria 11898
271 Ga0495604_0011284 3300047317 Bacteria 7094
272 Ga0495604_0013619 3300047317 Bacteria 6486
273 Ga0495604_0084103 3300047317 Bacteria 2377
274 Ga0495674_0006253 3300047319 Bacteria 11427
275 Ga0495674_0052258 3300047319 Bacteria 3597
276 Ga0495674_0121762 3300047319 Bacteria 2203
277 Ga0495674_0208073 3300047319 Bacteria 1621
278 Ga0495676_0014720 3300047321 Bacteria 6988
279 Ga0495680_0001606 3300047322 Bacteria 24078
280 Ga0495680_0011639 3300047322 Bacteria 7774
281 Ga0495680_0187003 3300047322 Bacteria 1492
282 Ga0495680_0328261 3300047322 Bacteria 1069
283 Ga0495675_0000077 3300047444 Bacteria 68982
284 Ga0495675_0001043 3300047444 Bacteria 16841
285 Ga0495675_0003997 3300047444 Bacteria 8934
286 Ga0495675_0154310 3300047444 Unclassified 1417
287 Ga0495684_0030561 3300047471 Bacteria 4135
288 Ga0495684_0033905 3300047471 Bacteria 3917
289 Ga0495684_0065814 3300047471 Bacteria 2755
290 Ga0495602_0000048 3300048088 Bacteria 116248
291 Ga0495602_0006628 3300048088 Bacteria 12141
292 Ga0495602_0035420 3300048088 Bacteria 4654
293 Ga0495602_0099474 3300048088 Unclassified 2390
294 Ga0495602_0126656 3300048088 Bacteria 2045
295 Ga0495602_0141791 3300048088 Bacteria 1901
296 Ga0495614_0023208 3300048089 Bacteria 2676
297 Ga0496105_0662585 3300048908 Unclassified 804
298 Ga0496106_0092116 3300048909 Bacteria 2341
299 Ga0496112_0296065 3300048915 Bacteria 1564
300 Ga0496112_0389647 3300048915 Bacteria 1334
301 Ga0496114_0060453 3300048917 Bacteria 3167
302 Ga0496115_0010629 3300048918 Bacteria 6884
303 Ga0496115_0052300 3300048918 Bacteria 3276
304 Ga0496115_0090232 3300048918 Unclassified 2503
305 nmdc:mga0n895_194769_c1 3300050512 Bacteria 2058
306 nmdc:mga0n895_73737_c1 3300050512 Bacteria 3389
307 nmdc:mga0rr50_16075_c1 3300050513 Bacteria 4958
308 nmdc:mga0rr50_86554_c1 3300050513 Bacteria 2431
309 nmdc:mga08x19_162857_c1 3300050514 Bacteria 1516
310 nmdc:mga08x19_2342_c1 3300050514 Bacteria 11501
311 nmdc:mga08x19_26488_c1 3300050514 Bacteria 3618
312 nmdc:mga08x19_49779_c1 3300050514 Bacteria 2688
313 Ga0495601_0030280 3300053077 Bacteria 3360
314 Ga0495619_0063370 3300053085 Bacteria 2463
315 Ga0495619_0145585 3300053085 Bacteria 1633
316 Ga0070697_100038421
317 Ga0070667_100146081
318 Ga0070713_100007566
319 Ga0070713_100032060
320 Ga0070713_100056527
321 Ga0070710_10108260
322 Ga0070710_10248552
323 Ga0070711_100004965
324 Ga0070711_100071753
325 Ga0070711_100358093
326 Ga0070705_100370090
327 Ga0070694_100081932
328 Ga0070708_100000446
329 Ga0070708_100099641
330 Ga0068867_100739951
331 Ga0070706_100101277
332 Ga0070706_100486244
333 Ga0070707_100000272
334 Ga0070707_100005954
335 Ga0070707_100093189
336 Ga0070707_100155695
337 Ga0070707_100221765
338 Ga0070698_100004944
339 Ga0070698_100102869
340 Ga0070699_100255218
341 Ga0070699_100333095
342 Ga0070699_100415912
343 Ga0070697_100020769
344 Ga0070697_100152665
345 Ga0070697_100205637
346 Ga0070695_100259689
347 Ga0070693_100001203
348 Ga0070665_100000666
349 Ga0070704_100041402
350 Ga0068859_100225909
351 Ga0068859_100397403
352 Ga0068863_100011437
353 Ga0068863_100233056
354 Ga0068858_100268652
355 Ga0068860_100011020
356 Ga0081455_10226588
357 Ga0070717_10348935
358 Ga0070715_10230169
359 Ga0070716_100000078
360 Ga0070716_100000483
361 Ga0070716_100020662
362 Ga0070716_100150529
363 Ga0070716_100182766
364 Ga0070712_100084324
365 Ga0070712_100166172
366 Ga0097621_100161669
367 Ga0068871_100014754
368 Ga0075434_100015969
369 Ga0075434_100196474
370 Ga0068865_100254657
371 Ga0075436_100023280
372 Ga0075436_100050868
373 Ga0075436_100080767
374 Ga0075436_100174108
375 Ga0097620_100225919
376 Ga0097620_100397398
377 Ga0075435_100041164
378 Ga0075435_100051065
379 Ga0099794_10003369
380 Ga0099794_10006695
381 Ga0099794_10010350
382 Ga0099794_10015103
383 Ga0099794_10017376
384 Ga0099794_10021744
385 Ga0099794_10037125
386 Ga0099794_10044050
387 Ga0099794_10044815
388 Ga0099794_10048109
389 Ga0099794_10081381
390 Ga0099794_10115793
391 Ga0099794_10161695
392 Ga0099795_10000337
393 Ga0099795_10029709
394 Ga0105247_10375715
395 Ga0105242_10239774
396 Ga0105242_10257090
397 Ga0105248_10183086
398 Ga0099796_10001025
399 Ga0099796_10033313
400 Ga0157374_10001694
401 Ga0157374_10126945
402 Ga0157378_10000053
403 Ga0157378_10003557
404 Ga0157378_10215354
405 Ga0163162_10207343
406 Ga0157372_10115617
407 Ga0157376_10000029
408 Ga0157376_10025571
409 Ga0224571_102602
410 Ga0228598_1005607
411 Ga0228598_1013476
412 Ga0207653_10066166
413 Ga0207692_10079879
414 Ga0207710_10235424
415 Ga0207699_10097179
416 Ga0207684_10015923
417 Ga0207684_10128234
418 Ga0207684_10524687
419 Ga0207693_10015792
420 Ga0207693_10019792
421 Ga0207693_10243580
422 Ga0207663_10005372
423 Ga0207663_10058917
424 Ga0207646_10000294
425 Ga0207646_10000586
426 Ga0207646_10000927
427 Ga0207646_10130207
428 Ga0207700_10024466
429 Ga0207686_10183667
430 Ga0207709_10366463
431 Ga0207704_10222087
432 Ga0207665_10000014
433 Ga0207665_10037072
434 Ga0207665_10050147
435 Ga0207665_10395131
436 Ga0207711_10124152
437 Ga0207658_10158787
438 Ga0207641_10025042
439 Ga0209588_1001472
440 Ga0209588_1001731
441 Ga0209588_1003238
442 Ga0209588_1006629
443 Ga0209588_1007687
444 Ga0209588_1009671
445 Ga0209588_1013900
446 Ga0209588_1091120
447 Ga0209588_1094834
448 Ga0265354_1000143
449 Ga0268266_10014862
450 Ga0268264_10003766
451 Ga0268264_10037781
452 Ga0265319_1000770
453 Ga0265318_10000563
454 Ga0265338_10005291
455 Ga0265338_10028075
456 Ga0265338_10192841
457 Ga0265338_10211760
458 Ga0265770_1001881
459 Ga0265760_10015142
460 Ga0265760_10015348
461 Ga0265760_10032914
462 Ga0265328_10122728
463 Ga0265320_10000328
464 Ga0265325_10001974
465 Ga0265325_10005997
466 Ga0265325_10020600
467 Ga0265329_10000518
468 Ga0265340_10009821
469 Ga0265340_10149719
470 Ga0265339_10002459
471 Ga0265331_10000021
472 Ga0265331_10012455
473 Ga0265331_10042036
474 Ga0265316_10020772
475 Ga0265316_10109405
476 Ga0265313_10000730
477 Ga0265313_10097451
478 Ga0265314_10012056
479 Ga0265342_10000032
480 Ga0316212_1001265
481 Ga0316212_1005171
482 Ga0373926_0008582
483 Ga0373926_0009689
484 Ga0373954_0016682
485 Ga0373946_0018587
486 Ga0373955_0003644
487 Ga0373955_0107187
488 Ga0373931_0062406
489 Ga0373935_0041693
490 Ga0373927_0017977
491 Ga0373927_0024735
492 Ga0373927_0367166
493 Ga0373933_0000568
494 Ga0373933_0001282
495 Ga0373947_0001525
496 Ga0373947_0014667
497 Ga0373937_0000051
498 Ga0373937_0000942
499 Ga0373937_0037074
500 Ga0373937_0187810
501 Ga0373925_0000193
502 Ga0373925_0070469
503 Ga0373925_0403625
504 Ga0436365_0155377
505 Ga0451577_0196793
506 Ga0451577_0340822
507 Ga0453683_0004362
508 Ga0453683_0006940
509 Ga0453683_0012473
510 Ga0453684_0022220
511 Ga0453684_0638402
512 Ga0495592_0130627
513 Ga0495651_0008669
514 Ga0495651_0028254
515 Ga0495651_0051316
516 Ga0495651_0052268
517 Ga0495653_0003367
518 Ga0495653_0043580
519 Ga0495653_0304002
520 Ga0495653_0341308
521 Ga0495580_0017563
522 Ga0495580_0029040
523 Ga0495580_0114924
524 Ga0495580_0201657
525 Ga0495580_0388700
526 Ga0495582_0006938
527 Ga0495582_0018274
528 Ga0495582_0025033
529 Ga0495582_0111367
530 Ga0495582_0229337
531 Ga0495639_0018306
532 Ga0495662_0090438
533 Ga0495664_0032941
534 Ga0495664_0108837
535 Ga0495664_0189328
536 Ga0495594_0010002
537 Ga0495594_0147431
538 Ga0495608_0008749
539 Ga0495608_0031575
540 Ga0495618_0063302
541 Ga0495618_0113414
542 Ga0495628_0000743
543 Ga0495628_0028733
544 Ga0495628_0053411
545 Ga0495628_0087734
546 Ga0495628_0645137
547 Ga0495630_0032646
548 Ga0495630_0067222
549 Ga0495630_0069333
550 Ga0495630_0099568
551 Ga0495630_0258831
552 Ga0495666_0052146
553 Ga0495652_0001695
554 Ga0495652_0017164
555 Ga0495665_0006787
556 Ga0495665_0046239
557 Ga0495640_0001536
558 Ga0495586_0015627
559 Ga0495586_0041663
560 Ga0495587_0000381
561 Ga0495587_0000902
562 Ga0495587_0005351
563 Ga0495645_0027873
564 Ga0495645_0054295
565 Ga0495667_0033936
566 Ga0495667_0037629
567 Ga0495667_0039991
568 Ga0495667_0243224
569 Ga0495635_0221795
570 Ga0495657_0024181
571 Ga0495657_0038646
572 Ga0495657_0134661
573 Ga0495599_0019261
574 Ga0495599_0051603
575 Ga0495599_0236353
576 Ga0495623_0049796
577 Ga0495623_0055679
578 Ga0495646_0023695
579 Ga0495647_0001160
580 Ga0495658_0013870
581 Ga0495624_0112359
582 Ga0495624_0225709
583 Ga0495600_0005166
584 Ga0495581_0003326
585 Ga0495604_0003883
586 Ga0495604_0011284
587 Ga0495604_0013619
588 Ga0495604_0084103
589 Ga0495674_0006253
590 Ga0495674_0052258
591 Ga0495674_0121762
592 Ga0495674_0208073
593 Ga0495676_0014720
594 Ga0495680_0001606
595 Ga0495680_0011639
596 Ga0495680_0187003
597 Ga0495680_0328261
598 Ga0495675_0000077
599 Ga0495675_0001043
600 Ga0495675_0003997
601 Ga0495675_0154310
602 Ga0495684_0030561
603 Ga0495684_0033905
604 Ga0495684_0065814
605 Ga0495602_0000048
606 Ga0495602_0006628
607 Ga0495602_0035420
608 Ga0495602_0099474
609 Ga0495602_0126656
610 Ga0495602_0141791
611 Ga0495614_0023208
612 Ga0496105_0662585
613 Ga0496106_0092116
614 Ga0496112_0296065
615 Ga0496112_0389647
616 Ga0496114_0060453
617 Ga0496115_0010629
618 Ga0496115_0052300
619 Ga0496115_0090232
620 nmdc:mga0n895_194769_c1
621 nmdc:mga0n895_73737_c1
622 nmdc:mga0rr50_16075_c1
623 nmdc:mga0rr50_86554_c1
624 nmdc:mga08x19_162857_c1
625 nmdc:mga08x19_2342_c1
626 nmdc:mga08x19_26488_c1
627 nmdc:mga08x19_49779_c1
628 Ga0495601_0030280
629 Ga0495619_0063370
630 Ga0495619_0145585

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

58

207

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9513 28 267
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9382 30 264
7z19-assembly1.cif.gz_I e. coli c-p lyase bound to a single phnk abc domain 0.9379 28 267
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.9355 28 268
7ch0-assembly1.cif.gz_E the overall structure of the mlafedb complex in atp-bound eqclose conformation (mutation of e170q on mlaf) 0.9352 27 265
ID Description Score Start End Superfamily
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9554 28 267 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9455 27 92 3.40.50.300
af_P16678_3_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9455 28 267 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9446 30 247 3.40.50.300
af_P9WQL5_26_341_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.942 30 265 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2N7JK81-F1-model_v4 ABC transporter ATP-binding protein 0.9529 28 268 GO:0005524
GO:0016887
AF-A0A7U3VV78-F1-model_v4 deleted 0.9486 26 267
AF-A0A527GZS8-F1-model_v4 ABC transporter ATP-binding protein 0.9431 28 243 GO:0005524
GO:0008643
GO:0016887
GO:0055052
GO:0140359
AF-A0A2E3LY08-F1-model_v4 ABC transporter ATP-binding protein 0.9429 30 268 GO:0005524
GO:0016887
AF-A0A2E7BRA8-F1-model_v4 ABC transporter ATP-binding protein 0.9401 30 267 GO:0005524
GO:0016887

Map