F403002
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 315 | 180 | 315 | 111 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100948537|Ga0070670_1009485371 |
| Length | 124 |
| Sequence | MVNRAARRLSEECVTNPSEMPGAAPVALVTLAAYQDGAVVSRILLKRGGGTVTLFAFDEGQSLSEHTAPFDAIAHVLEGEALITIAGLPLAVPAGDMVLMPANRPHAVAARTRFKMLLTMIRPV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 6 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 126 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 127 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 130 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 131 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 132 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 133 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 134 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 135 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 136 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 137 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 138 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 139 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 140 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 141 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 143 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 144 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 146 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 147 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 148 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 149 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 172 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 173 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 174 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 177 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.63 |
| Nodule | 0 |
| Rhizoplane | 1.59 |
| Rhizosphere | 97.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1009011 | 3300001977 | Unclassified | 1498 |
| 2 | JGI24743J22301_10120253 | 3300001991 | Bacteria | 575 |
| 3 | JGI24745J21846_1043273 | 3300002073 | Bacteria | 561 |
| 4 | JGI24748J21848_1048556 | 3300002074 | Bacteria | 551 |
| 5 | JGI24749J21850_1009275 | 3300002076 | Unclassified | 1376 |
| 6 | JGI24035J26624_1010446 | 3300002126 | Bacteria | 923 |
| 7 | JGI24751J29686_10022635 | 3300002459 | Unclassified | 1303 |
| 8 | Ga0065712_10108984 | 3300005290 | Unclassified | 1863 |
| 9 | Ga0065715_10099586 | 3300005293 | Unclassified | 3394 |
| 10 | Ga0065715_10373622 | 3300005293 | Bacteria | 917 |
| 11 | Ga0065707_10211859 | 3300005295 | Unclassified | 1262 |
| 12 | Ga0065707_10241689 | 3300005295 | Bacteria | 1133 |
| 13 | Ga0070676_10018929 | 3300005328 | Bacteria | 3823 |
| 14 | Ga0070676_10957782 | 3300005328 | Bacteria | 640 |
| 15 | Ga0070670_100003145 | 3300005331 | Bacteria | 13652 |
| 16 | Ga0070670_100182074 | 3300005331 | Unclassified | 1824 |
| 17 | Ga0070670_100948537 | 3300005331 | Unclassified | 781 |
| 18 | Ga0070670_101428691 | 3300005331 | Bacteria | 635 |
| 19 | Ga0068869_100461103 | 3300005334 | Bacteria | 1055 |
| 20 | Ga0068869_100558519 | 3300005334 | Unclassified | 962 |
| 21 | Ga0068869_101594143 | 3300005334 | Bacteria | 581 |
| 22 | Ga0068869_102033371 | 3300005334 | Unclassified | 516 |
| 23 | Ga0070666_10749886 | 3300005335 | Unclassified | 717 |
| 24 | Ga0070680_101146334 | 3300005336 | Unclassified | 672 |
| 25 | Ga0068868_100174803 | 3300005338 | Unclassified | 1779 |
| 26 | Ga0068868_100232158 | 3300005338 | Bacteria | 1548 |
| 27 | Ga0070689_100008286 | 3300005340 | Bacteria | 7315 |
| 28 | Ga0070689_100198605 | 3300005340 | Unclassified | 1636 |
| 29 | Ga0070689_100207877 | 3300005340 | Bacteria | 1601 |
| 30 | Ga0070687_100038606 | 3300005343 | Unclassified | 2394 |
| 31 | Ga0070661_100158306 | 3300005344 | Unclassified | 1714 |
| 32 | Ga0070668_100060638 | 3300005347 | Bacteria | 2930 |
| 33 | Ga0070668_100069687 | 3300005347 | Unclassified | 2736 |
| 34 | Ga0070669_100042487 | 3300005353 | Unclassified | 3308 |
| 35 | Ga0070669_100054183 | 3300005353 | Bacteria | 2937 |
| 36 | Ga0070675_100081806 | 3300005354 | Bacteria | 2693 |
| 37 | Ga0070675_100170543 | 3300005354 | Bacteria | 1876 |
| 38 | Ga0070671_100265119 | 3300005355 | Bacteria | 1460 |
| 39 | Ga0070688_100282204 | 3300005365 | Unclassified | 1193 |
| 40 | Ga0070688_100520132 | 3300005365 | Bacteria | 900 |
| 41 | Ga0070688_100548426 | 3300005365 | Bacteria | 878 |
| 42 | Ga0070659_100264074 | 3300005366 | Unclassified | 1429 |
| 43 | Ga0070667_100006984 | 3300005367 | Bacteria | 9382 |
| 44 | Ga0070667_102213444 | 3300005367 | Bacteria | 518 |
| 45 | Ga0070705_101201973 | 3300005440 | Bacteria | 625 |
| 46 | Ga0070700_100047028 | 3300005441 | Unclassified | 2669 |
| 47 | Ga0070663_100078862 | 3300005455 | Unclassified | 2415 |
| 48 | Ga0070678_100087815 | 3300005456 | Unclassified | 2375 |
| 49 | Ga0070662_100044912 | 3300005457 | Unclassified | 3168 |
| 50 | Ga0068867_100231807 | 3300005459 | Unclassified | 1493 |
| 51 | Ga0068867_100757315 | 3300005459 | Unclassified | 862 |
| 52 | Ga0070685_10310181 | 3300005466 | Bacteria | 1066 |
| 53 | Ga0070685_11052838 | 3300005466 | Unclassified | 613 |
| 54 | Ga0070706_100616289 | 3300005467 | Bacteria | 1008 |
| 55 | Ga0070698_100363152 | 3300005471 | Bacteria | 1380 |
| 56 | Ga0070684_100936466 | 3300005535 | Bacteria | 812 |
| 57 | Ga0070672_100124129 | 3300005543 | Unclassified | 2116 |
| 58 | Ga0070686_100044398 | 3300005544 | Unclassified | 2793 |
| 59 | Ga0070695_101168400 | 3300005545 | Bacteria | 632 |
| 60 | Ga0070693_101265572 | 3300005547 | Unclassified | 569 |
| 61 | Ga0070665_100057048 | 3300005548 | Unclassified | 3915 |
| 62 | Ga0070665_100880478 | 3300005548 | Bacteria | 908 |
| 63 | Ga0070664_100490763 | 3300005564 | Bacteria | 1131 |
| 64 | Ga0070664_100582833 | 3300005564 | Unclassified | 1036 |
| 65 | Ga0070664_100796298 | 3300005564 | Bacteria | 884 |
| 66 | Ga0070664_100871014 | 3300005564 | Bacteria | 844 |
| 67 | Ga0068857_100273373 | 3300005577 | Bacteria | 1553 |
| 68 | Ga0068854_100476490 | 3300005578 | Unclassified | 1047 |
| 69 | Ga0070702_100947863 | 3300005615 | Unclassified | 677 |
| 70 | Ga0068852_100797047 | 3300005616 | Bacteria | 959 |
| 71 | Ga0068859_100170473 | 3300005617 | Bacteria | 2257 |
| 72 | Ga0068859_100242301 | 3300005617 | Bacteria | 1892 |
| 73 | Ga0068859_100459916 | 3300005617 | Bacteria | 1369 |
| 74 | Ga0068859_100543183 | 3300005617 | Bacteria | 1257 |
| 75 | Ga0068859_100948435 | 3300005617 | Bacteria | 944 |
| 76 | Ga0068859_102677447 | 3300005617 | Unclassified | 548 |
| 77 | Ga0068864_100007880 | 3300005618 | Bacteria | 8779 |
| 78 | Ga0068864_100021512 | 3300005618 | Bacteria | 5402 |
| 79 | Ga0068864_100056290 | 3300005618 | Unclassified | 3397 |
| 80 | Ga0068864_100618332 | 3300005618 | Bacteria | 1053 |
| 81 | Ga0068866_10298777 | 3300005718 | Bacteria | 1005 |
| 82 | Ga0068861_100190431 | 3300005719 | Unclassified | 1714 |
| 83 | Ga0068861_100218304 | 3300005719 | Bacteria | 1610 |
| 84 | Ga0068861_101266819 | 3300005719 | Unclassified | 716 |
| 85 | Ga0068861_101972760 | 3300005719 | Bacteria | 582 |
| 86 | Ga0068851_11064313 | 3300005834 | Bacteria | 512 |
| 87 | Ga0068870_10010115 | 3300005840 | Unclassified | 4317 |
| 88 | Ga0068863_100339903 | 3300005841 | Unclassified | 1460 |
| 89 | Ga0068863_100419979 | 3300005841 | Unclassified | 1310 |
| 90 | Ga0068858_100005373 | 3300005842 | Bacteria | 12559 |
| 91 | Ga0068858_100048684 | 3300005842 | Unclassified | 3926 |
| 92 | Ga0068858_100169832 | 3300005842 | Unclassified | 2056 |
| 93 | Ga0068858_100424264 | 3300005842 | Unclassified | 1279 |
| 94 | Ga0068858_100879764 | 3300005842 | Unclassified | 876 |
| 95 | Ga0068860_100589011 | 3300005843 | Bacteria | 1117 |
| 96 | Ga0068862_100067700 | 3300005844 | Unclassified | 3079 |
| 97 | Ga0068862_100136284 | 3300005844 | Bacteria | 2175 |
| 98 | Ga0068862_100494268 | 3300005844 | Bacteria | 1160 |
| 99 | Ga0070717_11113803 | 3300006028 | Bacteria | 719 |
| 100 | Ga0075365_10402572 | 3300006038 | Bacteria | 966 |
| 101 | Ga0097621_100061714 | 3300006237 | Unclassified | 3075 |
| 102 | Ga0097621_100493191 | 3300006237 | Bacteria | 1109 |
| 103 | Ga0075428_100176774 | 3300006844 | Unclassified | 2312 |
| 104 | Ga0075431_100213297 | 3300006847 | Unclassified | 1971 |
| 105 | Ga0075434_100792887 | 3300006871 | Bacteria | 964 |
| 106 | Ga0068865_100026305 | 3300006881 | Unclassified | 3835 |
| 107 | Ga0068865_100072789 | 3300006881 | Bacteria | 2442 |
| 108 | Ga0075436_100280957 | 3300006914 | Unclassified | 1190 |
| 109 | Ga0075436_100457522 | 3300006914 | Bacteria | 930 |
| 110 | Ga0097620_100170471 | 3300006931 | Bacteria | 2257 |
| 111 | Ga0097620_100242290 | 3300006931 | Bacteria | 1892 |
| 112 | Ga0097620_100459894 | 3300006931 | Bacteria | 1369 |
| 113 | Ga0097620_100543178 | 3300006931 | Bacteria | 1257 |
| 114 | Ga0097620_100948259 | 3300006931 | Bacteria | 944 |
| 115 | Ga0097620_101454625 | 3300006931 | Unclassified | 756 |
| 116 | Ga0097620_102677399 | 3300006931 | Unclassified | 548 |
| 117 | Ga0075435_100118537 | 3300007076 | Bacteria | 2206 |
| 118 | Ga0111539_10168405 | 3300009094 | Bacteria | 2560 |
| 119 | Ga0111539_10606432 | 3300009094 | Bacteria | 1275 |
| 120 | Ga0111539_11479134 | 3300009094 | Bacteria | 788 |
| 121 | Ga0105245_10987602 | 3300009098 | Bacteria | 886 |
| 122 | Ga0105245_13039566 | 3300009098 | Bacteria | 520 |
| 123 | Ga0105243_10649287 | 3300009148 | Bacteria | 1022 |
| 124 | Ga0105241_11727812 | 3300009174 | Bacteria | 609 |
| 125 | Ga0105242_11657834 | 3300009176 | Bacteria | 675 |
| 126 | Ga0105248_10046216 | 3300009177 | Bacteria | 4879 |
| 127 | Ga0105248_10077308 | 3300009177 | Bacteria | 3742 |
| 128 | Ga0105248_10134132 | 3300009177 | Bacteria | 2794 |
| 129 | Ga0105248_10278696 | 3300009177 | Unclassified | 1882 |
| 130 | Ga0105248_10451891 | 3300009177 | Unclassified | 1448 |
| 131 | Ga0105248_11405575 | 3300009177 | Unclassified | 790 |
| 132 | Ga0105249_10056324 | 3300009553 | Unclassified | 3599 |
| 133 | Ga0105249_13194422 | 3300009553 | Unclassified | 527 |
| 134 | Ga0105246_10115122 | 3300011119 | Bacteria | 1983 |
| 135 | Ga0105246_11337203 | 3300011119 | Bacteria | 666 |
| 136 | Ga0157374_10187552 | 3300013296 | Unclassified | 2022 |
| 137 | Ga0163162_10075888 | 3300013306 | Unclassified | 3422 |
| 138 | Ga0157375_10039715 | 3300013308 | Unclassified | 4531 |
| 139 | Ga0157375_10716441 | 3300013308 | Bacteria | 1154 |
| 140 | Ga0163163_10032232 | 3300014325 | Bacteria | 5061 |
| 141 | Ga0163163_10057591 | 3300014325 | Bacteria | 3843 |
| 142 | Ga0163163_10353154 | 3300014325 | Bacteria | 1526 |
| 143 | Ga0163163_11351632 | 3300014325 | Unclassified | 774 |
| 144 | Ga0163163_11526073 | 3300014325 | Unclassified | 729 |
| 145 | Ga0163163_12856695 | 3300014325 | Unclassified | 539 |
| 146 | Ga0157380_10369696 | 3300014326 | Unclassified | 1349 |
| 147 | Ga0157377_10014730 | 3300014745 | Unclassified | 3985 |
| 148 | Ga0157377_10137486 | 3300014745 | Bacteria | 1498 |
| 149 | Ga0157379_10102709 | 3300014968 | Unclassified | 2566 |
| 150 | Ga0157379_10353270 | 3300014968 | Bacteria | 1346 |
| 151 | Ga0157379_11558068 | 3300014968 | Unclassified | 644 |
| 152 | Ga0157379_11675192 | 3300014968 | Unclassified | 622 |
| 153 | Ga0157376_10050266 | 3300014969 | Unclassified | 3458 |
| 154 | Ga0157376_10236723 | 3300014969 | Unclassified | 1699 |
| 155 | Ga0163161_10179919 | 3300017792 | Unclassified | 1621 |
| 156 | Ga0207673_1008349 | 3300025290 | Unclassified | 1310 |
| 157 | Ga0207697_10011747 | 3300025315 | Unclassified | 3695 |
| 158 | Ga0207682_10016883 | 3300025893 | Bacteria | 2849 |
| 159 | Ga0207688_10017109 | 3300025901 | Unclassified | 3939 |
| 160 | Ga0207680_10500669 | 3300025903 | Bacteria | 865 |
| 161 | Ga0207645_10015259 | 3300025907 | Bacteria | 5112 |
| 162 | Ga0207643_10009923 | 3300025908 | Bacteria | 5116 |
| 163 | Ga0207662_10041021 | 3300025918 | Unclassified | 2724 |
| 164 | Ga0207649_10377870 | 3300025920 | Unclassified | 1055 |
| 165 | Ga0207681_10088352 | 3300025923 | Bacteria | 2207 |
| 166 | Ga0207681_10120091 | 3300025923 | Unclassified | 1926 |
| 167 | Ga0207650_10119168 | 3300025925 | Bacteria | 2052 |
| 168 | Ga0207650_10124162 | 3300025925 | Unclassified | 2013 |
| 169 | Ga0207659_10054629 | 3300025926 | Unclassified | 2853 |
| 170 | Ga0207659_11719960 | 3300025926 | Unclassified | 534 |
| 171 | Ga0207687_10475793 | 3300025927 | Bacteria | 1039 |
| 172 | Ga0207644_10612978 | 3300025931 | Bacteria | 904 |
| 173 | Ga0207644_11382448 | 3300025931 | Bacteria | 591 |
| 174 | Ga0207706_10020610 | 3300025933 | Bacteria | 5925 |
| 175 | Ga0207686_11198525 | 3300025934 | Unclassified | 621 |
| 176 | Ga0207670_10454357 | 3300025936 | Bacteria | 1033 |
| 177 | Ga0207670_10684362 | 3300025936 | Unclassified | 848 |
| 178 | Ga0207669_10364441 | 3300025937 | Bacteria | 1121 |
| 179 | Ga0207704_10087945 | 3300025938 | Bacteria | 2031 |
| 180 | Ga0207704_10258199 | 3300025938 | Unclassified | 1312 |
| 181 | Ga0207691_10023996 | 3300025940 | Bacteria | 5737 |
| 182 | Ga0207711_10044308 | 3300025941 | Bacteria | 3798 |
| 183 | Ga0207711_10048684 | 3300025941 | Bacteria | 3626 |
| 184 | Ga0207711_10063372 | 3300025941 | Bacteria | 3191 |
| 185 | Ga0207711_10917325 | 3300025941 | Bacteria | 814 |
| 186 | Ga0207689_10040204 | 3300025942 | Unclassified | 3871 |
| 187 | Ga0207689_10276697 | 3300025942 | Bacteria | 1390 |
| 188 | Ga0207689_11738176 | 3300025942 | Unclassified | 516 |
| 189 | Ga0207679_10039704 | 3300025945 | Unclassified | 3363 |
| 190 | Ga0207679_11127003 | 3300025945 | Bacteria | 720 |
| 191 | Ga0207679_11984977 | 3300025945 | Unclassified | 530 |
| 192 | Ga0207651_10251348 | 3300025960 | Unclassified | 1446 |
| 193 | Ga0207651_10732183 | 3300025960 | Bacteria | 873 |
| 194 | Ga0207712_10078049 | 3300025961 | Unclassified | 2402 |
| 195 | Ga0207712_10501513 | 3300025961 | Bacteria | 1038 |
| 196 | Ga0207668_10133920 | 3300025972 | Bacteria | 1896 |
| 197 | Ga0207668_10667155 | 3300025972 | Unclassified | 911 |
| 198 | Ga0207640_10335324 | 3300025981 | Unclassified | 1209 |
| 199 | Ga0207658_10196043 | 3300025986 | Unclassified | 1682 |
| 200 | Ga0207658_11459196 | 3300025986 | Unclassified | 626 |
| 201 | Ga0207658_11973441 | 3300025986 | Bacteria | 531 |
| 202 | Ga0207677_10243517 | 3300026023 | Unclassified | 1456 |
| 203 | Ga0207677_10363292 | 3300026023 | Bacteria | 1217 |
| 204 | Ga0207703_10148677 | 3300026035 | Bacteria | 2040 |
| 205 | Ga0207703_10479016 | 3300026035 | Unclassified | 1166 |
| 206 | Ga0207703_10493893 | 3300026035 | Bacteria | 1148 |
| 207 | Ga0207703_11476521 | 3300026035 | Bacteria | 654 |
| 208 | Ga0207678_10095917 | 3300026067 | Unclassified | 2534 |
| 209 | Ga0207708_10042827 | 3300026075 | Unclassified | 3450 |
| 210 | Ga0207641_10067334 | 3300026088 | Unclassified | 3067 |
| 211 | Ga0207641_10607483 | 3300026088 | Bacteria | 1071 |
| 212 | Ga0207641_10949613 | 3300026088 | Bacteria | 855 |
| 213 | Ga0207648_10206906 | 3300026089 | Unclassified | 1741 |
| 214 | Ga0207676_10023487 | 3300026095 | Unclassified | 4550 |
| 215 | Ga0207676_10062728 | 3300026095 | Unclassified | 2949 |
| 216 | Ga0207676_10152927 | 3300026095 | Bacteria | 1989 |
| 217 | Ga0207676_10764552 | 3300026095 | Bacteria | 940 |
| 218 | Ga0207676_12515762 | 3300026095 | Bacteria | 511 |
| 219 | Ga0207674_10292872 | 3300026116 | Bacteria | 1576 |
| 220 | Ga0207675_100202598 | 3300026118 | Bacteria | 1906 |
| 221 | Ga0207675_100239063 | 3300026118 | Unclassified | 1754 |
| 222 | Ga0207683_10196711 | 3300026121 | Unclassified | 1832 |
| 223 | Ga0207698_10564330 | 3300026142 | Unclassified | 1118 |
| 224 | Ga0268266_10007617 | 3300028379 | Bacteria | 9747 |
| 225 | Ga0268266_10305499 | 3300028379 | Bacteria | 1485 |
| 226 | Ga0268266_11035678 | 3300028379 | Unclassified | 794 |
| 227 | Ga0268265_10056937 | 3300028380 | Unclassified | 2977 |
| 228 | Ga0268265_10190499 | 3300028380 | Bacteria | 1770 |
| 229 | Ga0268265_10566909 | 3300028380 | Bacteria | 1080 |
| 230 | Ga0265326_10044203 | 3300028558 | Unclassified | 1264 |
| 231 | Ga0265318_10242804 | 3300028577 | Unclassified | 657 |
| 232 | Ga0265338_10161312 | 3300028800 | Bacteria | 1731 |
| 233 | Ga0265324_10000078 | 3300029957 | Bacteria | 76172 |
| 234 | Ga0265324_10128507 | 3300029957 | Unclassified | 860 |
| 235 | Ga0265325_10055777 | 3300031241 | Bacteria | 2019 |
| 236 | Ga0265339_10000027 | 3300031249 | Bacteria | 158763 |
| 237 | Ga0265313_10034681 | 3300031595 | Bacteria | 2548 |
| 238 | Ga0316576_10058957 | 3300031727 | Unclassified | 2809 |
| 239 | Ga0373944_0340391 | 3300035089 | Bacteria | 569 |
| 240 | Ga0373953_0001987 | 3300035117 | Bacteria | 6075 |
| 241 | Ga0373953_0103162 | 3300035117 | Unclassified | 1202 |
| 242 | Ga0373954_0003481 | 3300035118 | Bacteria | 6682 |
| 243 | Ga0373957_0003081 | 3300035120 | Bacteria | 4860 |
| 244 | Ga0373955_0003104 | 3300035172 | Bacteria | 7270 |
| 245 | Ga0373955_0135970 | 3300035172 | Bacteria | 1438 |
| 246 | Ga0373955_0234712 | 3300035172 | Unclassified | 1098 |
| 247 | Ga0373955_0711743 | 3300035172 | Unclassified | 616 |
| 248 | Ga0373924_0446197 | 3300035410 | Unclassified | 580 |
| 249 | Ga0373933_0000725 | 3300035724 | Bacteria | 20273 |
| 250 | Ga0373947_1001704 | 3300035725 | Bacteria | 570 |
| 251 | Ga0373937_0003453 | 3300036401 | Bacteria | 13273 |
| 252 | Ga0373937_0034482 | 3300036401 | Bacteria | 4604 |
| 253 | Ga0373937_0138897 | 3300036401 | Bacteria | 2273 |
| 254 | Ga0373937_0220296 | 3300036401 | Bacteria | 1786 |
| 255 | Ga0373937_0653431 | 3300036401 | Unclassified | 997 |
| 256 | Ga0316582_0218419 | 3300036647 | Unclassified | 1303 |
| 257 | Ga0316584_0800680 | 3300036712 | Unclassified | 640 |
| 258 | Ga0316584_1063831 | 3300036712 | Unclassified | 538 |
| 259 | Ga0373925_0171573 | 3300037068 | Unclassified | 1713 |
| 260 | Ga0373925_0452281 | 3300037068 | Unclassified | 1052 |
| 261 | Ga0373925_1071551 | 3300037068 | Bacteria | 663 |
| 262 | Ga0451577_0252716 | 3300042876 | Bacteria | 1596 |
| 263 | Ga0451577_0933022 | 3300042876 | Bacteria | 781 |
| 264 | Ga0451577_0971807 | 3300042876 | Bacteria | 763 |
| 265 | Ga0451577_1492724 | 3300042876 | Bacteria | 598 |
| 266 | Ga0451577_1535985 | 3300042876 | Bacteria | 588 |
| 267 | Ga0453683_0274115 | 3300044673 | Unclassified | 1077 |
| 268 | Ga0453684_0000500 | 3300044712 | Bacteria | 153478 |
| 269 | Ga0453684_0000526 | 3300044712 | Bacteria | 146131 |
| 270 | Ga0453684_0002479 | 3300044712 | Bacteria | 44593 |
| 271 | Ga0453684_0095039 | 3300044712 | Bacteria | 3664 |
| 272 | Ga0453684_0263029 | 3300044712 | Bacteria | 1975 |
| 273 | Ga0453684_0539052 | 3300044712 | Bacteria | 1287 |
| 274 | Ga0453684_1766504 | 3300044712 | Bacteria | 630 |
| 275 | Ga0451576_0486325 | 3300045051 | Unclassified | 1296 |
| 276 | Ga0451576_0562320 | 3300045051 | Bacteria | 1198 |
| 277 | Ga0451576_1152382 | 3300045051 | Unclassified | 810 |
| 278 | Ga0451576_2385373 | 3300045051 | Bacteria | 541 |
| 279 | Ga0451576_2614532 | 3300045051 | Bacteria | 515 |
| 280 | Ga0495592_0133276 | 3300046454 | Unclassified | 1735 |
| 281 | Ga0495603_0103096 | 3300046455 | Unclassified | 1665 |
| 282 | Ga0495629_0149466 | 3300046459 | Bacteria | 1624 |
| 283 | Ga0495629_0438543 | 3300046459 | Unclassified | 885 |
| 284 | Ga0495651_0191513 | 3300046462 | Bacteria | 1439 |
| 285 | Ga0495653_0695554 | 3300046463 | Unclassified | 618 |
| 286 | Ga0495582_0102555 | 3300046473 | Unclassified | 1602 |
| 287 | Ga0495639_0191757 | 3300046475 | Unclassified | 998 |
| 288 | Ga0495608_0006714 | 3300046511 | Bacteria | 8161 |
| 289 | Ga0495652_0666515 | 3300046529 | Unclassified | 703 |
| 290 | Ga0495587_0007952 | 3300046536 | Bacteria | 6851 |
| 291 | Ga0495645_0010076 | 3300046543 | Bacteria | 6622 |
| 292 | Ga0495634_0237287 | 3300046642 | Bacteria | 1120 |
| 293 | Ga0495623_0005432 | 3300046679 | Bacteria | 8326 |
| 294 | Ga0495658_0215971 | 3300046683 | Unclassified | 1199 |
| 295 | Ga0495613_0201079 | 3300046689 | Unclassified | 1405 |
| 296 | Ga0495604_0000247 | 3300047317 | Bacteria | 48399 |
| 297 | Ga0495674_0037243 | 3300047319 | Bacteria | 4371 |
| 298 | Ga0495680_0501120 | 3300047322 | Unclassified | 824 |
| 299 | Ga0495684_0063576 | 3300047471 | Unclassified | 2805 |
| 300 | Ga0495593_0162844 | 3300047673 | Unclassified | 1126 |
| 301 | Ga0495602_0007700 | 3300048088 | Bacteria | 11259 |
| 302 | Ga0496108_0287431 | 3300048911 | Bacteria | 1432 |
| 303 | Ga0496112_0407077 | 3300048915 | Bacteria | 1300 |
| 304 | Ga0496113_0193010 | 3300048916 | Unclassified | 1617 |
| 305 | Ga0496114_0160578 | 3300048917 | Bacteria | 1954 |
| 306 | Ga0496114_0389679 | 3300048917 | Bacteria | 1234 |
| 307 | Ga0501074_0800891 | 3300049590 | Unclassified | 664 |
| 308 | Ga0501081_0642703 | 3300049743 | Bacteria | 795 |
| 309 | Ga0501081_1147966 | 3300049743 | Bacteria | 588 |
| 310 | nmdc:mga0yw44_628873_c1 | 3300050492 | Bacteria | 729 |
| 311 | Ga0495601_0014873 | 3300053077 | Bacteria | 4698 |
| 312 | Ga0495595_0391952 | 3300053084 | Unclassified | 703 |
| 313 | Ga0495619_0148161 | 3300053085 | Unclassified | 1618 |
| 314 | Ga0530510_0004836 | 3300061734 | Bacteria | 9320 |
| 315 | Ga0530510_1245458 | 3300061734 | Bacteria | 570 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009177 | Ga0105248_11405575 | Ga0105248_114055752 | 93 |
| 2 | 3300005295 | Ga0065707_10241689 | Ga0065707_102416891 | 99 |
| 3 | 3300005340 | Ga0070689_100198605 | Ga0070689_1001986052 | 99 |
| 4 | 3300005365 | Ga0070688_100282204 | Ga0070688_1002822041 | 99 |
| 5 | 3300005466 | Ga0070685_11052838 | Ga0070685_110528381 | 99 |
| 6 | 3300005471 | Ga0070698_100363152 | Ga0070698_1003631522 | 99 |
| 7 | 3300005617 | Ga0068859_102677447 | Ga0068859_1026774471 | 99 |
| 8 | 3300006931 | Ga0097620_102677399 | Ga0097620_1026773991 | 99 |
| 9 | 3300009094 | Ga0111539_10168405 | Ga0111539_101684053 | 99 |
| 10 | 3300009094 | Ga0111539_10606432 | Ga0111539_106064321 | 99 |
| 11 | 3300009177 | Ga0105248_10451891 | Ga0105248_104518912 | 99 |
| 12 | 3300044712 | Ga0453684_1766504 | Ga0453684_1766504_225_572 | 103 |
| 13 | 3300006844 | Ga0075428_100176774 | Ga0075428_1001767743 | 104 |
| 14 | 3300014325 | Ga0163163_12856695 | Ga0163163_128566951 | 104 |
| 15 | 3300049590 | Ga0501074_0800891 | Ga0501074_0800891_119_433 | 104 |
| 16 | 3300049743 | Ga0501081_0642703 | Ga0501081_0642703_398_712 | 104 |
| 17 | 3300005547 | Ga0070693_101265572 | Ga0070693_1012655721 | 105 |
| 18 | 3300006028 | Ga0070717_11113803 | Ga0070717_111138032 | 105 |
| 19 | 3300009094 | Ga0111539_11479134 | Ga0111539_114791342 | 105 |
| 20 | 3300009098 | Ga0105245_10987602 | Ga0105245_109876022 | 105 |
| 21 | 3300009176 | Ga0105242_11657834 | Ga0105242_116578342 | 105 |
| 22 | 3300009177 | Ga0105248_10077308 | Ga0105248_100773083 | 105 |
| 23 | 3300009177 | Ga0105248_10134132 | Ga0105248_101341322 | 105 |
| 24 | 3300009553 | Ga0105249_13194422 | Ga0105249_131944222 | 105 |
| 25 | 3300011119 | Ga0105246_11337203 | Ga0105246_113372031 | 105 |
| 26 | 3300014968 | Ga0157379_11675192 | Ga0157379_116751922 | 105 |
| 27 | 3300035117 | Ga0373953_0103162 | Ga0373953_0103162_684_1001 | 105 |
| 28 | 3300035172 | Ga0373955_0234712 | Ga0373955_0234712_538_855 | 105 |
| 29 | 3300035410 | Ga0373924_0446197 | Ga0373924_0446197_59_376 | 105 |
| 30 | 3300036401 | Ga0373937_0034482 | Ga0373937_0034482_1987_2304 | 105 |
| 31 | 3300036401 | Ga0373937_0138897 | Ga0373937_0138897_821_1138 | 105 |
| 32 | 3300046459 | Ga0495629_0149466 | Ga0495629_0149466_636_953 | 105 |
| 33 | 3300046529 | Ga0495652_0666515 | Ga0495652_0666515_232_549 | 105 |
| 34 | 3300046543 | Ga0495645_0010076 | Ga0495645_0010076_637_954 | 105 |
| 35 | 3300047319 | Ga0495674_0037243 | Ga0495674_0037243_2933_3250 | 105 |
| 36 | 3300048917 | Ga0496114_0160578 | Ga0496114_0160578_1299_1616 | 105 |
| 37 | 3300048917 | Ga0496114_0389679 | Ga0496114_0389679_241_558 | 105 |
| 38 | 3300053077 | Ga0495601_0014873 | Ga0495601_0014873_873_1190 | 105 |
| 39 | 3300053084 | Ga0495595_0391952 | Ga0495595_0391952_196_513 | 105 |
| 40 | 3300061734 | Ga0530510_1245458 | Ga0530510_1245458_207_524 | 105 |
| 41 | 3300028558 | Ga0265326_10044203 | Ga0265326_100442031 | 110 |
| 42 | 3300028577 | Ga0265318_10242804 | Ga0265318_102428041 | 110 |
| 43 | 3300028800 | Ga0265338_10161312 | Ga0265338_101613122 | 110 |
| 44 | 3300029957 | Ga0265324_10000078 | Ga0265324_1000007843 | 110 |
| 45 | 3300029957 | Ga0265324_10128507 | Ga0265324_101285072 | 110 |
| 46 | 3300031241 | Ga0265325_10055777 | Ga0265325_100557772 | 110 |
| 47 | 3300031249 | Ga0265339_10000027 | Ga0265339_1000002725 | 110 |
| 48 | 3300031595 | Ga0265313_10034681 | Ga0265313_100346812 | 110 |
| 49 | 3300035117 | Ga0373953_0001987 | Ga0373953_0001987_3755_4108 | 110 |
| 50 | 3300035118 | Ga0373954_0003481 | Ga0373954_0003481_660_1013 | 110 |
| 51 | 3300035120 | Ga0373957_0003081 | Ga0373957_0003081_1576_1929 | 110 |
| 52 | 3300035172 | Ga0373955_0003104 | Ga0373955_0003104_6070_6423 | 110 |
| 53 | 3300035724 | Ga0373933_0000725 | Ga0373933_0000725_7693_8046 | 110 |
| 54 | 3300036401 | Ga0373937_0003453 | Ga0373937_0003453_10819_11172 | 110 |
| 55 | 3300036647 | Ga0316582_0218419 | Ga0316582_0218419_425_778 | 110 |
| 56 | 3300036712 | Ga0316584_1063831 | Ga0316584_1063831_173_523 | 110 |
| 57 | 3300042876 | Ga0451577_0933022 | Ga0451577_0933022_193_549 | 110 |
| 58 | 3300044712 | Ga0453684_0263029 | Ga0453684_0263029_1142_1486 | 110 |
| 59 | 3300045051 | Ga0451576_2385373 | Ga0451576_2385373_95_439 | 110 |
| 60 | 3300046454 | Ga0495592_0133276 | Ga0495592_0133276_262_615 | 110 |
| 61 | 3300046462 | Ga0495651_0191513 | Ga0495651_0191513_469_822 | 110 |
| 62 | 3300046463 | Ga0495653_0695554 | Ga0495653_0695554_156_509 | 110 |
| 63 | 3300046511 | Ga0495608_0006714 | Ga0495608_0006714_7183_7536 | 110 |
| 64 | 3300046536 | Ga0495587_0007952 | Ga0495587_0007952_4582_4935 | 110 |
| 65 | 3300046679 | Ga0495623_0005432 | Ga0495623_0005432_1705_2058 | 110 |
| 66 | 3300047317 | Ga0495604_0000247 | Ga0495604_0000247_9713_10066 | 110 |
| 67 | 3300047322 | Ga0495680_0501120 | Ga0495680_0501120_428_781 | 110 |
| 68 | 3300047471 | Ga0495684_0063576 | Ga0495684_0063576_1609_1962 | 110 |
| 69 | 3300048088 | Ga0495602_0007700 | Ga0495602_0007700_2101_2454 | 110 |
| 70 | 3300049743 | Ga0501081_1147966 | Ga0501081_1147966_50_382 | 110 |
| 71 | 3300001977 | JGI24746J21847_1009011 | JGI24746J21847_10090112 | 111 |
| 72 | 3300001991 | JGI24743J22301_10120253 | JGI24743J22301_101202532 | 111 |
| 73 | 3300002073 | JGI24745J21846_1043273 | JGI24745J21846_10432732 | 111 |
| 74 | 3300002074 | JGI24748J21848_1048556 | JGI24748J21848_10485562 | 111 |
| 75 | 3300002076 | JGI24749J21850_1009275 | JGI24749J21850_10092752 | 111 |
| 76 | 3300002126 | JGI24035J26624_1010446 | JGI24035J26624_10104462 | 111 |
| 77 | 3300002459 | JGI24751J29686_10022635 | JGI24751J29686_100226352 | 111 |
| 78 | 3300005290 | Ga0065712_10108984 | Ga0065712_101089842 | 111 |
| 79 | 3300005293 | Ga0065715_10099586 | Ga0065715_100995864 | 111 |
| 80 | 3300005293 | Ga0065715_10373622 | Ga0065715_103736222 | 111 |
| 81 | 3300005295 | Ga0065707_10211859 | Ga0065707_102118591 | 111 |
| 82 | 3300005328 | Ga0070676_10018929 | Ga0070676_100189295 | 111 |
| 83 | 3300005328 | Ga0070676_10957782 | Ga0070676_109577822 | 111 |
| 84 | 3300005331 | Ga0070670_100003145 | Ga0070670_1000031456 | 111 |
| 85 | 3300005331 | Ga0070670_100182074 | Ga0070670_1001820742 | 111 |
| 86 | 3300005331 | Ga0070670_100948537 | Ga0070670_1009485371 | 111 |
| 87 | 3300005331 | Ga0070670_101428691 | Ga0070670_1014286911 | 111 |
| 88 | 3300005334 | Ga0068869_100461103 | Ga0068869_1004611031 | 111 |
| 89 | 3300005334 | Ga0068869_100558519 | Ga0068869_1005585192 | 111 |
| 90 | 3300005334 | Ga0068869_101594143 | Ga0068869_1015941431 | 111 |
| 91 | 3300005334 | Ga0068869_102033371 | Ga0068869_1020333711 | 111 |
| 92 | 3300005335 | Ga0070666_10749886 | Ga0070666_107498862 | 111 |
| 93 | 3300005336 | Ga0070680_101146334 | Ga0070680_1011463342 | 111 |
| 94 | 3300005338 | Ga0068868_100174803 | Ga0068868_1001748033 | 111 |
| 95 | 3300005338 | Ga0068868_100232158 | Ga0068868_1002321582 | 111 |
| 96 | 3300005340 | Ga0070689_100008286 | Ga0070689_1000082862 | 111 |
| 97 | 3300005340 | Ga0070689_100207877 | Ga0070689_1002078772 | 111 |
| 98 | 3300005343 | Ga0070687_100038606 | Ga0070687_1000386064 | 111 |
| 99 | 3300005344 | Ga0070661_100158306 | Ga0070661_1001583062 | 111 |
| 100 | 3300005347 | Ga0070668_100060638 | Ga0070668_1000606383 | 111 |
| 101 | 3300005347 | Ga0070668_100069687 | Ga0070668_1000696874 | 111 |
| 102 | 3300005353 | Ga0070669_100042487 | Ga0070669_1000424874 | 111 |
| 103 | 3300005353 | Ga0070669_100054183 | Ga0070669_1000541834 | 111 |
| 104 | 3300005354 | Ga0070675_100081806 | Ga0070675_1000818064 | 111 |
| 105 | 3300005354 | Ga0070675_100170543 | Ga0070675_1001705432 | 111 |
| 106 | 3300005355 | Ga0070671_100265119 | Ga0070671_1002651192 | 111 |
| 107 | 3300005365 | Ga0070688_100520132 | Ga0070688_1005201321 | 111 |
| 108 | 3300005365 | Ga0070688_100548426 | Ga0070688_1005484262 | 111 |
| 109 | 3300005366 | Ga0070659_100264074 | Ga0070659_1002640742 | 111 |
| 110 | 3300005367 | Ga0070667_100006984 | Ga0070667_10000698411 | 111 |
| 111 | 3300005367 | Ga0070667_102213444 | Ga0070667_1022134441 | 111 |
| 112 | 3300005440 | Ga0070705_101201973 | Ga0070705_1012019731 | 111 |
| 113 | 3300005441 | Ga0070700_100047028 | Ga0070700_1000470284 | 111 |
| 114 | 3300005455 | Ga0070663_100078862 | Ga0070663_1000788625 | 111 |
| 115 | 3300005456 | Ga0070678_100087815 | Ga0070678_1000878152 | 111 |
| 116 | 3300005457 | Ga0070662_100044912 | Ga0070662_1000449124 | 111 |
| 117 | 3300005459 | Ga0068867_100231807 | Ga0068867_1002318072 | 111 |
| 118 | 3300005459 | Ga0068867_100757315 | Ga0068867_1007573151 | 111 |
| 119 | 3300005466 | Ga0070685_10310181 | Ga0070685_103101811 | 111 |
| 120 | 3300005467 | Ga0070706_100616289 | Ga0070706_1006162891 | 111 |
| 121 | 3300005535 | Ga0070684_100936466 | Ga0070684_1009364662 | 111 |
| 122 | 3300005543 | Ga0070672_100124129 | Ga0070672_1001241293 | 111 |
| 123 | 3300005544 | Ga0070686_100044398 | Ga0070686_1000443982 | 111 |
| 124 | 3300005545 | Ga0070695_101168400 | Ga0070695_1011684002 | 111 |
| 125 | 3300005548 | Ga0070665_100057048 | Ga0070665_1000570482 | 111 |
| 126 | 3300005548 | Ga0070665_100880478 | Ga0070665_1008804782 | 111 |
| 127 | 3300005564 | Ga0070664_100490763 | Ga0070664_1004907632 | 111 |
| 128 | 3300005564 | Ga0070664_100582833 | Ga0070664_1005828332 | 111 |
| 129 | 3300005564 | Ga0070664_100796298 | Ga0070664_1007962982 | 111 |
| 130 | 3300005564 | Ga0070664_100871014 | Ga0070664_1008710142 | 111 |
| 131 | 3300005577 | Ga0068857_100273373 | Ga0068857_1002733732 | 111 |
| 132 | 3300005578 | Ga0068854_100476490 | Ga0068854_1004764902 | 111 |
| 133 | 3300005615 | Ga0070702_100947863 | Ga0070702_1009478631 | 111 |
| 134 | 3300005616 | Ga0068852_100797047 | Ga0068852_1007970473 | 111 |
| 135 | 3300005617 | Ga0068859_100170473 | Ga0068859_1001704734 | 111 |
| 136 | 3300005617 | Ga0068859_100242301 | Ga0068859_1002423012 | 111 |
| 137 | 3300005617 | Ga0068859_100459916 | Ga0068859_1004599163 | 111 |
| 138 | 3300005617 | Ga0068859_100543183 | Ga0068859_1005431832 | 111 |
| 139 | 3300005617 | Ga0068859_100948435 | Ga0068859_1009484352 | 111 |
| 140 | 3300005618 | Ga0068864_100007880 | Ga0068864_1000078807 | 111 |
| 141 | 3300005618 | Ga0068864_100021512 | Ga0068864_1000215125 | 111 |
| 142 | 3300005618 | Ga0068864_100056290 | Ga0068864_1000562906 | 111 |
| 143 | 3300005618 | Ga0068864_100618332 | Ga0068864_1006183322 | 111 |
| 144 | 3300005718 | Ga0068866_10298777 | Ga0068866_102987772 | 111 |
| 145 | 3300005719 | Ga0068861_100190431 | Ga0068861_1001904312 | 111 |
| 146 | 3300005719 | Ga0068861_100218304 | Ga0068861_1002183042 | 111 |
| 147 | 3300005719 | Ga0068861_101266819 | Ga0068861_1012668192 | 111 |
| 148 | 3300005719 | Ga0068861_101972760 | Ga0068861_1019727601 | 111 |
| 149 | 3300005834 | Ga0068851_11064313 | Ga0068851_110643132 | 111 |
| 150 | 3300005840 | Ga0068870_10010115 | Ga0068870_100101155 | 111 |
| 151 | 3300005841 | Ga0068863_100339903 | Ga0068863_1003399032 | 111 |
| 152 | 3300005841 | Ga0068863_100419979 | Ga0068863_1004199792 | 111 |
| 153 | 3300005842 | Ga0068858_100005373 | Ga0068858_1000053737 | 111 |
| 154 | 3300005842 | Ga0068858_100048684 | Ga0068858_1000486845 | 111 |
| 155 | 3300005842 | Ga0068858_100169832 | Ga0068858_1001698324 | 111 |
| 156 | 3300005842 | Ga0068858_100424264 | Ga0068858_1004242642 | 111 |
| 157 | 3300005842 | Ga0068858_100879764 | Ga0068858_1008797642 | 111 |
| 158 | 3300005843 | Ga0068860_100589011 | Ga0068860_1005890112 | 111 |
| 159 | 3300005844 | Ga0068862_100067700 | Ga0068862_1000677005 | 111 |
| 160 | 3300005844 | Ga0068862_100136284 | Ga0068862_1001362842 | 111 |
| 161 | 3300005844 | Ga0068862_100494268 | Ga0068862_1004942682 | 111 |
| 162 | 3300006038 | Ga0075365_10402572 | Ga0075365_104025722 | 111 |
| 163 | 3300006237 | Ga0097621_100061714 | Ga0097621_1000617144 | 111 |
| 164 | 3300006237 | Ga0097621_100493191 | Ga0097621_1004931912 | 111 |
| 165 | 3300006847 | Ga0075431_100213297 | Ga0075431_1002132972 | 111 |
| 166 | 3300006871 | Ga0075434_100792887 | Ga0075434_1007928872 | 111 |
| 167 | 3300006881 | Ga0068865_100026305 | Ga0068865_1000263058 | 111 |
| 168 | 3300006881 | Ga0068865_100072789 | Ga0068865_1000727894 | 111 |
| 169 | 3300006914 | Ga0075436_100280957 | Ga0075436_1002809573 | 111 |
| 170 | 3300006914 | Ga0075436_100457522 | Ga0075436_1004575222 | 111 |
| 171 | 3300006931 | Ga0097620_100170471 | Ga0097620_1001704714 | 111 |
| 172 | 3300006931 | Ga0097620_100242290 | Ga0097620_1002422902 | 111 |
| 173 | 3300006931 | Ga0097620_100459894 | Ga0097620_1004598943 | 111 |
| 174 | 3300006931 | Ga0097620_100543178 | Ga0097620_1005431782 | 111 |
| 175 | 3300006931 | Ga0097620_100948259 | Ga0097620_1009482592 | 111 |
| 176 | 3300006931 | Ga0097620_101454625 | Ga0097620_1014546252 | 111 |
| 177 | 3300007076 | Ga0075435_100118537 | Ga0075435_1001185372 | 111 |
| 178 | 3300009098 | Ga0105245_13039566 | Ga0105245_130395661 | 111 |
| 179 | 3300009148 | Ga0105243_10649287 | Ga0105243_106492871 | 111 |
| 180 | 3300009174 | Ga0105241_11727812 | Ga0105241_117278121 | 111 |
| 181 | 3300009177 | Ga0105248_10046216 | Ga0105248_100462164 | 111 |
| 182 | 3300009177 | Ga0105248_10278696 | Ga0105248_102786962 | 111 |
| 183 | 3300009553 | Ga0105249_10056324 | Ga0105249_100563243 | 111 |
| 184 | 3300011119 | Ga0105246_10115122 | Ga0105246_101151222 | 111 |
| 185 | 3300013296 | Ga0157374_10187552 | Ga0157374_101875524 | 111 |
| 186 | 3300013306 | Ga0163162_10075888 | Ga0163162_100758884 | 111 |
| 187 | 3300013308 | Ga0157375_10039715 | Ga0157375_100397151 | 111 |
| 188 | 3300013308 | Ga0157375_10716441 | Ga0157375_107164412 | 111 |
| 189 | 3300014325 | Ga0163163_10032232 | Ga0163163_100322325 | 111 |
| 190 | 3300014325 | Ga0163163_10057591 | Ga0163163_100575914 | 111 |
| 191 | 3300014325 | Ga0163163_10353154 | Ga0163163_103531542 | 111 |
| 192 | 3300014325 | Ga0163163_11351632 | Ga0163163_113516321 | 111 |
| 193 | 3300014325 | Ga0163163_11526073 | Ga0163163_115260731 | 111 |
| 194 | 3300014326 | Ga0157380_10369696 | Ga0157380_103696962 | 111 |
| 195 | 3300014745 | Ga0157377_10014730 | Ga0157377_100147303 | 111 |
| 196 | 3300014745 | Ga0157377_10137486 | Ga0157377_101374862 | 111 |
| 197 | 3300014968 | Ga0157379_10102709 | Ga0157379_101027091 | 111 |
| 198 | 3300014968 | Ga0157379_10353270 | Ga0157379_103532702 | 111 |
| 199 | 3300014968 | Ga0157379_11558068 | Ga0157379_115580681 | 111 |
| 200 | 3300014969 | Ga0157376_10050266 | Ga0157376_100502663 | 111 |
| 201 | 3300014969 | Ga0157376_10236723 | Ga0157376_102367232 | 111 |
| 202 | 3300017792 | Ga0163161_10179919 | Ga0163161_101799191 | 111 |
| 203 | 3300025290 | Ga0207673_1008349 | Ga0207673_10083492 | 111 |
| 204 | 3300025315 | Ga0207697_10011747 | Ga0207697_100117472 | 111 |
| 205 | 3300025893 | Ga0207682_10016883 | Ga0207682_100168833 | 111 |
| 206 | 3300025901 | Ga0207688_10017109 | Ga0207688_100171096 | 111 |
| 207 | 3300025903 | Ga0207680_10500669 | Ga0207680_105006691 | 111 |
| 208 | 3300025907 | Ga0207645_10015259 | Ga0207645_100152592 | 111 |
| 209 | 3300025908 | Ga0207643_10009923 | Ga0207643_100099235 | 111 |
| 210 | 3300025918 | Ga0207662_10041021 | Ga0207662_100410212 | 111 |
| 211 | 3300025920 | Ga0207649_10377870 | Ga0207649_103778701 | 111 |
| 212 | 3300025923 | Ga0207681_10088352 | Ga0207681_100883523 | 111 |
| 213 | 3300025923 | Ga0207681_10120091 | Ga0207681_101200913 | 111 |
| 214 | 3300025925 | Ga0207650_10119168 | Ga0207650_101191682 | 111 |
| 215 | 3300025925 | Ga0207650_10124162 | Ga0207650_101241623 | 111 |
| 216 | 3300025926 | Ga0207659_10054629 | Ga0207659_100546295 | 111 |
| 217 | 3300025926 | Ga0207659_11719960 | Ga0207659_117199602 | 111 |
| 218 | 3300025927 | Ga0207687_10475793 | Ga0207687_104757931 | 111 |
| 219 | 3300025931 | Ga0207644_10612978 | Ga0207644_106129782 | 111 |
| 220 | 3300025931 | Ga0207644_11382448 | Ga0207644_113824482 | 111 |
| 221 | 3300025933 | Ga0207706_10020610 | Ga0207706_100206109 | 111 |
| 222 | 3300025934 | Ga0207686_11198525 | Ga0207686_111985251 | 111 |
| 223 | 3300025936 | Ga0207670_10454357 | Ga0207670_104543572 | 111 |
| 224 | 3300025936 | Ga0207670_10684362 | Ga0207670_106843622 | 111 |
| 225 | 3300025937 | Ga0207669_10364441 | Ga0207669_103644411 | 111 |
| 226 | 3300025938 | Ga0207704_10087945 | Ga0207704_100879452 | 111 |
| 227 | 3300025938 | Ga0207704_10258199 | Ga0207704_102581992 | 111 |
| 228 | 3300025940 | Ga0207691_10023996 | Ga0207691_100239967 | 111 |
| 229 | 3300025941 | Ga0207711_10044308 | Ga0207711_100443083 | 111 |
| 230 | 3300025941 | Ga0207711_10048684 | Ga0207711_100486844 | 111 |
| 231 | 3300025941 | Ga0207711_10063372 | Ga0207711_100633722 | 111 |
| 232 | 3300025941 | Ga0207711_10917325 | Ga0207711_109173251 | 111 |
| 233 | 3300025942 | Ga0207689_10040204 | Ga0207689_100402048 | 111 |
| 234 | 3300025942 | Ga0207689_10276697 | Ga0207689_102766972 | 111 |
| 235 | 3300025942 | Ga0207689_11738176 | Ga0207689_117381762 | 111 |
| 236 | 3300025945 | Ga0207679_10039704 | Ga0207679_100397044 | 111 |
| 237 | 3300025945 | Ga0207679_11127003 | Ga0207679_111270032 | 111 |
| 238 | 3300025945 | Ga0207679_11984977 | Ga0207679_119849771 | 111 |
| 239 | 3300025960 | Ga0207651_10251348 | Ga0207651_102513483 | 111 |
| 240 | 3300025960 | Ga0207651_10732183 | Ga0207651_107321832 | 111 |
| 241 | 3300025961 | Ga0207712_10078049 | Ga0207712_100780494 | 111 |
| 242 | 3300025961 | Ga0207712_10501513 | Ga0207712_105015132 | 111 |
| 243 | 3300025972 | Ga0207668_10133920 | Ga0207668_101339204 | 111 |
| 244 | 3300025972 | Ga0207668_10667155 | Ga0207668_106671552 | 111 |
| 245 | 3300025981 | Ga0207640_10335324 | Ga0207640_103353241 | 111 |
| 246 | 3300025986 | Ga0207658_10196043 | Ga0207658_101960432 | 111 |
| 247 | 3300025986 | Ga0207658_11459196 | Ga0207658_114591961 | 111 |
| 248 | 3300025986 | Ga0207658_11973441 | Ga0207658_119734411 | 111 |
| 249 | 3300026023 | Ga0207677_10243517 | Ga0207677_102435174 | 111 |
| 250 | 3300026023 | Ga0207677_10363292 | Ga0207677_103632921 | 111 |
| 251 | 3300026035 | Ga0207703_10148677 | Ga0207703_101486773 | 111 |
| 252 | 3300026035 | Ga0207703_10479016 | Ga0207703_104790162 | 111 |
| 253 | 3300026035 | Ga0207703_10493893 | Ga0207703_104938932 | 111 |
| 254 | 3300026035 | Ga0207703_11476521 | Ga0207703_114765211 | 111 |
| 255 | 3300026067 | Ga0207678_10095917 | Ga0207678_100959176 | 111 |
| 256 | 3300026075 | Ga0207708_10042827 | Ga0207708_100428276 | 111 |
| 257 | 3300026088 | Ga0207641_10067334 | Ga0207641_100673341 | 111 |
| 258 | 3300026088 | Ga0207641_10607483 | Ga0207641_106074831 | 111 |
| 259 | 3300026088 | Ga0207641_10949613 | Ga0207641_109496131 | 111 |
| 260 | 3300026089 | Ga0207648_10206906 | Ga0207648_102069062 | 111 |
| 261 | 3300026095 | Ga0207676_10023487 | Ga0207676_100234872 | 111 |
| 262 | 3300026095 | Ga0207676_10062728 | Ga0207676_100627284 | 111 |
| 263 | 3300026095 | Ga0207676_10152927 | Ga0207676_101529271 | 111 |
| 264 | 3300026095 | Ga0207676_10764552 | Ga0207676_107645521 | 111 |
| 265 | 3300026095 | Ga0207676_12515762 | Ga0207676_125157621 | 111 |
| 266 | 3300026116 | Ga0207674_10292872 | Ga0207674_102928722 | 111 |
| 267 | 3300026118 | Ga0207675_100202598 | Ga0207675_1002025982 | 111 |
| 268 | 3300026118 | Ga0207675_100239063 | Ga0207675_1002390631 | 111 |
| 269 | 3300026121 | Ga0207683_10196711 | Ga0207683_101967112 | 111 |
| 270 | 3300026142 | Ga0207698_10564330 | Ga0207698_105643302 | 111 |
| 271 | 3300028379 | Ga0268266_10007617 | Ga0268266_100076175 | 111 |
| 272 | 3300028379 | Ga0268266_10305499 | Ga0268266_103054991 | 111 |
| 273 | 3300028379 | Ga0268266_11035678 | Ga0268266_110356782 | 111 |
| 274 | 3300028380 | Ga0268265_10056937 | Ga0268265_100569374 | 111 |
| 275 | 3300028380 | Ga0268265_10190499 | Ga0268265_101904992 | 111 |
| 276 | 3300028380 | Ga0268265_10566909 | Ga0268265_105669091 | 111 |
| 277 | 3300031727 | Ga0316576_10058957 | Ga0316576_100589573 | 111 |
| 278 | 3300035089 | Ga0373944_0340391 | Ga0373944_0340391_130_465 | 111 |
| 279 | 3300035172 | Ga0373955_0135970 | Ga0373955_0135970_861_1196 | 111 |
| 280 | 3300035172 | Ga0373955_0711743 | Ga0373955_0711743_203_538 | 111 |
| 281 | 3300035725 | Ga0373947_1001704 | Ga0373947_1001704_187_522 | 111 |
| 282 | 3300036401 | Ga0373937_0220296 | Ga0373937_0220296_710_1045 | 111 |
| 283 | 3300036401 | Ga0373937_0653431 | Ga0373937_0653431_233_583 | 111 |
| 284 | 3300036712 | Ga0316584_0800680 | Ga0316584_0800680_192_551 | 111 |
| 285 | 3300037068 | Ga0373925_0171573 | Ga0373925_0171573_189_524 | 111 |
| 286 | 3300037068 | Ga0373925_0452281 | Ga0373925_0452281_259_594 | 111 |
| 287 | 3300037068 | Ga0373925_1071551 | Ga0373925_1071551_288_641 | 111 |
| 288 | 3300042876 | Ga0451577_0252716 | Ga0451577_0252716_1018_1365 | 111 |
| 289 | 3300042876 | Ga0451577_0971807 | Ga0451577_0971807_272_619 | 111 |
| 290 | 3300042876 | Ga0451577_1492724 | Ga0451577_1492724_118_465 | 111 |
| 291 | 3300042876 | Ga0451577_1535985 | Ga0451577_1535985_87_434 | 111 |
| 292 | 3300044673 | Ga0453683_0274115 | Ga0453683_0274115_668_1015 | 111 |
| 293 | 3300044712 | Ga0453684_0000500 | Ga0453684_0000500_75333_75680 | 111 |
| 294 | 3300044712 | Ga0453684_0000526 | Ga0453684_0000526_128220_128567 | 111 |
| 295 | 3300044712 | Ga0453684_0002479 | Ga0453684_0002479_18125_18484 | 111 |
| 296 | 3300044712 | Ga0453684_0095039 | Ga0453684_0095039_3007_3354 | 111 |
| 297 | 3300044712 | Ga0453684_0539052 | Ga0453684_0539052_286_633 | 111 |
| 298 | 3300045051 | Ga0451576_0486325 | Ga0451576_0486325_36_371 | 111 |
| 299 | 3300045051 | Ga0451576_0562320 | Ga0451576_0562320_377_739 | 111 |
| 300 | 3300045051 | Ga0451576_1152382 | Ga0451576_1152382_197_544 | 111 |
| 301 | 3300045051 | Ga0451576_2614532 | Ga0451576_2614532_38_385 | 111 |
| 302 | 3300046455 | Ga0495603_0103096 | Ga0495603_0103096_1286_1621 | 111 |
| 303 | 3300046459 | Ga0495629_0438543 | Ga0495629_0438543_268_603 | 111 |
| 304 | 3300046473 | Ga0495582_0102555 | Ga0495582_0102555_109_444 | 111 |
| 305 | 3300046475 | Ga0495639_0191757 | Ga0495639_0191757_379_714 | 111 |
| 306 | 3300046642 | Ga0495634_0237287 | Ga0495634_0237287_19_372 | 111 |
| 307 | 3300046683 | Ga0495658_0215971 | Ga0495658_0215971_196_531 | 111 |
| 308 | 3300046689 | Ga0495613_0201079 | Ga0495613_0201079_523_858 | 111 |
| 309 | 3300047673 | Ga0495593_0162844 | Ga0495593_0162844_91_426 | 111 |
| 310 | 3300048911 | Ga0496108_0287431 | Ga0496108_0287431_1006_1341 | 111 |
| 311 | 3300048915 | Ga0496112_0407077 | Ga0496112_0407077_65_421 | 111 |
| 312 | 3300048916 | Ga0496113_0193010 | Ga0496113_0193010_635_970 | 111 |
| 313 | 3300050492 | nmdc:mga0yw44_628873_c1 | nmdc:mga0yw44_628873_c1_187_546 | 111 |
| 314 | 3300053085 | Ga0495619_0148161 | Ga0495619_0148161_56_391 | 111 |
| 315 | 3300061734 | Ga0530510_0004836 | Ga0530510_0004836_3519_3866 | 111 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rns-assembly1.cif.gz_A | cupin 2 conserved barrel domain protein from leptotrichia buccalis | 0.9724 | 16 | 109 |
| 1y3t-assembly1.cif.gz_B | crystal structure of yxag, a dioxygenase from bacillus subtilis | 0.9527 | 26 | 108 |
| 8hfb-assembly1.cif.gz_B | evolved variant of quercetin 2,4-dioxygenase from bacillus subtilis | 0.9441 | 26 | 108 |
| 1o4t-assembly1.cif.gz_B | crystal structure of a predicted oxalate decarboxylase (tm1287) from thermotoga maritima at 1.95 a resolution | 0.9427 | 26 | 110 |
| 2f4p-assembly2.cif.gz_C | crystal structure of a cupin-like protein (tm1010) from thermotoga maritima msb8 at 1.90 a resolution | 0.9376 | 26 | 108 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1o4tB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9427 | 26 | 110 | 2.60.120.10 |
| af_A0A0P0V3U4_1_196_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.937 | 39 | 109 | 2.60.120.650 |
| af_A0A0P0XHH9_265_498_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.9335 | 38 | 107 | 2.60.120.650 |
| af_A0A1D6FJ77_3_135_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9314 | 39 | 110 | 2.60.120.10 |
| 3rnsA02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9313 | 11 | 109 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A660V027-F1-model_v4 | Cupin domain-containing protein | 0.9939 | 16 | 111 |
|
| AF-A0A1V5QDL3-F1-model_v4 | Cupin domain protein | 0.9929 | 17 | 110 |
|
| AF-A0A832WZQ8-F1-model_v4 | Cupin domain-containing protein | 0.9926 | 17 | 110 |
|
| AF-A0A524N0V7-F1-model_v4 | Cupin domain-containing protein | 0.9921 | 16 | 109 |
|
| AF-A0A7C4T1Q2-F1-model_v4 | Cupin domain-containing protein | 0.9915 | 16 | 110 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar