F403002

General Info

Members Datasets Scaffolds Average Seq Length
315 180 315 111

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100948537|Ga0070670_1009485371
Length 124
Sequence MVNRAARRLSEECVTNPSEMPGAAPVALVTLAAYQDGAVVSRILLKRGGGTVTLFAFDEGQSLSEHTAPFDAIAHVLEGEALITIAGLPLAVPAGDMVLMPANRPHAVAARTRFKMLLTMIRPV

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
143 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 1.59
Rhizosphere 97.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1009011 3300001977 Unclassified 1498
2 JGI24743J22301_10120253 3300001991 Bacteria 575
3 JGI24745J21846_1043273 3300002073 Bacteria 561
4 JGI24748J21848_1048556 3300002074 Bacteria 551
5 JGI24749J21850_1009275 3300002076 Unclassified 1376
6 JGI24035J26624_1010446 3300002126 Bacteria 923
7 JGI24751J29686_10022635 3300002459 Unclassified 1303
8 Ga0065712_10108984 3300005290 Unclassified 1863
9 Ga0065715_10099586 3300005293 Unclassified 3394
10 Ga0065715_10373622 3300005293 Bacteria 917
11 Ga0065707_10211859 3300005295 Unclassified 1262
12 Ga0065707_10241689 3300005295 Bacteria 1133
13 Ga0070676_10018929 3300005328 Bacteria 3823
14 Ga0070676_10957782 3300005328 Bacteria 640
15 Ga0070670_100003145 3300005331 Bacteria 13652
16 Ga0070670_100182074 3300005331 Unclassified 1824
17 Ga0070670_100948537 3300005331 Unclassified 781
18 Ga0070670_101428691 3300005331 Bacteria 635
19 Ga0068869_100461103 3300005334 Bacteria 1055
20 Ga0068869_100558519 3300005334 Unclassified 962
21 Ga0068869_101594143 3300005334 Bacteria 581
22 Ga0068869_102033371 3300005334 Unclassified 516
23 Ga0070666_10749886 3300005335 Unclassified 717
24 Ga0070680_101146334 3300005336 Unclassified 672
25 Ga0068868_100174803 3300005338 Unclassified 1779
26 Ga0068868_100232158 3300005338 Bacteria 1548
27 Ga0070689_100008286 3300005340 Bacteria 7315
28 Ga0070689_100198605 3300005340 Unclassified 1636
29 Ga0070689_100207877 3300005340 Bacteria 1601
30 Ga0070687_100038606 3300005343 Unclassified 2394
31 Ga0070661_100158306 3300005344 Unclassified 1714
32 Ga0070668_100060638 3300005347 Bacteria 2930
33 Ga0070668_100069687 3300005347 Unclassified 2736
34 Ga0070669_100042487 3300005353 Unclassified 3308
35 Ga0070669_100054183 3300005353 Bacteria 2937
36 Ga0070675_100081806 3300005354 Bacteria 2693
37 Ga0070675_100170543 3300005354 Bacteria 1876
38 Ga0070671_100265119 3300005355 Bacteria 1460
39 Ga0070688_100282204 3300005365 Unclassified 1193
40 Ga0070688_100520132 3300005365 Bacteria 900
41 Ga0070688_100548426 3300005365 Bacteria 878
42 Ga0070659_100264074 3300005366 Unclassified 1429
43 Ga0070667_100006984 3300005367 Bacteria 9382
44 Ga0070667_102213444 3300005367 Bacteria 518
45 Ga0070705_101201973 3300005440 Bacteria 625
46 Ga0070700_100047028 3300005441 Unclassified 2669
47 Ga0070663_100078862 3300005455 Unclassified 2415
48 Ga0070678_100087815 3300005456 Unclassified 2375
49 Ga0070662_100044912 3300005457 Unclassified 3168
50 Ga0068867_100231807 3300005459 Unclassified 1493
51 Ga0068867_100757315 3300005459 Unclassified 862
52 Ga0070685_10310181 3300005466 Bacteria 1066
53 Ga0070685_11052838 3300005466 Unclassified 613
54 Ga0070706_100616289 3300005467 Bacteria 1008
55 Ga0070698_100363152 3300005471 Bacteria 1380
56 Ga0070684_100936466 3300005535 Bacteria 812
57 Ga0070672_100124129 3300005543 Unclassified 2116
58 Ga0070686_100044398 3300005544 Unclassified 2793
59 Ga0070695_101168400 3300005545 Bacteria 632
60 Ga0070693_101265572 3300005547 Unclassified 569
61 Ga0070665_100057048 3300005548 Unclassified 3915
62 Ga0070665_100880478 3300005548 Bacteria 908
63 Ga0070664_100490763 3300005564 Bacteria 1131
64 Ga0070664_100582833 3300005564 Unclassified 1036
65 Ga0070664_100796298 3300005564 Bacteria 884
66 Ga0070664_100871014 3300005564 Bacteria 844
67 Ga0068857_100273373 3300005577 Bacteria 1553
68 Ga0068854_100476490 3300005578 Unclassified 1047
69 Ga0070702_100947863 3300005615 Unclassified 677
70 Ga0068852_100797047 3300005616 Bacteria 959
71 Ga0068859_100170473 3300005617 Bacteria 2257
72 Ga0068859_100242301 3300005617 Bacteria 1892
73 Ga0068859_100459916 3300005617 Bacteria 1369
74 Ga0068859_100543183 3300005617 Bacteria 1257
75 Ga0068859_100948435 3300005617 Bacteria 944
76 Ga0068859_102677447 3300005617 Unclassified 548
77 Ga0068864_100007880 3300005618 Bacteria 8779
78 Ga0068864_100021512 3300005618 Bacteria 5402
79 Ga0068864_100056290 3300005618 Unclassified 3397
80 Ga0068864_100618332 3300005618 Bacteria 1053
81 Ga0068866_10298777 3300005718 Bacteria 1005
82 Ga0068861_100190431 3300005719 Unclassified 1714
83 Ga0068861_100218304 3300005719 Bacteria 1610
84 Ga0068861_101266819 3300005719 Unclassified 716
85 Ga0068861_101972760 3300005719 Bacteria 582
86 Ga0068851_11064313 3300005834 Bacteria 512
87 Ga0068870_10010115 3300005840 Unclassified 4317
88 Ga0068863_100339903 3300005841 Unclassified 1460
89 Ga0068863_100419979 3300005841 Unclassified 1310
90 Ga0068858_100005373 3300005842 Bacteria 12559
91 Ga0068858_100048684 3300005842 Unclassified 3926
92 Ga0068858_100169832 3300005842 Unclassified 2056
93 Ga0068858_100424264 3300005842 Unclassified 1279
94 Ga0068858_100879764 3300005842 Unclassified 876
95 Ga0068860_100589011 3300005843 Bacteria 1117
96 Ga0068862_100067700 3300005844 Unclassified 3079
97 Ga0068862_100136284 3300005844 Bacteria 2175
98 Ga0068862_100494268 3300005844 Bacteria 1160
99 Ga0070717_11113803 3300006028 Bacteria 719
100 Ga0075365_10402572 3300006038 Bacteria 966
101 Ga0097621_100061714 3300006237 Unclassified 3075
102 Ga0097621_100493191 3300006237 Bacteria 1109
103 Ga0075428_100176774 3300006844 Unclassified 2312
104 Ga0075431_100213297 3300006847 Unclassified 1971
105 Ga0075434_100792887 3300006871 Bacteria 964
106 Ga0068865_100026305 3300006881 Unclassified 3835
107 Ga0068865_100072789 3300006881 Bacteria 2442
108 Ga0075436_100280957 3300006914 Unclassified 1190
109 Ga0075436_100457522 3300006914 Bacteria 930
110 Ga0097620_100170471 3300006931 Bacteria 2257
111 Ga0097620_100242290 3300006931 Bacteria 1892
112 Ga0097620_100459894 3300006931 Bacteria 1369
113 Ga0097620_100543178 3300006931 Bacteria 1257
114 Ga0097620_100948259 3300006931 Bacteria 944
115 Ga0097620_101454625 3300006931 Unclassified 756
116 Ga0097620_102677399 3300006931 Unclassified 548
117 Ga0075435_100118537 3300007076 Bacteria 2206
118 Ga0111539_10168405 3300009094 Bacteria 2560
119 Ga0111539_10606432 3300009094 Bacteria 1275
120 Ga0111539_11479134 3300009094 Bacteria 788
121 Ga0105245_10987602 3300009098 Bacteria 886
122 Ga0105245_13039566 3300009098 Bacteria 520
123 Ga0105243_10649287 3300009148 Bacteria 1022
124 Ga0105241_11727812 3300009174 Bacteria 609
125 Ga0105242_11657834 3300009176 Bacteria 675
126 Ga0105248_10046216 3300009177 Bacteria 4879
127 Ga0105248_10077308 3300009177 Bacteria 3742
128 Ga0105248_10134132 3300009177 Bacteria 2794
129 Ga0105248_10278696 3300009177 Unclassified 1882
130 Ga0105248_10451891 3300009177 Unclassified 1448
131 Ga0105248_11405575 3300009177 Unclassified 790
132 Ga0105249_10056324 3300009553 Unclassified 3599
133 Ga0105249_13194422 3300009553 Unclassified 527
134 Ga0105246_10115122 3300011119 Bacteria 1983
135 Ga0105246_11337203 3300011119 Bacteria 666
136 Ga0157374_10187552 3300013296 Unclassified 2022
137 Ga0163162_10075888 3300013306 Unclassified 3422
138 Ga0157375_10039715 3300013308 Unclassified 4531
139 Ga0157375_10716441 3300013308 Bacteria 1154
140 Ga0163163_10032232 3300014325 Bacteria 5061
141 Ga0163163_10057591 3300014325 Bacteria 3843
142 Ga0163163_10353154 3300014325 Bacteria 1526
143 Ga0163163_11351632 3300014325 Unclassified 774
144 Ga0163163_11526073 3300014325 Unclassified 729
145 Ga0163163_12856695 3300014325 Unclassified 539
146 Ga0157380_10369696 3300014326 Unclassified 1349
147 Ga0157377_10014730 3300014745 Unclassified 3985
148 Ga0157377_10137486 3300014745 Bacteria 1498
149 Ga0157379_10102709 3300014968 Unclassified 2566
150 Ga0157379_10353270 3300014968 Bacteria 1346
151 Ga0157379_11558068 3300014968 Unclassified 644
152 Ga0157379_11675192 3300014968 Unclassified 622
153 Ga0157376_10050266 3300014969 Unclassified 3458
154 Ga0157376_10236723 3300014969 Unclassified 1699
155 Ga0163161_10179919 3300017792 Unclassified 1621
156 Ga0207673_1008349 3300025290 Unclassified 1310
157 Ga0207697_10011747 3300025315 Unclassified 3695
158 Ga0207682_10016883 3300025893 Bacteria 2849
159 Ga0207688_10017109 3300025901 Unclassified 3939
160 Ga0207680_10500669 3300025903 Bacteria 865
161 Ga0207645_10015259 3300025907 Bacteria 5112
162 Ga0207643_10009923 3300025908 Bacteria 5116
163 Ga0207662_10041021 3300025918 Unclassified 2724
164 Ga0207649_10377870 3300025920 Unclassified 1055
165 Ga0207681_10088352 3300025923 Bacteria 2207
166 Ga0207681_10120091 3300025923 Unclassified 1926
167 Ga0207650_10119168 3300025925 Bacteria 2052
168 Ga0207650_10124162 3300025925 Unclassified 2013
169 Ga0207659_10054629 3300025926 Unclassified 2853
170 Ga0207659_11719960 3300025926 Unclassified 534
171 Ga0207687_10475793 3300025927 Bacteria 1039
172 Ga0207644_10612978 3300025931 Bacteria 904
173 Ga0207644_11382448 3300025931 Bacteria 591
174 Ga0207706_10020610 3300025933 Bacteria 5925
175 Ga0207686_11198525 3300025934 Unclassified 621
176 Ga0207670_10454357 3300025936 Bacteria 1033
177 Ga0207670_10684362 3300025936 Unclassified 848
178 Ga0207669_10364441 3300025937 Bacteria 1121
179 Ga0207704_10087945 3300025938 Bacteria 2031
180 Ga0207704_10258199 3300025938 Unclassified 1312
181 Ga0207691_10023996 3300025940 Bacteria 5737
182 Ga0207711_10044308 3300025941 Bacteria 3798
183 Ga0207711_10048684 3300025941 Bacteria 3626
184 Ga0207711_10063372 3300025941 Bacteria 3191
185 Ga0207711_10917325 3300025941 Bacteria 814
186 Ga0207689_10040204 3300025942 Unclassified 3871
187 Ga0207689_10276697 3300025942 Bacteria 1390
188 Ga0207689_11738176 3300025942 Unclassified 516
189 Ga0207679_10039704 3300025945 Unclassified 3363
190 Ga0207679_11127003 3300025945 Bacteria 720
191 Ga0207679_11984977 3300025945 Unclassified 530
192 Ga0207651_10251348 3300025960 Unclassified 1446
193 Ga0207651_10732183 3300025960 Bacteria 873
194 Ga0207712_10078049 3300025961 Unclassified 2402
195 Ga0207712_10501513 3300025961 Bacteria 1038
196 Ga0207668_10133920 3300025972 Bacteria 1896
197 Ga0207668_10667155 3300025972 Unclassified 911
198 Ga0207640_10335324 3300025981 Unclassified 1209
199 Ga0207658_10196043 3300025986 Unclassified 1682
200 Ga0207658_11459196 3300025986 Unclassified 626
201 Ga0207658_11973441 3300025986 Bacteria 531
202 Ga0207677_10243517 3300026023 Unclassified 1456
203 Ga0207677_10363292 3300026023 Bacteria 1217
204 Ga0207703_10148677 3300026035 Bacteria 2040
205 Ga0207703_10479016 3300026035 Unclassified 1166
206 Ga0207703_10493893 3300026035 Bacteria 1148
207 Ga0207703_11476521 3300026035 Bacteria 654
208 Ga0207678_10095917 3300026067 Unclassified 2534
209 Ga0207708_10042827 3300026075 Unclassified 3450
210 Ga0207641_10067334 3300026088 Unclassified 3067
211 Ga0207641_10607483 3300026088 Bacteria 1071
212 Ga0207641_10949613 3300026088 Bacteria 855
213 Ga0207648_10206906 3300026089 Unclassified 1741
214 Ga0207676_10023487 3300026095 Unclassified 4550
215 Ga0207676_10062728 3300026095 Unclassified 2949
216 Ga0207676_10152927 3300026095 Bacteria 1989
217 Ga0207676_10764552 3300026095 Bacteria 940
218 Ga0207676_12515762 3300026095 Bacteria 511
219 Ga0207674_10292872 3300026116 Bacteria 1576
220 Ga0207675_100202598 3300026118 Bacteria 1906
221 Ga0207675_100239063 3300026118 Unclassified 1754
222 Ga0207683_10196711 3300026121 Unclassified 1832
223 Ga0207698_10564330 3300026142 Unclassified 1118
224 Ga0268266_10007617 3300028379 Bacteria 9747
225 Ga0268266_10305499 3300028379 Bacteria 1485
226 Ga0268266_11035678 3300028379 Unclassified 794
227 Ga0268265_10056937 3300028380 Unclassified 2977
228 Ga0268265_10190499 3300028380 Bacteria 1770
229 Ga0268265_10566909 3300028380 Bacteria 1080
230 Ga0265326_10044203 3300028558 Unclassified 1264
231 Ga0265318_10242804 3300028577 Unclassified 657
232 Ga0265338_10161312 3300028800 Bacteria 1731
233 Ga0265324_10000078 3300029957 Bacteria 76172
234 Ga0265324_10128507 3300029957 Unclassified 860
235 Ga0265325_10055777 3300031241 Bacteria 2019
236 Ga0265339_10000027 3300031249 Bacteria 158763
237 Ga0265313_10034681 3300031595 Bacteria 2548
238 Ga0316576_10058957 3300031727 Unclassified 2809
239 Ga0373944_0340391 3300035089 Bacteria 569
240 Ga0373953_0001987 3300035117 Bacteria 6075
241 Ga0373953_0103162 3300035117 Unclassified 1202
242 Ga0373954_0003481 3300035118 Bacteria 6682
243 Ga0373957_0003081 3300035120 Bacteria 4860
244 Ga0373955_0003104 3300035172 Bacteria 7270
245 Ga0373955_0135970 3300035172 Bacteria 1438
246 Ga0373955_0234712 3300035172 Unclassified 1098
247 Ga0373955_0711743 3300035172 Unclassified 616
248 Ga0373924_0446197 3300035410 Unclassified 580
249 Ga0373933_0000725 3300035724 Bacteria 20273
250 Ga0373947_1001704 3300035725 Bacteria 570
251 Ga0373937_0003453 3300036401 Bacteria 13273
252 Ga0373937_0034482 3300036401 Bacteria 4604
253 Ga0373937_0138897 3300036401 Bacteria 2273
254 Ga0373937_0220296 3300036401 Bacteria 1786
255 Ga0373937_0653431 3300036401 Unclassified 997
256 Ga0316582_0218419 3300036647 Unclassified 1303
257 Ga0316584_0800680 3300036712 Unclassified 640
258 Ga0316584_1063831 3300036712 Unclassified 538
259 Ga0373925_0171573 3300037068 Unclassified 1713
260 Ga0373925_0452281 3300037068 Unclassified 1052
261 Ga0373925_1071551 3300037068 Bacteria 663
262 Ga0451577_0252716 3300042876 Bacteria 1596
263 Ga0451577_0933022 3300042876 Bacteria 781
264 Ga0451577_0971807 3300042876 Bacteria 763
265 Ga0451577_1492724 3300042876 Bacteria 598
266 Ga0451577_1535985 3300042876 Bacteria 588
267 Ga0453683_0274115 3300044673 Unclassified 1077
268 Ga0453684_0000500 3300044712 Bacteria 153478
269 Ga0453684_0000526 3300044712 Bacteria 146131
270 Ga0453684_0002479 3300044712 Bacteria 44593
271 Ga0453684_0095039 3300044712 Bacteria 3664
272 Ga0453684_0263029 3300044712 Bacteria 1975
273 Ga0453684_0539052 3300044712 Bacteria 1287
274 Ga0453684_1766504 3300044712 Bacteria 630
275 Ga0451576_0486325 3300045051 Unclassified 1296
276 Ga0451576_0562320 3300045051 Bacteria 1198
277 Ga0451576_1152382 3300045051 Unclassified 810
278 Ga0451576_2385373 3300045051 Bacteria 541
279 Ga0451576_2614532 3300045051 Bacteria 515
280 Ga0495592_0133276 3300046454 Unclassified 1735
281 Ga0495603_0103096 3300046455 Unclassified 1665
282 Ga0495629_0149466 3300046459 Bacteria 1624
283 Ga0495629_0438543 3300046459 Unclassified 885
284 Ga0495651_0191513 3300046462 Bacteria 1439
285 Ga0495653_0695554 3300046463 Unclassified 618
286 Ga0495582_0102555 3300046473 Unclassified 1602
287 Ga0495639_0191757 3300046475 Unclassified 998
288 Ga0495608_0006714 3300046511 Bacteria 8161
289 Ga0495652_0666515 3300046529 Unclassified 703
290 Ga0495587_0007952 3300046536 Bacteria 6851
291 Ga0495645_0010076 3300046543 Bacteria 6622
292 Ga0495634_0237287 3300046642 Bacteria 1120
293 Ga0495623_0005432 3300046679 Bacteria 8326
294 Ga0495658_0215971 3300046683 Unclassified 1199
295 Ga0495613_0201079 3300046689 Unclassified 1405
296 Ga0495604_0000247 3300047317 Bacteria 48399
297 Ga0495674_0037243 3300047319 Bacteria 4371
298 Ga0495680_0501120 3300047322 Unclassified 824
299 Ga0495684_0063576 3300047471 Unclassified 2805
300 Ga0495593_0162844 3300047673 Unclassified 1126
301 Ga0495602_0007700 3300048088 Bacteria 11259
302 Ga0496108_0287431 3300048911 Bacteria 1432
303 Ga0496112_0407077 3300048915 Bacteria 1300
304 Ga0496113_0193010 3300048916 Unclassified 1617
305 Ga0496114_0160578 3300048917 Bacteria 1954
306 Ga0496114_0389679 3300048917 Bacteria 1234
307 Ga0501074_0800891 3300049590 Unclassified 664
308 Ga0501081_0642703 3300049743 Bacteria 795
309 Ga0501081_1147966 3300049743 Bacteria 588
310 nmdc:mga0yw44_628873_c1 3300050492 Bacteria 729
311 Ga0495601_0014873 3300053077 Bacteria 4698
312 Ga0495595_0391952 3300053084 Unclassified 703
313 Ga0495619_0148161 3300053085 Unclassified 1618
314 Ga0530510_0004836 3300061734 Bacteria 9320
315 Ga0530510_1245458 3300061734 Bacteria 570

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_11405575 Ga0105248_114055752 93
2 3300005295 Ga0065707_10241689 Ga0065707_102416891 99
3 3300005340 Ga0070689_100198605 Ga0070689_1001986052 99
4 3300005365 Ga0070688_100282204 Ga0070688_1002822041 99
5 3300005466 Ga0070685_11052838 Ga0070685_110528381 99
6 3300005471 Ga0070698_100363152 Ga0070698_1003631522 99
7 3300005617 Ga0068859_102677447 Ga0068859_1026774471 99
8 3300006931 Ga0097620_102677399 Ga0097620_1026773991 99
9 3300009094 Ga0111539_10168405 Ga0111539_101684053 99
10 3300009094 Ga0111539_10606432 Ga0111539_106064321 99
11 3300009177 Ga0105248_10451891 Ga0105248_104518912 99
12 3300044712 Ga0453684_1766504 Ga0453684_1766504_225_572 103
13 3300006844 Ga0075428_100176774 Ga0075428_1001767743 104
14 3300014325 Ga0163163_12856695 Ga0163163_128566951 104
15 3300049590 Ga0501074_0800891 Ga0501074_0800891_119_433 104
16 3300049743 Ga0501081_0642703 Ga0501081_0642703_398_712 104
17 3300005547 Ga0070693_101265572 Ga0070693_1012655721 105
18 3300006028 Ga0070717_11113803 Ga0070717_111138032 105
19 3300009094 Ga0111539_11479134 Ga0111539_114791342 105
20 3300009098 Ga0105245_10987602 Ga0105245_109876022 105
21 3300009176 Ga0105242_11657834 Ga0105242_116578342 105
22 3300009177 Ga0105248_10077308 Ga0105248_100773083 105
23 3300009177 Ga0105248_10134132 Ga0105248_101341322 105
24 3300009553 Ga0105249_13194422 Ga0105249_131944222 105
25 3300011119 Ga0105246_11337203 Ga0105246_113372031 105
26 3300014968 Ga0157379_11675192 Ga0157379_116751922 105
27 3300035117 Ga0373953_0103162 Ga0373953_0103162_684_1001 105
28 3300035172 Ga0373955_0234712 Ga0373955_0234712_538_855 105
29 3300035410 Ga0373924_0446197 Ga0373924_0446197_59_376 105
30 3300036401 Ga0373937_0034482 Ga0373937_0034482_1987_2304 105
31 3300036401 Ga0373937_0138897 Ga0373937_0138897_821_1138 105
32 3300046459 Ga0495629_0149466 Ga0495629_0149466_636_953 105
33 3300046529 Ga0495652_0666515 Ga0495652_0666515_232_549 105
34 3300046543 Ga0495645_0010076 Ga0495645_0010076_637_954 105
35 3300047319 Ga0495674_0037243 Ga0495674_0037243_2933_3250 105
36 3300048917 Ga0496114_0160578 Ga0496114_0160578_1299_1616 105
37 3300048917 Ga0496114_0389679 Ga0496114_0389679_241_558 105
38 3300053077 Ga0495601_0014873 Ga0495601_0014873_873_1190 105
39 3300053084 Ga0495595_0391952 Ga0495595_0391952_196_513 105
40 3300061734 Ga0530510_1245458 Ga0530510_1245458_207_524 105
41 3300028558 Ga0265326_10044203 Ga0265326_100442031 110
42 3300028577 Ga0265318_10242804 Ga0265318_102428041 110
43 3300028800 Ga0265338_10161312 Ga0265338_101613122 110
44 3300029957 Ga0265324_10000078 Ga0265324_1000007843 110
45 3300029957 Ga0265324_10128507 Ga0265324_101285072 110
46 3300031241 Ga0265325_10055777 Ga0265325_100557772 110
47 3300031249 Ga0265339_10000027 Ga0265339_1000002725 110
48 3300031595 Ga0265313_10034681 Ga0265313_100346812 110
49 3300035117 Ga0373953_0001987 Ga0373953_0001987_3755_4108 110
50 3300035118 Ga0373954_0003481 Ga0373954_0003481_660_1013 110
51 3300035120 Ga0373957_0003081 Ga0373957_0003081_1576_1929 110
52 3300035172 Ga0373955_0003104 Ga0373955_0003104_6070_6423 110
53 3300035724 Ga0373933_0000725 Ga0373933_0000725_7693_8046 110
54 3300036401 Ga0373937_0003453 Ga0373937_0003453_10819_11172 110
55 3300036647 Ga0316582_0218419 Ga0316582_0218419_425_778 110
56 3300036712 Ga0316584_1063831 Ga0316584_1063831_173_523 110
57 3300042876 Ga0451577_0933022 Ga0451577_0933022_193_549 110
58 3300044712 Ga0453684_0263029 Ga0453684_0263029_1142_1486 110
59 3300045051 Ga0451576_2385373 Ga0451576_2385373_95_439 110
60 3300046454 Ga0495592_0133276 Ga0495592_0133276_262_615 110
61 3300046462 Ga0495651_0191513 Ga0495651_0191513_469_822 110
62 3300046463 Ga0495653_0695554 Ga0495653_0695554_156_509 110
63 3300046511 Ga0495608_0006714 Ga0495608_0006714_7183_7536 110
64 3300046536 Ga0495587_0007952 Ga0495587_0007952_4582_4935 110
65 3300046679 Ga0495623_0005432 Ga0495623_0005432_1705_2058 110
66 3300047317 Ga0495604_0000247 Ga0495604_0000247_9713_10066 110
67 3300047322 Ga0495680_0501120 Ga0495680_0501120_428_781 110
68 3300047471 Ga0495684_0063576 Ga0495684_0063576_1609_1962 110
69 3300048088 Ga0495602_0007700 Ga0495602_0007700_2101_2454 110
70 3300049743 Ga0501081_1147966 Ga0501081_1147966_50_382 110
71 3300001977 JGI24746J21847_1009011 JGI24746J21847_10090112 111
72 3300001991 JGI24743J22301_10120253 JGI24743J22301_101202532 111
73 3300002073 JGI24745J21846_1043273 JGI24745J21846_10432732 111
74 3300002074 JGI24748J21848_1048556 JGI24748J21848_10485562 111
75 3300002076 JGI24749J21850_1009275 JGI24749J21850_10092752 111
76 3300002126 JGI24035J26624_1010446 JGI24035J26624_10104462 111
77 3300002459 JGI24751J29686_10022635 JGI24751J29686_100226352 111
78 3300005290 Ga0065712_10108984 Ga0065712_101089842 111
79 3300005293 Ga0065715_10099586 Ga0065715_100995864 111
80 3300005293 Ga0065715_10373622 Ga0065715_103736222 111
81 3300005295 Ga0065707_10211859 Ga0065707_102118591 111
82 3300005328 Ga0070676_10018929 Ga0070676_100189295 111
83 3300005328 Ga0070676_10957782 Ga0070676_109577822 111
84 3300005331 Ga0070670_100003145 Ga0070670_1000031456 111
85 3300005331 Ga0070670_100182074 Ga0070670_1001820742 111
86 3300005331 Ga0070670_100948537 Ga0070670_1009485371 111
87 3300005331 Ga0070670_101428691 Ga0070670_1014286911 111
88 3300005334 Ga0068869_100461103 Ga0068869_1004611031 111
89 3300005334 Ga0068869_100558519 Ga0068869_1005585192 111
90 3300005334 Ga0068869_101594143 Ga0068869_1015941431 111
91 3300005334 Ga0068869_102033371 Ga0068869_1020333711 111
92 3300005335 Ga0070666_10749886 Ga0070666_107498862 111
93 3300005336 Ga0070680_101146334 Ga0070680_1011463342 111
94 3300005338 Ga0068868_100174803 Ga0068868_1001748033 111
95 3300005338 Ga0068868_100232158 Ga0068868_1002321582 111
96 3300005340 Ga0070689_100008286 Ga0070689_1000082862 111
97 3300005340 Ga0070689_100207877 Ga0070689_1002078772 111
98 3300005343 Ga0070687_100038606 Ga0070687_1000386064 111
99 3300005344 Ga0070661_100158306 Ga0070661_1001583062 111
100 3300005347 Ga0070668_100060638 Ga0070668_1000606383 111
101 3300005347 Ga0070668_100069687 Ga0070668_1000696874 111
102 3300005353 Ga0070669_100042487 Ga0070669_1000424874 111
103 3300005353 Ga0070669_100054183 Ga0070669_1000541834 111
104 3300005354 Ga0070675_100081806 Ga0070675_1000818064 111
105 3300005354 Ga0070675_100170543 Ga0070675_1001705432 111
106 3300005355 Ga0070671_100265119 Ga0070671_1002651192 111
107 3300005365 Ga0070688_100520132 Ga0070688_1005201321 111
108 3300005365 Ga0070688_100548426 Ga0070688_1005484262 111
109 3300005366 Ga0070659_100264074 Ga0070659_1002640742 111
110 3300005367 Ga0070667_100006984 Ga0070667_10000698411 111
111 3300005367 Ga0070667_102213444 Ga0070667_1022134441 111
112 3300005440 Ga0070705_101201973 Ga0070705_1012019731 111
113 3300005441 Ga0070700_100047028 Ga0070700_1000470284 111
114 3300005455 Ga0070663_100078862 Ga0070663_1000788625 111
115 3300005456 Ga0070678_100087815 Ga0070678_1000878152 111
116 3300005457 Ga0070662_100044912 Ga0070662_1000449124 111
117 3300005459 Ga0068867_100231807 Ga0068867_1002318072 111
118 3300005459 Ga0068867_100757315 Ga0068867_1007573151 111
119 3300005466 Ga0070685_10310181 Ga0070685_103101811 111
120 3300005467 Ga0070706_100616289 Ga0070706_1006162891 111
121 3300005535 Ga0070684_100936466 Ga0070684_1009364662 111
122 3300005543 Ga0070672_100124129 Ga0070672_1001241293 111
123 3300005544 Ga0070686_100044398 Ga0070686_1000443982 111
124 3300005545 Ga0070695_101168400 Ga0070695_1011684002 111
125 3300005548 Ga0070665_100057048 Ga0070665_1000570482 111
126 3300005548 Ga0070665_100880478 Ga0070665_1008804782 111
127 3300005564 Ga0070664_100490763 Ga0070664_1004907632 111
128 3300005564 Ga0070664_100582833 Ga0070664_1005828332 111
129 3300005564 Ga0070664_100796298 Ga0070664_1007962982 111
130 3300005564 Ga0070664_100871014 Ga0070664_1008710142 111
131 3300005577 Ga0068857_100273373 Ga0068857_1002733732 111
132 3300005578 Ga0068854_100476490 Ga0068854_1004764902 111
133 3300005615 Ga0070702_100947863 Ga0070702_1009478631 111
134 3300005616 Ga0068852_100797047 Ga0068852_1007970473 111
135 3300005617 Ga0068859_100170473 Ga0068859_1001704734 111
136 3300005617 Ga0068859_100242301 Ga0068859_1002423012 111
137 3300005617 Ga0068859_100459916 Ga0068859_1004599163 111
138 3300005617 Ga0068859_100543183 Ga0068859_1005431832 111
139 3300005617 Ga0068859_100948435 Ga0068859_1009484352 111
140 3300005618 Ga0068864_100007880 Ga0068864_1000078807 111
141 3300005618 Ga0068864_100021512 Ga0068864_1000215125 111
142 3300005618 Ga0068864_100056290 Ga0068864_1000562906 111
143 3300005618 Ga0068864_100618332 Ga0068864_1006183322 111
144 3300005718 Ga0068866_10298777 Ga0068866_102987772 111
145 3300005719 Ga0068861_100190431 Ga0068861_1001904312 111
146 3300005719 Ga0068861_100218304 Ga0068861_1002183042 111
147 3300005719 Ga0068861_101266819 Ga0068861_1012668192 111
148 3300005719 Ga0068861_101972760 Ga0068861_1019727601 111
149 3300005834 Ga0068851_11064313 Ga0068851_110643132 111
150 3300005840 Ga0068870_10010115 Ga0068870_100101155 111
151 3300005841 Ga0068863_100339903 Ga0068863_1003399032 111
152 3300005841 Ga0068863_100419979 Ga0068863_1004199792 111
153 3300005842 Ga0068858_100005373 Ga0068858_1000053737 111
154 3300005842 Ga0068858_100048684 Ga0068858_1000486845 111
155 3300005842 Ga0068858_100169832 Ga0068858_1001698324 111
156 3300005842 Ga0068858_100424264 Ga0068858_1004242642 111
157 3300005842 Ga0068858_100879764 Ga0068858_1008797642 111
158 3300005843 Ga0068860_100589011 Ga0068860_1005890112 111
159 3300005844 Ga0068862_100067700 Ga0068862_1000677005 111
160 3300005844 Ga0068862_100136284 Ga0068862_1001362842 111
161 3300005844 Ga0068862_100494268 Ga0068862_1004942682 111
162 3300006038 Ga0075365_10402572 Ga0075365_104025722 111
163 3300006237 Ga0097621_100061714 Ga0097621_1000617144 111
164 3300006237 Ga0097621_100493191 Ga0097621_1004931912 111
165 3300006847 Ga0075431_100213297 Ga0075431_1002132972 111
166 3300006871 Ga0075434_100792887 Ga0075434_1007928872 111
167 3300006881 Ga0068865_100026305 Ga0068865_1000263058 111
168 3300006881 Ga0068865_100072789 Ga0068865_1000727894 111
169 3300006914 Ga0075436_100280957 Ga0075436_1002809573 111
170 3300006914 Ga0075436_100457522 Ga0075436_1004575222 111
171 3300006931 Ga0097620_100170471 Ga0097620_1001704714 111
172 3300006931 Ga0097620_100242290 Ga0097620_1002422902 111
173 3300006931 Ga0097620_100459894 Ga0097620_1004598943 111
174 3300006931 Ga0097620_100543178 Ga0097620_1005431782 111
175 3300006931 Ga0097620_100948259 Ga0097620_1009482592 111
176 3300006931 Ga0097620_101454625 Ga0097620_1014546252 111
177 3300007076 Ga0075435_100118537 Ga0075435_1001185372 111
178 3300009098 Ga0105245_13039566 Ga0105245_130395661 111
179 3300009148 Ga0105243_10649287 Ga0105243_106492871 111
180 3300009174 Ga0105241_11727812 Ga0105241_117278121 111
181 3300009177 Ga0105248_10046216 Ga0105248_100462164 111
182 3300009177 Ga0105248_10278696 Ga0105248_102786962 111
183 3300009553 Ga0105249_10056324 Ga0105249_100563243 111
184 3300011119 Ga0105246_10115122 Ga0105246_101151222 111
185 3300013296 Ga0157374_10187552 Ga0157374_101875524 111
186 3300013306 Ga0163162_10075888 Ga0163162_100758884 111
187 3300013308 Ga0157375_10039715 Ga0157375_100397151 111
188 3300013308 Ga0157375_10716441 Ga0157375_107164412 111
189 3300014325 Ga0163163_10032232 Ga0163163_100322325 111
190 3300014325 Ga0163163_10057591 Ga0163163_100575914 111
191 3300014325 Ga0163163_10353154 Ga0163163_103531542 111
192 3300014325 Ga0163163_11351632 Ga0163163_113516321 111
193 3300014325 Ga0163163_11526073 Ga0163163_115260731 111
194 3300014326 Ga0157380_10369696 Ga0157380_103696962 111
195 3300014745 Ga0157377_10014730 Ga0157377_100147303 111
196 3300014745 Ga0157377_10137486 Ga0157377_101374862 111
197 3300014968 Ga0157379_10102709 Ga0157379_101027091 111
198 3300014968 Ga0157379_10353270 Ga0157379_103532702 111
199 3300014968 Ga0157379_11558068 Ga0157379_115580681 111
200 3300014969 Ga0157376_10050266 Ga0157376_100502663 111
201 3300014969 Ga0157376_10236723 Ga0157376_102367232 111
202 3300017792 Ga0163161_10179919 Ga0163161_101799191 111
203 3300025290 Ga0207673_1008349 Ga0207673_10083492 111
204 3300025315 Ga0207697_10011747 Ga0207697_100117472 111
205 3300025893 Ga0207682_10016883 Ga0207682_100168833 111
206 3300025901 Ga0207688_10017109 Ga0207688_100171096 111
207 3300025903 Ga0207680_10500669 Ga0207680_105006691 111
208 3300025907 Ga0207645_10015259 Ga0207645_100152592 111
209 3300025908 Ga0207643_10009923 Ga0207643_100099235 111
210 3300025918 Ga0207662_10041021 Ga0207662_100410212 111
211 3300025920 Ga0207649_10377870 Ga0207649_103778701 111
212 3300025923 Ga0207681_10088352 Ga0207681_100883523 111
213 3300025923 Ga0207681_10120091 Ga0207681_101200913 111
214 3300025925 Ga0207650_10119168 Ga0207650_101191682 111
215 3300025925 Ga0207650_10124162 Ga0207650_101241623 111
216 3300025926 Ga0207659_10054629 Ga0207659_100546295 111
217 3300025926 Ga0207659_11719960 Ga0207659_117199602 111
218 3300025927 Ga0207687_10475793 Ga0207687_104757931 111
219 3300025931 Ga0207644_10612978 Ga0207644_106129782 111
220 3300025931 Ga0207644_11382448 Ga0207644_113824482 111
221 3300025933 Ga0207706_10020610 Ga0207706_100206109 111
222 3300025934 Ga0207686_11198525 Ga0207686_111985251 111
223 3300025936 Ga0207670_10454357 Ga0207670_104543572 111
224 3300025936 Ga0207670_10684362 Ga0207670_106843622 111
225 3300025937 Ga0207669_10364441 Ga0207669_103644411 111
226 3300025938 Ga0207704_10087945 Ga0207704_100879452 111
227 3300025938 Ga0207704_10258199 Ga0207704_102581992 111
228 3300025940 Ga0207691_10023996 Ga0207691_100239967 111
229 3300025941 Ga0207711_10044308 Ga0207711_100443083 111
230 3300025941 Ga0207711_10048684 Ga0207711_100486844 111
231 3300025941 Ga0207711_10063372 Ga0207711_100633722 111
232 3300025941 Ga0207711_10917325 Ga0207711_109173251 111
233 3300025942 Ga0207689_10040204 Ga0207689_100402048 111
234 3300025942 Ga0207689_10276697 Ga0207689_102766972 111
235 3300025942 Ga0207689_11738176 Ga0207689_117381762 111
236 3300025945 Ga0207679_10039704 Ga0207679_100397044 111
237 3300025945 Ga0207679_11127003 Ga0207679_111270032 111
238 3300025945 Ga0207679_11984977 Ga0207679_119849771 111
239 3300025960 Ga0207651_10251348 Ga0207651_102513483 111
240 3300025960 Ga0207651_10732183 Ga0207651_107321832 111
241 3300025961 Ga0207712_10078049 Ga0207712_100780494 111
242 3300025961 Ga0207712_10501513 Ga0207712_105015132 111
243 3300025972 Ga0207668_10133920 Ga0207668_101339204 111
244 3300025972 Ga0207668_10667155 Ga0207668_106671552 111
245 3300025981 Ga0207640_10335324 Ga0207640_103353241 111
246 3300025986 Ga0207658_10196043 Ga0207658_101960432 111
247 3300025986 Ga0207658_11459196 Ga0207658_114591961 111
248 3300025986 Ga0207658_11973441 Ga0207658_119734411 111
249 3300026023 Ga0207677_10243517 Ga0207677_102435174 111
250 3300026023 Ga0207677_10363292 Ga0207677_103632921 111
251 3300026035 Ga0207703_10148677 Ga0207703_101486773 111
252 3300026035 Ga0207703_10479016 Ga0207703_104790162 111
253 3300026035 Ga0207703_10493893 Ga0207703_104938932 111
254 3300026035 Ga0207703_11476521 Ga0207703_114765211 111
255 3300026067 Ga0207678_10095917 Ga0207678_100959176 111
256 3300026075 Ga0207708_10042827 Ga0207708_100428276 111
257 3300026088 Ga0207641_10067334 Ga0207641_100673341 111
258 3300026088 Ga0207641_10607483 Ga0207641_106074831 111
259 3300026088 Ga0207641_10949613 Ga0207641_109496131 111
260 3300026089 Ga0207648_10206906 Ga0207648_102069062 111
261 3300026095 Ga0207676_10023487 Ga0207676_100234872 111
262 3300026095 Ga0207676_10062728 Ga0207676_100627284 111
263 3300026095 Ga0207676_10152927 Ga0207676_101529271 111
264 3300026095 Ga0207676_10764552 Ga0207676_107645521 111
265 3300026095 Ga0207676_12515762 Ga0207676_125157621 111
266 3300026116 Ga0207674_10292872 Ga0207674_102928722 111
267 3300026118 Ga0207675_100202598 Ga0207675_1002025982 111
268 3300026118 Ga0207675_100239063 Ga0207675_1002390631 111
269 3300026121 Ga0207683_10196711 Ga0207683_101967112 111
270 3300026142 Ga0207698_10564330 Ga0207698_105643302 111
271 3300028379 Ga0268266_10007617 Ga0268266_100076175 111
272 3300028379 Ga0268266_10305499 Ga0268266_103054991 111
273 3300028379 Ga0268266_11035678 Ga0268266_110356782 111
274 3300028380 Ga0268265_10056937 Ga0268265_100569374 111
275 3300028380 Ga0268265_10190499 Ga0268265_101904992 111
276 3300028380 Ga0268265_10566909 Ga0268265_105669091 111
277 3300031727 Ga0316576_10058957 Ga0316576_100589573 111
278 3300035089 Ga0373944_0340391 Ga0373944_0340391_130_465 111
279 3300035172 Ga0373955_0135970 Ga0373955_0135970_861_1196 111
280 3300035172 Ga0373955_0711743 Ga0373955_0711743_203_538 111
281 3300035725 Ga0373947_1001704 Ga0373947_1001704_187_522 111
282 3300036401 Ga0373937_0220296 Ga0373937_0220296_710_1045 111
283 3300036401 Ga0373937_0653431 Ga0373937_0653431_233_583 111
284 3300036712 Ga0316584_0800680 Ga0316584_0800680_192_551 111
285 3300037068 Ga0373925_0171573 Ga0373925_0171573_189_524 111
286 3300037068 Ga0373925_0452281 Ga0373925_0452281_259_594 111
287 3300037068 Ga0373925_1071551 Ga0373925_1071551_288_641 111
288 3300042876 Ga0451577_0252716 Ga0451577_0252716_1018_1365 111
289 3300042876 Ga0451577_0971807 Ga0451577_0971807_272_619 111
290 3300042876 Ga0451577_1492724 Ga0451577_1492724_118_465 111
291 3300042876 Ga0451577_1535985 Ga0451577_1535985_87_434 111
292 3300044673 Ga0453683_0274115 Ga0453683_0274115_668_1015 111
293 3300044712 Ga0453684_0000500 Ga0453684_0000500_75333_75680 111
294 3300044712 Ga0453684_0000526 Ga0453684_0000526_128220_128567 111
295 3300044712 Ga0453684_0002479 Ga0453684_0002479_18125_18484 111
296 3300044712 Ga0453684_0095039 Ga0453684_0095039_3007_3354 111
297 3300044712 Ga0453684_0539052 Ga0453684_0539052_286_633 111
298 3300045051 Ga0451576_0486325 Ga0451576_0486325_36_371 111
299 3300045051 Ga0451576_0562320 Ga0451576_0562320_377_739 111
300 3300045051 Ga0451576_1152382 Ga0451576_1152382_197_544 111
301 3300045051 Ga0451576_2614532 Ga0451576_2614532_38_385 111
302 3300046455 Ga0495603_0103096 Ga0495603_0103096_1286_1621 111
303 3300046459 Ga0495629_0438543 Ga0495629_0438543_268_603 111
304 3300046473 Ga0495582_0102555 Ga0495582_0102555_109_444 111
305 3300046475 Ga0495639_0191757 Ga0495639_0191757_379_714 111
306 3300046642 Ga0495634_0237287 Ga0495634_0237287_19_372 111
307 3300046683 Ga0495658_0215971 Ga0495658_0215971_196_531 111
308 3300046689 Ga0495613_0201079 Ga0495613_0201079_523_858 111
309 3300047673 Ga0495593_0162844 Ga0495593_0162844_91_426 111
310 3300048911 Ga0496108_0287431 Ga0496108_0287431_1006_1341 111
311 3300048915 Ga0496112_0407077 Ga0496112_0407077_65_421 111
312 3300048916 Ga0496113_0193010 Ga0496113_0193010_635_970 111
313 3300050492 nmdc:mga0yw44_628873_c1 nmdc:mga0yw44_628873_c1_187_546 111
314 3300053085 Ga0495619_0148161 Ga0495619_0148161_56_391 111
315 3300061734 Ga0530510_0004836 Ga0530510_0004836_3519_3866 111

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

53

122

0.89

PF02311

AraC_binding

AraC-like ligand binding domain

48

123

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rns-assembly1.cif.gz_A cupin 2 conserved barrel domain protein from leptotrichia buccalis 0.9724 16 109
1y3t-assembly1.cif.gz_B crystal structure of yxag, a dioxygenase from bacillus subtilis 0.9527 26 108
8hfb-assembly1.cif.gz_B evolved variant of quercetin 2,4-dioxygenase from bacillus subtilis 0.9441 26 108
1o4t-assembly1.cif.gz_B crystal structure of a predicted oxalate decarboxylase (tm1287) from thermotoga maritima at 1.95 a resolution 0.9427 26 110
2f4p-assembly2.cif.gz_C crystal structure of a cupin-like protein (tm1010) from thermotoga maritima msb8 at 1.90 a resolution 0.9376 26 108
ID Description Score Start End Superfamily
1o4tB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9427 26 110 2.60.120.10
af_A0A0P0V3U4_1_196_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.937 39 109 2.60.120.650
af_A0A0P0XHH9_265_498_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9335 38 107 2.60.120.650
af_A0A1D6FJ77_3_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9314 39 110 2.60.120.10
3rnsA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9313 11 109 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A660V027-F1-model_v4 Cupin domain-containing protein 0.9939 16 111
AF-A0A1V5QDL3-F1-model_v4 Cupin domain protein 0.9929 17 110
AF-A0A832WZQ8-F1-model_v4 Cupin domain-containing protein 0.9926 17 110
AF-A0A524N0V7-F1-model_v4 Cupin domain-containing protein 0.9921 16 109
AF-A0A7C4T1Q2-F1-model_v4 Cupin domain-containing protein 0.9915 16 110

Feature Viewer

pLDDT pTM Quality
93.86 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map