F402742

General Info

Members Datasets Scaffolds Average Seq Length
314 210 628 284

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10174960|Ga0307511_101749602
Length 307
Sequence MALVDATSPARAAHAEQHCKTGGVRIDLHTHSTASDGTDTPTELVRNAAAAGLDVVAITDHDTTAGWTEAVDALPTGLTLVRGMEMSCIGLGEDGWPVPVHLLAYLFDPADRSFADERERLRAERVXXXXAMAERMRADGLPIDPDAVLASAGPSAGRPHLARALVEAGVVPSVDAAFIELLAPRGRYYAEKADTPLRRAVEMIATAGGVSVLAHTRARKRGRLLAFDDIRELATLGLGGLEIDHPDHSAADRALLQELAAELGLITTGSSDYHGANKAIRLGEFTTDPAQFEELAGKATGVPVIAS

Samples

Sample ID Description Type Environment
1 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
117 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
118 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
119 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
182 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
183 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
184 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
189 2547132424 Nocardia nova SH22a Isolate Unclassified
190 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
191 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
192 2643221692 Nocardia sp. Root136 Isolate Unclassified
193 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
194 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
195 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
196 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
197 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
198 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
199 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
200 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
201 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
202 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
203 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
204 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
205 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
206 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
207 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
208 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
209 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
210 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.68
Metatranscriptomes 0.32
Isolates 7.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 0
Rhizoplane 2.55
Rhizosphere 90.45
Stem 0
Stem Tuber 0
Unclassified 6.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307511_10174960 3300030521 Bacteria 1170
2 JGI24751J29686_10009996 3300002459 Bacteria 1954
3 Ga0070658_10090832 3300005327 Bacteria 2516
4 Ga0070658_10134592 3300005327 Bacteria 2061
5 Ga0070676_10153926 3300005328 Bacteria 1474
6 Ga0070690_100173045 3300005330 Bacteria 1487
7 Ga0070670_100029998 3300005331 Bacteria 4683
8 Ga0068869_100043006 3300005334 Bacteria 3242
9 Ga0070666_10006486 3300005335 Bacteria 7189
10 Ga0070680_100028927 3300005336 Bacteria 4448
11 Ga0070689_100031952 3300005340 Bacteria 4002
12 Ga0070691_10002009 3300005341 Bacteria 8969
13 Ga0070661_100119454 3300005344 Bacteria 1973
14 Ga0070692_10010613 3300005345 Bacteria 4201
15 Ga0070675_100014224 3300005354 Bacteria 6273
16 Ga0070671_100059291 3300005355 Unclassified 3185
17 Ga0070674_100100800 3300005356 Bacteria 2103
18 Ga0070673_100120558 3300005364 Bacteria 2187
19 Ga0070688_100037185 3300005365 Bacteria 2965
20 Ga0070709_10001759 3300005434 Bacteria 11777
21 Ga0070714_100019179 3300005435 Bacteria 5567
22 Ga0070714_100779192 3300005435 Bacteria 925
23 Ga0070713_100001846 3300005436 Bacteria 13663
24 Ga0070713_100174406 3300005436 Bacteria 1928
25 Ga0070710_10014257 3300005437 Bacteria 3998
26 Ga0070711_100006170 3300005439 Bacteria 7209
27 Ga0070700_100032406 3300005441 Bacteria 3140
28 Ga0070663_100016169 3300005455 Bacteria 4836
29 Ga0070678_100011669 3300005456 Bacteria 5431
30 Ga0068867_100240553 3300005459 Bacteria 1468
31 Ga0070679_100020645 3300005530 Bacteria 6423
32 Ga0068853_100010607 3300005539 Bacteria 7453
33 Ga0070672_100056416 3300005543 Bacteria 3080
34 Ga0070693_100000306 3300005547 Bacteria 22765
35 Ga0070665_100016151 3300005548 Bacteria 7493
36 Ga0068855_100209082 3300005563 Bacteria 2194
37 Ga0068854_100074543 3300005578 Bacteria 2490
38 Ga0068856_100359995 3300005614 Bacteria 1473
39 Ga0070702_100000311 3300005615 Bacteria 16805
40 Ga0068859_100024488 3300005617 Bacteria 6056
41 Ga0068864_100025108 3300005618 Bacteria 5016
42 Ga0068851_10008118 3300005834 Bacteria 4844
43 Ga0068870_10001346 3300005840 Bacteria 9915
44 Ga0068863_100011457 3300005841 Bacteria 8574
45 Ga0068863_100015174 3300005841 Bacteria 7401
46 Ga0068858_100032051 3300005842 Bacteria 4882
47 Ga0068858_100056729 3300005842 Bacteria 3619
48 Ga0068860_100000067 3300005843 Bacteria 180176
49 Ga0068860_100386123 3300005843 Bacteria 1383
50 Ga0068862_100172394 3300005844 Bacteria 1938
51 Ga0070717_10276950 3300006028 Bacteria 1487
52 Ga0075364_10056190 3300006051 Bacteria 2577
53 Ga0075432_10005820 3300006058 Bacteria 4194
54 Ga0068871_100006255 3300006358 Bacteria 8397
55 Ga0075434_100023217 3300006871 Bacteria 6043
56 Ga0075436_100009879 3300006914 Bacteria 6528
57 Ga0097620_100024488 3300006931 Bacteria 6056
58 Ga0105251_10014379 3300009011 Bacteria 4377
59 Ga0105240_10209608 3300009093 Bacteria 2278
60 Ga0111539_10058807 3300009094 Bacteria 4559
61 Ga0105245_10178530 3300009098 Bacteria 2027
62 Ga0114129_10187434 3300009147 Bacteria 2811
63 Ga0114129_10191245 3300009147 Bacteria 2778
64 Ga0105241_10005599 3300009174 Bacteria 9274
65 Ga0105248_10034030 3300009177 Bacteria 5696
66 Ga0105237_10083699 3300009545 Bacteria 3181
67 Ga0105238_10221229 3300009551 Bacteria 1869
68 Ga0105239_10070562 3300010375 Bacteria 3838
69 Ga0105246_10000477 3300011119 Bacteria 21587
70 Ga0157370_10023768 3300013104 Bacteria 6081
71 Ga0157374_10018491 3300013296 Bacteria 6151
72 Ga0157372_10057432 3300013307 Bacteria 4350
73 Ga0157375_10021330 3300013308 Bacteria 5936
74 Ga0163163_10159639 3300014325 Bacteria 2300
75 Ga0157380_10498377 3300014326 Bacteria 1182
76 Ga0182008_10025809 3300014497 Bacteria 2983
77 Ga0157377_10001745 3300014745 Bacteria 9478
78 Ga0157379_10128626 3300014968 Bacteria 2279
79 Ga0157376_10049847 3300014969 Bacteria 3470
80 Ga0206356_11910987 3300020070 Bacteria 2437
81 Ga0207656_10067292 3300025321 Bacteria 1585
82 Ga0207688_10007494 3300025901 Bacteria 5934
83 Ga0207680_10001372 3300025903 Bacteria 11532
84 Ga0207647_10101642 3300025904 Bacteria 1705
85 Ga0207699_10279156 3300025906 Bacteria 1160
86 Ga0207645_10045100 3300025907 Bacteria 2818
87 Ga0207643_10001271 3300025908 Bacteria 14739
88 Ga0207705_10016870 3300025909 Bacteria 5231
89 Ga0207654_10002878 3300025911 Bacteria 8731
90 Ga0207693_10033114 3300025915 Bacteria 4079
91 Ga0207660_10010014 3300025917 Bacteria 6141
92 Ga0207657_10010401 3300025919 Bacteria 9287
93 Ga0207649_10059750 3300025920 Bacteria 2393
94 Ga0207652_10016757 3300025921 Bacteria 5988
95 Ga0207694_10038921 3300025924 Bacteria 3657
96 Ga0207650_10004601 3300025925 Bacteria 9438
97 Ga0207687_10015358 3300025927 Bacteria 5020
98 Ga0207700_10009272 3300025928 Bacteria 6139
99 Ga0207700_10203418 3300025928 Bacteria 1670
100 Ga0207664_10633532 3300025929 Bacteria 961
101 Ga0207706_10067058 3300025933 Bacteria 3157
102 Ga0207670_10025103 3300025936 Bacteria 3736
103 Ga0207691_10120767 3300025940 Bacteria 2322
104 Ga0207689_10002005 3300025942 Bacteria 19226
105 Ga0207661_10002435 3300025944 Bacteria 12825
106 Ga0207679_10008102 3300025945 Bacteria 6682
107 Ga0207651_10035272 3300025960 Bacteria 3250
108 Ga0207640_10019743 3300025981 Bacteria 3987
109 Ga0207677_10150596 3300026023 Bacteria 1794
110 Ga0207703_10083410 3300026035 Bacteria 2670
111 Ga0207703_10084299 3300026035 Bacteria 2657
112 Ga0207678_10000891 3300026067 Bacteria 27453
113 Ga0207708_10057141 3300026075 Bacteria 2977
114 Ga0207702_10000901 3300026078 Bacteria 30858
115 Ga0207702_10097213 3300026078 Bacteria 2591
116 Ga0207641_10008654 3300026088 Bacteria 8404
117 Ga0207641_10020400 3300026088 Bacteria 5443
118 Ga0207648_10137873 3300026089 Bacteria 2149
119 Ga0207676_10000683 3300026095 Bacteria 26944
120 Ga0207675_100141802 3300026118 Bacteria 2283
121 Ga0207683_10001117 3300026121 Bacteria 24390
122 Ga0268266_10009773 3300028379 Bacteria 8438
123 Ga0268266_10023217 3300028379 Bacteria 5282
124 Ga0268265_10155231 3300028380 Bacteria 1936
125 Ga0268264_10000114 3300028381 Bacteria 203211
126 Ga0268264_10055990 3300028381 Bacteria 3295
127 Ga0307517_10023238 3300028786 Bacteria 7718
128 Ga0307511_10001322 3300030521 Bacteria 26289
129 Ga0307509_10101100 3300031507 Bacteria 2919
130 Ga0307518_10000112 3300031838 Bacteria 56876
131 Ga0439463_049774 3300042016 Bacteria 1068
132 Ga0450920_002025 3300042122 Unclassified 3426
133 Ga0450920_029904 3300042122 Unclassified 1070
134 Ga0439458_0005192 3300042157 Bacteria 2933
135 Ga0451577_0285046 3300042876 Bacteria 1497
136 Ga0466972_0013425 3300044658 Bacteria 4113
137 Ga0466963_0004840 3300044694 Bacteria 7846
138 Ga0466963_0013419 3300044694 Bacteria 5031
139 Ga0466963_0112733 3300044694 Bacteria 1867
140 Ga0466963_0323788 3300044694 Bacteria 1085
141 Ga0466957_0062022 3300044842 Bacteria 2296
142 Ga0466958_0015729 3300045836 Bacteria 4343
143 Ga0466958_0059203 3300045836 Bacteria 2330
144 Ga0466967_0035142 3300045976 Bacteria 4262
145 Ga0466967_0097070 3300045976 Bacteria 2689
146 Ga0495603_0144055 3300046455 Bacteria 1386
147 Ga0495629_0158824 3300046459 Bacteria 1570
148 Ga0495638_0040853 3300046460 Bacteria 2937
149 Ga0495580_0163508 3300046472 Bacteria 1540
150 Ga0495585_0014478 3300046492 Bacteria 4595
151 Ga0495594_0028387 3300046499 Bacteria 3019
152 Ga0495657_0237490 3300046675 Bacteria 1101
153 Ga0495683_0000380 3300047323 Bacteria 36306
154 Ga0495687_038906 3300047443 Bacteria 2107
155 Ga0496102_0016477 3300048905 Bacteria 6459
156 Ga0496104_0001600 3300048907 Bacteria 19488
157 Ga0496105_0006669 3300048908 Bacteria 8889
158 Ga0496106_0032602 3300048909 Bacteria 3885
159 Ga0496107_0040882 3300048910 Bacteria 3329
160 Ga0496110_0019589 3300048913 Bacteria 5697
161 Ga0496111_0039413 3300048914 Bacteria 3386
162 Ga0496112_0023177 3300048915 Bacteria 5925
163 Ga0501031_0008277 3300049568 Bacteria 6765
164 Ga0501032_0093933 3300049569 Bacteria 1989
165 Ga0501033_0012987 3300049570 Bacteria 6351
166 Ga0501033_0092493 3300049570 Bacteria 2212
167 Ga0501033_0111572 3300049570 Bacteria 1990
168 Ga0501034_0016791 3300049571 Bacteria 7505
169 Ga0501034_0357511 3300049571 Bacteria 1388
170 Ga0501036_0006578 3300049572 Bacteria 9441
171 Ga0501036_0008972 3300049572 Bacteria 8223
172 Ga0501036_0033518 3300049572 Bacteria 4343
173 Ga0501036_0046934 3300049572 Bacteria 3658
174 Ga0501036_0078828 3300049572 Unclassified 2786
175 Ga0501036_0184883 3300049572 Bacteria 1754
176 Ga0501036_0276433 3300049572 Bacteria 1406
177 Ga0501037_0048606 3300049573 Bacteria 3107
178 Ga0501037_0364406 3300049573 Bacteria 995
179 Ga0501038_0040236 3300049574 Bacteria 4085
180 Ga0501038_0068398 3300049574 Bacteria 3019
181 Ga0501039_0011336 3300049575 Bacteria 6789
182 Ga0501039_0057196 3300049575 Bacteria 3020
183 Ga0501039_0166976 3300049575 Bacteria 1730
184 Ga0501040_0051331 3300049576 Unclassified 2821
185 Ga0501040_0074641 3300049576 Bacteria 2343
186 Ga0501040_0154587 3300049576 Bacteria 1620
187 Ga0501040_0156339 3300049576 Unclassified 1610
188 Ga0501040_0216543 3300049576 Bacteria 1362
189 Ga0501040_0223966 3300049576 Bacteria 1338
190 Ga0501041_0031326 3300049577 Bacteria 3213
191 Ga0501041_0035399 3300049577 Bacteria 3024
192 Ga0501041_0102438 3300049577 Bacteria 1773
193 Ga0501042_0036146 3300049578 Unclassified 3504
194 Ga0501042_0125969 3300049578 Bacteria 1844
195 Ga0501042_0143576 3300049578 Bacteria 1721
196 Ga0501043_0004540 3300049579 Bacteria 11285
197 Ga0501043_0008116 3300049579 Bacteria 8286
198 Ga0501046_0023023 3300049580 Bacteria 5128
199 Ga0501046_0029555 3300049580 Bacteria 4454
200 Ga0501046_0060384 3300049580 Bacteria 2966
201 Ga0501047_0029544 3300049581 Bacteria 5285
202 Ga0501048_0018838 3300049582 Bacteria 5075
203 Ga0501068_0044978 3300049584 Unclassified 2660
204 Ga0501068_0190371 3300049584 Bacteria 1299
205 Ga0501069_0048478 3300049585 Bacteria 2359
206 Ga0501070_0000534 3300049586 Bacteria 34857
207 Ga0501071_0001875 3300049587 Bacteria 12478
208 Ga0501071_0008068 3300049587 Bacteria 6947
209 Ga0501071_0039126 3300049587 Bacteria 3391
210 Ga0501071_0090147 3300049587 Bacteria 2251
211 Ga0501071_0115924 3300049587 Unclassified 1983
212 Ga0501071_0240634 3300049587 Bacteria 1365
213 Ga0501071_0341170 3300049587 Bacteria 1139
214 Ga0501072_0002462 3300049588 Bacteria 13855
215 Ga0501072_0013918 3300049588 Bacteria 6166
216 Ga0501072_0036534 3300049588 Bacteria 3851
217 Ga0501072_0052829 3300049588 Unclassified 3199
218 Ga0501072_0085321 3300049588 Bacteria 2504
219 Ga0501072_0086952 3300049588 Bacteria 2480
220 Ga0501072_0096975 3300049588 Bacteria 2343
221 Ga0501072_0165589 3300049588 Unclassified 1764
222 Ga0501072_0213192 3300049588 Bacteria 1539
223 Ga0501072_0280893 3300049588 Bacteria 1324
224 Ga0501072_0470669 3300049588 Bacteria 995
225 Ga0501073_0018328 3300049589 Bacteria 5059
226 Ga0501073_0208995 3300049589 Bacteria 1349
227 Ga0501074_0000721 3300049590 Bacteria 20738
228 Ga0501074_0020422 3300049590 Bacteria 4814
229 Ga0501074_0036966 3300049590 Unclassified 3539
230 Ga0501074_0094202 3300049590 Bacteria 2145
231 Ga0501074_0125973 3300049590 Bacteria 1832
232 Ga0501074_0245219 3300049590 Bacteria 1274
233 Ga0501075_0011081 3300049591 Bacteria 6365
234 Ga0501075_0012168 3300049591 Bacteria 6109
235 Ga0501075_0022389 3300049591 Bacteria 4615
236 Ga0501075_0053187 3300049591 Unclassified 3045
237 Ga0501075_0148021 3300049591 Bacteria 1790
238 Ga0501076_0008761 3300049592 Bacteria 7433
239 Ga0501076_0026525 3300049592 Bacteria 4489
240 Ga0501076_0068274 3300049592 Bacteria 2839
241 Ga0501076_0123708 3300049592 Bacteria 2095
242 Ga0501076_0167213 3300049592 Bacteria 1792
243 Ga0501076_0427169 3300049592 Bacteria 1090
244 Ga0501077_0025076 3300049593 Bacteria 3787
245 Ga0501079_0003792 3300049741 Bacteria 11162
246 Ga0501079_0015143 3300049741 Bacteria 5881
247 Ga0501079_0030101 3300049741 Bacteria 4171
248 Ga0501079_0163786 3300049741 Unclassified 1734
249 Ga0501080_0007559 3300049742 Bacteria 9823
250 Ga0501081_0010872 3300049743 Bacteria 5949
251 Ga0501081_0054132 3300049743 Bacteria 2772
252 Ga0501081_0229053 3300049743 Unclassified 1353
253 Ga0501081_0252294 3300049743 Bacteria 1288
254 Ga0501081_0338935 3300049743 Bacteria 1107
255 Ga0501083_0013512 3300049744 Bacteria 5708
256 Ga0501035_0002605 3300049822 Bacteria 17611
257 Ga0501035_0015603 3300049822 Bacteria 7010
258 Ga0501035_0036514 3300049822 Bacteria 4453
259 Ga0501035_0412747 3300049822 Bacteria 1122
260 Ga0501044_0166444 3300049823 Bacteria 2179
261 Ga0501044_0652822 3300049823 Bacteria 941
262 Ga0501045_0001578 3300049824 Bacteria 15191
263 Ga0501045_0041248 3300049824 Bacteria 3359
264 Ga0501045_0130488 3300049824 Unclassified 1868
265 Ga0501045_0141746 3300049824 Bacteria 1787
266 Ga0501045_0175107 3300049824 Bacteria 1598
267 nmdc:mga00v17_21912_c1 3300050491 Bacteria 3680
268 nmdc:mga05p37_479376_c1 3300050507 Bacteria 1433
269 nmdc:mga05p37_497545_c1 3300050507 Bacteria 1400
270 nmdc:mga08y16_65489_c1 3300050511 Bacteria 3794
271 nmdc:mga0n895_7702_c1 3300050512 Bacteria 9267
272 nmdc:mga0rr50_9036_c1 3300050513 Bacteria 6236
273 nmdc:mga0a205_24756_c1 3300050515 Bacteria 5711
274 Ga0500566_0132393 3300053094 Bacteria 1332
275 Ga0500660_053031 3300053100 Bacteria 1995
276 Ga0500560_009676 3300053107 Bacteria 2379
277 Ga0500573_0011659 3300053140 Bacteria 4926
278 Ga0501084_0046727 3300054114 Bacteria 3626
279 Ga0501084_0127517 3300054114 Bacteria 2142
280 Ga0501084_0250308 3300054114 Bacteria 1496
281 Ga0501082_0022539 3300060353 Bacteria 5424
282 Ga0501082_0047596 3300060353 Bacteria 3695
283 Ga0501082_0056417 3300060353 Bacteria 3383
284 Ga0501082_0195219 3300060353 Unclassified 1761
285 Ga0501082_0196000 3300060353 Unclassified 1757
286 Ga0466962_0061083 3300061719 Bacteria 1799
287 Ga0530510_0002311 3300061734 Bacteria 13064
288 Ga0530510_0020500 3300061734 Bacteria 4700
289 Ga0530510_0030298 3300061734 Bacteria 3886
290 Ga0530510_0036526 3300061734 Bacteria 3541
291 Ga0530510_0113974 3300061734 Unclassified 1981
292 Ga0530510_0200402 3300061734 Bacteria 1482
293 2548698670 2547132424 Bacteria 8348532
294 2552110322 2551306166 Bacteria 9731570
295 2554256422 2554235005 Bacteria 6457341
296 2644513666 2643221692 Bacteria 7282860
297 2739203900 2738543005 Bacteria 5278128
298 2739366117 2738543034 Bacteria 6084756
299 2744954658 2744054611 Bacteria 5611514
300 2795791461 2795385472 Bacteria 6627535
301 2809586637 2808606522 Bacteria 9488490
302 2812478970 2811994917 Bacteria 7761064
303 2862513273 2862507626 Bacteria 9425308
304 2904767278 2904765812 Bacteria 5369154
305 2904775838 2904770941 Bacteria 5580202
306 2908812658 2908811453 Bacteria 5478616
307 2915772419 2915768154 Bacteria 8424322
308 2919424857 2919420072 Bacteria 5390363
309 2919437423 2919432681 Bacteria 5390474
310 2919719344 2919713450 Bacteria 7431245
311 2925332532 2925326138 Bacteria 9652120
312 2946077533 2946072368 Bacteria 8999607
313 3006493882 3006486233 Bacteria 8157040
314 8055072495 8055066027 Bacteria 9479577
315 Ga0307511_10174960
316 JGI24751J29686_10009996
317 Ga0070658_10090832
318 Ga0070658_10134592
319 Ga0070676_10153926
320 Ga0070690_100173045
321 Ga0070670_100029998
322 Ga0068869_100043006
323 Ga0070666_10006486
324 Ga0070680_100028927
325 Ga0070689_100031952
326 Ga0070691_10002009
327 Ga0070661_100119454
328 Ga0070692_10010613
329 Ga0070675_100014224
330 Ga0070671_100059291
331 Ga0070674_100100800
332 Ga0070673_100120558
333 Ga0070688_100037185
334 Ga0070709_10001759
335 Ga0070714_100019179
336 Ga0070714_100779192
337 Ga0070713_100001846
338 Ga0070713_100174406
339 Ga0070710_10014257
340 Ga0070711_100006170
341 Ga0070700_100032406
342 Ga0070663_100016169
343 Ga0070678_100011669
344 Ga0068867_100240553
345 Ga0070679_100020645
346 Ga0068853_100010607
347 Ga0070672_100056416
348 Ga0070693_100000306
349 Ga0070665_100016151
350 Ga0068855_100209082
351 Ga0068854_100074543
352 Ga0068856_100359995
353 Ga0070702_100000311
354 Ga0068859_100024488
355 Ga0068864_100025108
356 Ga0068851_10008118
357 Ga0068870_10001346
358 Ga0068863_100011457
359 Ga0068863_100015174
360 Ga0068858_100032051
361 Ga0068858_100056729
362 Ga0068860_100000067
363 Ga0068860_100386123
364 Ga0068862_100172394
365 Ga0070717_10276950
366 Ga0075364_10056190
367 Ga0075432_10005820
368 Ga0068871_100006255
369 Ga0075434_100023217
370 Ga0075436_100009879
371 Ga0097620_100024488
372 Ga0105251_10014379
373 Ga0105240_10209608
374 Ga0111539_10058807
375 Ga0105245_10178530
376 Ga0114129_10187434
377 Ga0114129_10191245
378 Ga0105241_10005599
379 Ga0105248_10034030
380 Ga0105237_10083699
381 Ga0105238_10221229
382 Ga0105239_10070562
383 Ga0105246_10000477
384 Ga0157370_10023768
385 Ga0157374_10018491
386 Ga0157372_10057432
387 Ga0157375_10021330
388 Ga0163163_10159639
389 Ga0157380_10498377
390 Ga0182008_10025809
391 Ga0157377_10001745
392 Ga0157379_10128626
393 Ga0157376_10049847
394 Ga0206356_11910987
395 Ga0207656_10067292
396 Ga0207688_10007494
397 Ga0207680_10001372
398 Ga0207647_10101642
399 Ga0207699_10279156
400 Ga0207645_10045100
401 Ga0207643_10001271
402 Ga0207705_10016870
403 Ga0207654_10002878
404 Ga0207693_10033114
405 Ga0207660_10010014
406 Ga0207657_10010401
407 Ga0207649_10059750
408 Ga0207652_10016757
409 Ga0207694_10038921
410 Ga0207650_10004601
411 Ga0207687_10015358
412 Ga0207700_10009272
413 Ga0207700_10203418
414 Ga0207664_10633532
415 Ga0207706_10067058
416 Ga0207670_10025103
417 Ga0207691_10120767
418 Ga0207689_10002005
419 Ga0207661_10002435
420 Ga0207679_10008102
421 Ga0207651_10035272
422 Ga0207640_10019743
423 Ga0207677_10150596
424 Ga0207703_10083410
425 Ga0207703_10084299
426 Ga0207678_10000891
427 Ga0207708_10057141
428 Ga0207702_10000901
429 Ga0207702_10097213
430 Ga0207641_10008654
431 Ga0207641_10020400
432 Ga0207648_10137873
433 Ga0207676_10000683
434 Ga0207675_100141802
435 Ga0207683_10001117
436 Ga0268266_10009773
437 Ga0268266_10023217
438 Ga0268265_10155231
439 Ga0268264_10000114
440 Ga0268264_10055990
441 Ga0307517_10023238
442 Ga0307511_10001322
443 Ga0307509_10101100
444 Ga0307518_10000112
445 Ga0439463_049774
446 Ga0450920_002025
447 Ga0450920_029904
448 Ga0439458_0005192
449 Ga0451577_0285046
450 Ga0466972_0013425
451 Ga0466963_0004840
452 Ga0466963_0013419
453 Ga0466963_0112733
454 Ga0466963_0323788
455 Ga0466957_0062022
456 Ga0466958_0015729
457 Ga0466958_0059203
458 Ga0466967_0035142
459 Ga0466967_0097070
460 Ga0495603_0144055
461 Ga0495629_0158824
462 Ga0495638_0040853
463 Ga0495580_0163508
464 Ga0495585_0014478
465 Ga0495594_0028387
466 Ga0495657_0237490
467 Ga0495683_0000380
468 Ga0495687_038906
469 Ga0496102_0016477
470 Ga0496104_0001600
471 Ga0496105_0006669
472 Ga0496106_0032602
473 Ga0496107_0040882
474 Ga0496110_0019589
475 Ga0496111_0039413
476 Ga0496112_0023177
477 Ga0501031_0008277
478 Ga0501032_0093933
479 Ga0501033_0012987
480 Ga0501033_0092493
481 Ga0501033_0111572
482 Ga0501034_0016791
483 Ga0501034_0357511
484 Ga0501036_0006578
485 Ga0501036_0008972
486 Ga0501036_0033518
487 Ga0501036_0046934
488 Ga0501036_0078828
489 Ga0501036_0184883
490 Ga0501036_0276433
491 Ga0501037_0048606
492 Ga0501037_0364406
493 Ga0501038_0040236
494 Ga0501038_0068398
495 Ga0501039_0011336
496 Ga0501039_0057196
497 Ga0501039_0166976
498 Ga0501040_0051331
499 Ga0501040_0074641
500 Ga0501040_0154587
501 Ga0501040_0156339
502 Ga0501040_0216543
503 Ga0501040_0223966
504 Ga0501041_0031326
505 Ga0501041_0035399
506 Ga0501041_0102438
507 Ga0501042_0036146
508 Ga0501042_0125969
509 Ga0501042_0143576
510 Ga0501043_0004540
511 Ga0501043_0008116
512 Ga0501046_0023023
513 Ga0501046_0029555
514 Ga0501046_0060384
515 Ga0501047_0029544
516 Ga0501048_0018838
517 Ga0501068_0044978
518 Ga0501068_0190371
519 Ga0501069_0048478
520 Ga0501070_0000534
521 Ga0501071_0001875
522 Ga0501071_0008068
523 Ga0501071_0039126
524 Ga0501071_0090147
525 Ga0501071_0115924
526 Ga0501071_0240634
527 Ga0501071_0341170
528 Ga0501072_0002462
529 Ga0501072_0013918
530 Ga0501072_0036534
531 Ga0501072_0052829
532 Ga0501072_0085321
533 Ga0501072_0086952
534 Ga0501072_0096975
535 Ga0501072_0165589
536 Ga0501072_0213192
537 Ga0501072_0280893
538 Ga0501072_0470669
539 Ga0501073_0018328
540 Ga0501073_0208995
541 Ga0501074_0000721
542 Ga0501074_0020422
543 Ga0501074_0036966
544 Ga0501074_0094202
545 Ga0501074_0125973
546 Ga0501074_0245219
547 Ga0501075_0011081
548 Ga0501075_0012168
549 Ga0501075_0022389
550 Ga0501075_0053187
551 Ga0501075_0148021
552 Ga0501076_0008761
553 Ga0501076_0026525
554 Ga0501076_0068274
555 Ga0501076_0123708
556 Ga0501076_0167213
557 Ga0501076_0427169
558 Ga0501077_0025076
559 Ga0501079_0003792
560 Ga0501079_0015143
561 Ga0501079_0030101
562 Ga0501079_0163786
563 Ga0501080_0007559
564 Ga0501081_0010872
565 Ga0501081_0054132
566 Ga0501081_0229053
567 Ga0501081_0252294
568 Ga0501081_0338935
569 Ga0501083_0013512
570 Ga0501035_0002605
571 Ga0501035_0015603
572 Ga0501035_0036514
573 Ga0501035_0412747
574 Ga0501044_0166444
575 Ga0501044_0652822
576 Ga0501045_0001578
577 Ga0501045_0041248
578 Ga0501045_0130488
579 Ga0501045_0141746
580 Ga0501045_0175107
581 nmdc:mga00v17_21912_c1
582 nmdc:mga05p37_479376_c1
583 nmdc:mga05p37_497545_c1
584 nmdc:mga08y16_65489_c1
585 nmdc:mga0n895_7702_c1
586 nmdc:mga0rr50_9036_c1
587 nmdc:mga0a205_24756_c1
588 Ga0500566_0132393
589 Ga0500660_053031
590 Ga0500560_009676
591 Ga0500573_0011659
592 Ga0501084_0046727
593 Ga0501084_0127517
594 Ga0501084_0250308
595 Ga0501082_0022539
596 Ga0501082_0047596
597 Ga0501082_0056417
598 Ga0501082_0195219
599 Ga0501082_0196000
600 Ga0466962_0061083
601 Ga0530510_0002311
602 Ga0530510_0020500
603 Ga0530510_0030298
604 Ga0530510_0036526
605 Ga0530510_0113974
606 Ga0530510_0200402
607 2548698670
608 2552110322
609 2554256422
610 2644513666
611 2739203900
612 2739366117
613 2744954658
614 2795791461
615 2809586637
616 2812478970
617 2862513273
618 2904767278
619 2904775838
620 2908812658
621 2915772419
622 2919424857
623 2919437423
624 2919719344
625 2925332532
626 2946077533
627 3006493882
628 8055072495

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02811

PHP

PHP domain

27

125

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e0f-assembly1.cif.gz_A crystal structure of a putative metal-dependent phosphoesterase (bad_1165) from bifidobacterium adolescentis atcc 15703 at 2.40 a resolution 0.9119 3 279
7ug9-assembly1.cif.gz_A crystal structure of rnase am php domain 0.8512 3 268
2yb4-assembly1.cif.gz_A structure of an amidohydrolase from chromobacterium violaceum (efi target efi-500202) with bound so4, no metal 0.8223 1 285
2yb4-assembly1.cif.gz_A structure of an amidohydrolase from chromobacterium violaceum (efi target efi-500202) with bound so4, no metal 0.8037 1 285
7ug9-assembly1.cif.gz_A crystal structure of rnase am php domain 0.8004 3 268
ID Description Score Start End Superfamily
3e0fA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9074 3 279 3.20.20.140
3o0fA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.8783 102 171 1.10.150.650
3e0fA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8571 3 279 3.20.20.140
3o0fA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.8342 102 171 1.10.150.650
2yb4A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8243 1 285 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A6J7FXN0-F1-model_v4 Unannotated protein 0.9836 190 286
AF-A0A132NG65-F1-model_v4 Phosphoesterase 0.9747 163 286 GO:0004534
GO:0035312
AF-A0A7W9IJC3-F1-model_v4 Putative metal-dependent phosphoesterase TrpH 0.9646 1 286 GO:0004534
GO:0035312
AF-A0A4Q7L5X6-F1-model_v4 Polymerase/histidinol phosphatase N-terminal domain-containing protein 0.9639 1 286 GO:0004534
GO:0035312
AF-A0A0D8HV19-F1-model_v4 PHP domain-containing protein 0.9627 23 286 GO:0004534
GO:0035312

Map