F402726

General Info

Members Datasets Scaffolds Average Seq Length
314 188 628 254

Family's Representative Sequence

Representative Sequence 3300025937|Ga0207669_10267484|Ga0207669_102674842
Length 292
Sequence MTGMRGADGSTKPARSLRRYGGVTVTTAVHEHGRYNRALMDPWRTAIATADATNIWIRGHEITSLMRERTFTDAIVLLHLGRIPTPGERKLLDAILIGVCDHGAGAPSCAAARIAASGNRQALSAAVAAGVLTIGDEHGGAGSNCMEMIAAGLAAGTRDGLAADAAARRVVEEAVAAKRRLPGLGHRVHTTDPRVAALFEMARAEGLAGDGIRFMTALEAEAARRIKPLPMNIDGALAAVLHDMGFTPPAGRFIFIVGRVAGLTAEVAEELTRERPMRIKFDVEYDGPPPTE

Samples

Sample ID Description Type Environment
1 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
123 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
124 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
125 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
128 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
129 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
130 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
131 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
132 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
133 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
134 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
135 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
179 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
180 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 0
Rhizoplane 3.18
Rhizosphere 92.68
Stem 0
Stem Tuber 0
Unclassified 21.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207669_10267484 3300025937 Unclassified 1282
2 Ga0065715_10017482 3300005293 Bacteria 2127
3 Ga0065707_10110235 3300005295 Unclassified 2438
4 Ga0070676_10108882 3300005328 Bacteria 1722
5 Ga0070683_100304222 3300005329 Bacteria 1517
6 Ga0070690_100006472 3300005330 Bacteria 6641
7 Ga0070670_100017529 3300005331 Bacteria 6144
8 Ga0070670_100020586 3300005331 Bacteria 5674
9 Ga0070677_10067534 3300005333 Bacteria 1494
10 Ga0070666_10064057 3300005335 Bacteria 2492
11 Ga0070682_100122653 3300005337 Bacteria 1747
12 Ga0070689_100164484 3300005340 Bacteria 1795
13 Ga0070689_100177835 3300005340 Bacteria 1727
14 Ga0070689_100206141 3300005340 Bacteria 1607
15 Ga0070691_10064400 3300005341 Unclassified 1769
16 Ga0070687_100039886 3300005343 Unclassified 2363
17 Ga0070661_100137618 3300005344 Unclassified 1838
18 Ga0070661_100336039 3300005344 Bacteria 1182
19 Ga0070692_10087885 3300005345 Unclassified 1685
20 Ga0070668_100201427 3300005347 Unclassified 1634
21 Ga0070668_100226914 3300005347 Bacteria 1543
22 Ga0070669_100003700 3300005353 Bacteria 11034
23 Ga0070669_100080143 3300005353 Bacteria 2429
24 Ga0070669_100106021 3300005353 Unclassified 2127
25 Ga0070669_100288027 3300005353 Bacteria 1318
26 Ga0070675_100098971 3300005354 Bacteria 2454
27 Ga0070675_100488605 3300005354 Bacteria 1108
28 Ga0070671_100010304 3300005355 Bacteria 7500
29 Ga0070671_100132209 3300005355 Bacteria 2102
30 Ga0070674_100150718 3300005356 Unclassified 1755
31 Ga0070674_100226272 3300005356 Bacteria 1458
32 Ga0070673_100071836 3300005364 Bacteria 2782
33 Ga0070688_100025094 3300005365 Bacteria 3526
34 Ga0070688_100108272 3300005365 Bacteria 1844
35 Ga0070688_100220444 3300005365 Bacteria 1336
36 Ga0070659_100082986 3300005366 Bacteria 2561
37 Ga0070667_100037656 3300005367 Bacteria 4055
38 Ga0070713_100011040 3300005436 Bacteria 6558
39 Ga0070701_10044034 3300005438 Bacteria 2286
40 Ga0070705_100080972 3300005440 Unclassified 1994
41 Ga0070700_100014061 3300005441 Bacteria 4512
42 Ga0070694_100003989 3300005444 Bacteria 8832
43 Ga0070694_100359700 3300005444 Unclassified 1130
44 Ga0070663_100177055 3300005455 Bacteria 1652
45 Ga0070678_100024804 3300005456 Bacteria 4021
46 Ga0070662_100043105 3300005457 Bacteria 3227
47 Ga0068867_100002242 3300005459 Bacteria 13587
48 Ga0068867_100189439 3300005459 Bacteria 1640
49 Ga0070685_10133201 3300005466 Bacteria 1556
50 Ga0070684_100198605 3300005535 Bacteria 1826
51 Ga0070684_100517355 3300005535 Bacteria 1106
52 Ga0070672_100026685 3300005543 Bacteria 4302
53 Ga0070672_100140624 3300005543 Unclassified 1991
54 Ga0070686_100072053 3300005544 Bacteria 2264
55 Ga0070686_100074204 3300005544 Bacteria 2235
56 Ga0070696_100110150 3300005546 Unclassified 1982
57 Ga0070696_100159684 3300005546 Unclassified 1660
58 Ga0070693_100025251 3300005547 Bacteria 3196
59 Ga0070665_100169731 3300005548 Unclassified 2183
60 Ga0070704_100081430 3300005549 Bacteria 2384
61 Ga0070664_100030337 3300005564 Bacteria 4511
62 Ga0070664_100243797 3300005564 Bacteria 1614
63 Ga0068857_100042344 3300005577 Unclassified 4039
64 Ga0068857_100506916 3300005577 Bacteria 1133
65 Ga0068854_100017632 3300005578 Bacteria 4780
66 Ga0070702_100027368 3300005615 Bacteria 3075
67 Ga0070702_100236955 3300005615 Bacteria 1229
68 Ga0068852_100048446 3300005616 Unclassified 3631
69 Ga0068852_100421918 3300005616 Unclassified 1316
70 Ga0068859_100232267 3300005617 Unclassified 1933
71 Ga0068864_100724323 3300005618 Unclassified 973
72 Ga0068866_10088377 3300005718 Bacteria 1682
73 Ga0068861_100185152 3300005719 Bacteria 1736
74 Ga0068870_10058259 3300005840 Bacteria 2068
75 Ga0068870_10131306 3300005840 Bacteria 1455
76 Ga0068863_100176475 3300005841 Unclassified 2051
77 Ga0068858_100056456 3300005842 Bacteria 3629
78 Ga0068858_100072779 3300005842 Bacteria 3189
79 Ga0068858_100148490 3300005842 Bacteria 2203
80 Ga0068858_100555390 3300005842 Unclassified 1112
81 Ga0068860_100059732 3300005843 Bacteria 3624
82 Ga0068862_100003708 3300005844 Bacteria 13056
83 Ga0068862_100486361 3300005844 Unclassified 1169
84 Ga0068862_100521874 3300005844 Bacteria 1130
85 Ga0081539_10118503 3300005985 Bacteria 1319
86 Ga0075368_10021040 3300006042 Bacteria 2475
87 Ga0075363_100155350 3300006048 Bacteria 1293
88 Ga0068871_100003699 3300006358 Bacteria 10515
89 Ga0068871_100160247 3300006358 Bacteria 1924
90 Ga0075428_100375146 3300006844 Bacteria 1525
91 Ga0075430_100100280 3300006846 Bacteria 2419
92 Ga0075433_10000570 3300006852 Bacteria 24365
93 Ga0075433_10051615 3300006852 Bacteria 3582
94 Ga0075433_10106448 3300006852 Bacteria 2486
95 Ga0075434_100006701 3300006871 Bacteria 10581
96 Ga0075434_100063444 3300006871 Bacteria 3677
97 Ga0075434_100199206 3300006871 Bacteria 2022
98 Ga0068865_100009232 3300006881 Bacteria 6107
99 Ga0068865_100133938 3300006881 Unclassified 1859
100 Ga0068865_100171215 3300006881 Bacteria 1665
101 Ga0075436_100000666 3300006914 Bacteria 22605
102 Ga0075436_100010834 3300006914 Bacteria 6254
103 Ga0075436_100240668 3300006914 Bacteria 1287
104 Ga0097620_100232260 3300006931 Unclassified 1933
105 Ga0075435_100000450 3300007076 Bacteria 25173
106 Ga0075435_100015088 3300007076 Bacteria 5800
107 Ga0111539_10000413 3300009094 Bacteria 53529
108 Ga0111539_10000767 3300009094 Bacteria 41841
109 Ga0111539_10009146 3300009094 Bacteria 12528
110 Ga0111539_10256733 3300009094 Unclassified 2035
111 Ga0105245_10048606 3300009098 Bacteria 3795
112 Ga0105245_10067171 3300009098 Bacteria 3247
113 Ga0105245_10183119 3300009098 Bacteria 2002
114 Ga0105245_10254375 3300009098 Bacteria 1708
115 Ga0105245_11098438 3300009098 Bacteria 842
116 Ga0114129_10002517 3300009147 Bacteria 25438
117 Ga0114129_10064295 3300009147 Bacteria 5119
118 Ga0114129_10085199 3300009147 Bacteria 4384
119 Ga0114129_10302551 3300009147 Bacteria 2131
120 Ga0114129_10846041 3300009147 Bacteria 1163
121 Ga0105243_10030626 3300009148 Bacteria 4144
122 Ga0105242_10081671 3300009176 Bacteria 2703
123 Ga0105242_10137243 3300009176 Unclassified 2118
124 Ga0105242_10169567 3300009176 Unclassified 1917
125 Ga0105248_10003843 3300009177 Bacteria 16638
126 Ga0105248_10052757 3300009177 Bacteria 4563
127 Ga0105248_10155075 3300009177 Bacteria 2584
128 Ga0105248_10789261 3300009177 Bacteria 1072
129 Ga0105249_10002082 3300009553 Bacteria 17350
130 Ga0105249_10015897 3300009553 Bacteria 6669
131 Ga0105249_10170086 3300009553 Unclassified 2112
132 Ga0105249_10222704 3300009553 Bacteria 1857
133 Ga0105249_10327544 3300009553 Bacteria 1545
134 Ga0157378_10074303 3300013297 Bacteria 3058
135 Ga0157378_10123865 3300013297 Bacteria 2386
136 Ga0157378_10723119 3300013297 Unclassified 1016
137 Ga0163162_10063929 3300013306 Bacteria 3724
138 Ga0163162_10192946 3300013306 Bacteria 2165
139 Ga0163163_11055637 3300014325 Bacteria 876
140 Ga0157380_10058422 3300014326 Bacteria 3075
141 Ga0157380_10113666 3300014326 Bacteria 2280
142 Ga0157380_10353935 3300014326 Archaea 1375
143 Ga0157377_10022176 3300014745 Unclassified 3349
144 Ga0157377_10176805 3300014745 Bacteria 1339
145 Ga0157379_10240741 3300014968 Unclassified 1641
146 Ga0157379_10313628 3300014968 Bacteria 1431
147 Ga0157376_10265465 3300014969 Bacteria 1610
148 Ga0213876_10027607 3300021384 Bacteria 2995
149 Ga0213875_10152184 3300021388 Bacteria 1084
150 Ga0207682_10062365 3300025893 Bacteria 1563
151 Ga0207688_10003360 3300025901 Bacteria 8737
152 Ga0207688_10111422 3300025901 Unclassified 1589
153 Ga0207685_10047589 3300025905 Unclassified 1638
154 Ga0207645_10060861 3300025907 Bacteria 2411
155 Ga0207643_10007350 3300025908 Bacteria 5910
156 Ga0207643_10087770 3300025908 Unclassified 1809
157 Ga0207662_10000398 3300025918 Bacteria 19335
158 Ga0207662_10010939 3300025918 Bacteria 5019
159 Ga0207657_10499231 3300025919 Unclassified 953
160 Ga0207649_10343201 3300025920 Bacteria 1103
161 Ga0207652_10130933 3300025921 Bacteria 2237
162 Ga0207681_10026672 3300025923 Bacteria 3729
163 Ga0207681_10031344 3300025923 Bacteria 3471
164 Ga0207681_10211481 3300025923 Unclassified 1495
165 Ga0207681_10417265 3300025923 Bacteria 1087
166 Ga0207650_10012663 3300025925 Bacteria 5822
167 Ga0207659_10008725 3300025926 Bacteria 6309
168 Ga0207687_10033560 3300025927 Bacteria 3482
169 Ga0207687_10038546 3300025927 Bacteria 3266
170 Ga0207687_10136300 3300025927 Bacteria 1857
171 Ga0207687_10221231 3300025927 Bacteria 1491
172 Ga0207700_10198853 3300025928 Bacteria 1688
173 Ga0207700_10703570 3300025928 Bacteria 902
174 Ga0207644_10074970 3300025931 Bacteria 2485
175 Ga0207644_10320803 3300025931 Unclassified 1252
176 Ga0207690_10209641 3300025932 Bacteria 1485
177 Ga0207690_10277190 3300025932 Unclassified 1305
178 Ga0207706_10041340 3300025933 Bacteria 4087
179 Ga0207686_10082602 3300025934 Unclassified 2101
180 Ga0207709_10018901 3300025935 Bacteria 3866
181 Ga0207670_10009373 3300025936 Bacteria 5586
182 Ga0207670_10058071 3300025936 Bacteria 2627
183 Ga0207669_10006390 3300025937 Bacteria 5382
184 Ga0207669_10013464 3300025937 Bacteria 4064
185 Ga0207704_10115654 3300025938 Unclassified 1823
186 Ga0207704_10254453 3300025938 Bacteria 1320
187 Ga0207691_10041345 3300025940 Bacteria 4256
188 Ga0207711_10011857 3300025941 Bacteria 7244
189 Ga0207711_10233924 3300025941 Bacteria 1683
190 Ga0207679_10210266 3300025945 Bacteria 1631
191 Ga0207679_10370930 3300025945 Bacteria 1253
192 Ga0207679_10484542 3300025945 Bacteria 1101
193 Ga0207651_10112587 3300025960 Bacteria 2046
194 Ga0207712_10006592 3300025961 Bacteria 7324
195 Ga0207712_10021590 3300025961 Bacteria 4227
196 Ga0207712_10082229 3300025961 Bacteria 2347
197 Ga0207712_10117426 3300025961 Bacteria 2006
198 Ga0207712_10228519 3300025961 Bacteria 1492
199 Ga0207712_10408960 3300025961 Archaea 1142
200 Ga0207668_10060495 3300025972 Bacteria 2659
201 Ga0207677_10184738 3300026023 Bacteria 1643
202 Ga0207677_10487368 3300026023 Bacteria 1063
203 Ga0207677_10609239 3300026023 Bacteria 959
204 Ga0207708_10044161 3300026075 Bacteria 3395
205 Ga0207641_10162695 3300026088 Unclassified 2030
206 Ga0207648_10004385 3300026089 Bacteria 14510
207 Ga0207648_10018128 3300026089 Bacteria 6377
208 Ga0207674_10006340 3300026116 Bacteria 13926
209 Ga0207674_10107225 3300026116 Bacteria 2770
210 Ga0207674_10223269 3300026116 Unclassified 1832
211 Ga0207675_100044160 3300026118 Bacteria 4163
212 Ga0207675_100145413 3300026118 Bacteria 2254
213 Ga0207683_10022082 3300026121 Bacteria 5461
214 Ga0207683_10022667 3300026121 Bacteria 5392
215 Ga0207428_10000139 3300027907 Bacteria 98277
216 Ga0207428_10000765 3300027907 Bacteria 36585
217 Ga0207428_10023986 3300027907 Bacteria 5123
218 Ga0268265_10134111 3300028380 Unclassified 2063
219 Ga0268265_10232440 3300028380 Unclassified 1621
220 Ga0268265_10486987 3300028380 Bacteria 1160
221 Ga0268264_10433833 3300028381 Unclassified 1269
222 Ga0307405_10372430 3300031731 Bacteria 1109
223 Ga0373950_0006437 3300034818 Bacteria 1791
224 Ga0373958_0000853 3300034819 Bacteria 3920
225 Ga0373938_0001973 3300034957 Bacteria 3290
226 Ga0373929_0000355 3300035085 Bacteria 8545
227 Ga0373934_0030923 3300035086 Unclassified 2095
228 Ga0373940_0003208 3300035088 Bacteria 3306
229 Ga0373949_0001583 3300035090 Bacteria 6414
230 Ga0373951_0001536 3300035091 Bacteria 6037
231 Ga0373952_0000209 3300035092 Bacteria 9263
232 Ga0373932_0000857 3300035112 Bacteria 8980
233 Ga0373939_0000198 3300035114 Bacteria 16611
234 Ga0373941_0008017 3300035115 Bacteria 2608
235 Ga0373956_0052074 3300035119 Unclassified 1841
236 Ga0373960_0000078 3300035121 Bacteria 14239
237 Ga0373943_0024410 3300035170 Unclassified 2818
238 Ga0373955_0032814 3300035172 Bacteria 2730
239 Ga0373942_0001202 3300035207 Bacteria 6827
240 Ga0373961_0005970 3300035241 Bacteria 2926
241 Ga0373962_0002112 3300035242 Bacteria 4748
242 Ga0373931_0001096 3300035691 Bacteria 11492
243 Ga0373935_0219468 3300035692 Bacteria 1320
244 Ga0373935_0432768 3300035692 Bacteria 948
245 Ga0373947_0006301 3300035725 Bacteria 6896
246 Ga0373937_0028158 3300036401 Bacteria 5083
247 Ga0373925_0010081 3300037068 Bacteria 6864
248 Ga0436364_0325681 3300037853 Bacteria 3655
249 Ga0436364_0587501 3300037853 Unclassified 998
250 Ga0436364_0767943 3300037853 Unclassified 1269
251 Ga0436364_0922888 3300037853 Unclassified 859
252 Ga0436365_1489555 3300039437 Unclassified 1496
253 Ga0451577_0050454 3300042876 Bacteria 3714
254 Ga0453684_0187054 3300044712 Unclassified 2426
255 Ga0451576_0014251 3300045051 Bacteria 8857
256 Ga0451576_0337776 3300045051 Bacteria 1577
257 Ga0495592_0119605 3300046454 Unclassified 1855
258 Ga0495603_0186307 3300046455 Bacteria 1200
259 Ga0495653_0345948 3300046463 Bacteria 957
260 Ga0495580_0223756 3300046472 Bacteria 1293
261 Ga0495594_0096864 3300046499 Unclassified 1658
262 Ga0495594_0226360 3300046499 Unclassified 1066
263 Ga0495628_0123637 3300046516 Unclassified 1983
264 Ga0495587_0138432 3300046536 Bacteria 1390
265 Ga0495667_0244356 3300046559 Unclassified 1143
266 Ga0495635_0075941 3300046663 Bacteria 2302
267 Ga0495599_0088017 3300046678 Unclassified 1939
268 Ga0495599_0253387 3300046678 Bacteria 1071
269 Ga0495658_0023077 3300046683 Bacteria 3300
270 Ga0495613_0311005 3300046689 Unclassified 1089
271 Ga0495675_0153345 3300047444 Bacteria 1422
272 Ga0495684_0002689 3300047471 Bacteria 14073
273 Ga0495686_0134797 3300047472 Bacteria 1461
274 Ga0496103_0413732 3300048906 Unclassified 866
275 Ga0496104_0596045 3300048907 Unclassified 1015
276 Ga0496106_0102726 3300048909 Unclassified 2218
277 Ga0496106_0185578 3300048909 Unclassified 1652
278 Ga0496107_0481499 3300048910 Bacteria 921
279 Ga0496109_0046956 3300048912 Bacteria 3924
280 Ga0496110_0038225 3300048913 Bacteria 4175
281 Ga0496112_0018101 3300048915 Bacteria 6629
282 Ga0496113_0040400 3300048916 Bacteria 3438
283 Ga0496114_0708476 3300048917 Bacteria 882
284 Ga0501073_0037816 3300049589 Bacteria 3426
285 Ga0501077_0111843 3300049593 Bacteria 1731
286 Ga0501080_0176829 3300049742 Bacteria 1966
287 nmdc:mga03683_27058_c1 3300050489 Bacteria 2268
288 nmdc:mga03n38_174038_c1 3300050490 Unclassified 1098
289 nmdc:mga04h51_112132_c1 3300050495 Unclassified 1007
290 nmdc:mga05p37_109749_c1 3300050507 Bacteria 3394
291 nmdc:mga05p37_134926_c1 3300050507 Bacteria 3028
292 nmdc:mga05p37_15679_c1 3300050507 Bacteria 9110
293 nmdc:mga05p37_437793_c1 3300050507 Bacteria 1517
294 nmdc:mga05p37_711270_c1 3300050507 Bacteria 1114
295 nmdc:mga0qj67_102748_c1 3300050509 Bacteria 2305
296 nmdc:mga0qj67_282190_c1 3300050509 Unclassified 1346
297 nmdc:mga08y16_11001_c1 3300050511 Bacteria 9500
298 nmdc:mga08y16_251765_c1 3300050511 Viruses 1825
299 nmdc:mga08y16_2997_c1 3300050511 Bacteria 17422
300 nmdc:mga08y16_563_c1 3300050511 Bacteria 34402
301 nmdc:mga08y16_61651_c1 3300050511 Bacteria 3916
302 nmdc:mga08y16_99706_c1 3300050511 Bacteria 3024
303 nmdc:mga0n895_207985_c1 3300050512 Bacteria 1987
304 nmdc:mga0n895_383967_c1 3300050512 Bacteria 1421
305 nmdc:mga0n895_47420_c1 3300050512 Bacteria 4201
306 nmdc:mga0n895_798_c1 3300050512 Bacteria 22501
307 nmdc:mga0rr50_16252_c1 3300050513 Bacteria 4937
308 nmdc:mga0rr50_201_c1 3300050513 Bacteria 32622
309 nmdc:mga08x19_2093_c1 3300050514 Bacteria 12201
310 nmdc:mga08x19_213519_c1 3300050514 Bacteria 1325
311 nmdc:mga08x19_36505_c1 3300050514 Bacteria 3113
312 nmdc:mga0a205_31982_c1 3300050515 Bacteria 5044
313 nmdc:mga0a205_98543_c1 3300050515 Bacteria 2822
314 Ga0500645_007815 3300053730 Unclassified 3697
315 Ga0207669_10267484
316 Ga0065715_10017482
317 Ga0065707_10110235
318 Ga0070676_10108882
319 Ga0070683_100304222
320 Ga0070690_100006472
321 Ga0070670_100017529
322 Ga0070670_100020586
323 Ga0070677_10067534
324 Ga0070666_10064057
325 Ga0070682_100122653
326 Ga0070689_100164484
327 Ga0070689_100177835
328 Ga0070689_100206141
329 Ga0070691_10064400
330 Ga0070687_100039886
331 Ga0070661_100137618
332 Ga0070661_100336039
333 Ga0070692_10087885
334 Ga0070668_100201427
335 Ga0070668_100226914
336 Ga0070669_100003700
337 Ga0070669_100080143
338 Ga0070669_100106021
339 Ga0070669_100288027
340 Ga0070675_100098971
341 Ga0070675_100488605
342 Ga0070671_100010304
343 Ga0070671_100132209
344 Ga0070674_100150718
345 Ga0070674_100226272
346 Ga0070673_100071836
347 Ga0070688_100025094
348 Ga0070688_100108272
349 Ga0070688_100220444
350 Ga0070659_100082986
351 Ga0070667_100037656
352 Ga0070713_100011040
353 Ga0070701_10044034
354 Ga0070705_100080972
355 Ga0070700_100014061
356 Ga0070694_100003989
357 Ga0070694_100359700
358 Ga0070663_100177055
359 Ga0070678_100024804
360 Ga0070662_100043105
361 Ga0068867_100002242
362 Ga0068867_100189439
363 Ga0070685_10133201
364 Ga0070684_100198605
365 Ga0070684_100517355
366 Ga0070672_100026685
367 Ga0070672_100140624
368 Ga0070686_100072053
369 Ga0070686_100074204
370 Ga0070696_100110150
371 Ga0070696_100159684
372 Ga0070693_100025251
373 Ga0070665_100169731
374 Ga0070704_100081430
375 Ga0070664_100030337
376 Ga0070664_100243797
377 Ga0068857_100042344
378 Ga0068857_100506916
379 Ga0068854_100017632
380 Ga0070702_100027368
381 Ga0070702_100236955
382 Ga0068852_100048446
383 Ga0068852_100421918
384 Ga0068859_100232267
385 Ga0068864_100724323
386 Ga0068866_10088377
387 Ga0068861_100185152
388 Ga0068870_10058259
389 Ga0068870_10131306
390 Ga0068863_100176475
391 Ga0068858_100056456
392 Ga0068858_100072779
393 Ga0068858_100148490
394 Ga0068858_100555390
395 Ga0068860_100059732
396 Ga0068862_100003708
397 Ga0068862_100486361
398 Ga0068862_100521874
399 Ga0081539_10118503
400 Ga0075368_10021040
401 Ga0075363_100155350
402 Ga0068871_100003699
403 Ga0068871_100160247
404 Ga0075428_100375146
405 Ga0075430_100100280
406 Ga0075433_10000570
407 Ga0075433_10051615
408 Ga0075433_10106448
409 Ga0075434_100006701
410 Ga0075434_100063444
411 Ga0075434_100199206
412 Ga0068865_100009232
413 Ga0068865_100133938
414 Ga0068865_100171215
415 Ga0075436_100000666
416 Ga0075436_100010834
417 Ga0075436_100240668
418 Ga0097620_100232260
419 Ga0075435_100000450
420 Ga0075435_100015088
421 Ga0111539_10000413
422 Ga0111539_10000767
423 Ga0111539_10009146
424 Ga0111539_10256733
425 Ga0105245_10048606
426 Ga0105245_10067171
427 Ga0105245_10183119
428 Ga0105245_10254375
429 Ga0105245_11098438
430 Ga0114129_10002517
431 Ga0114129_10064295
432 Ga0114129_10085199
433 Ga0114129_10302551
434 Ga0114129_10846041
435 Ga0105243_10030626
436 Ga0105242_10081671
437 Ga0105242_10137243
438 Ga0105242_10169567
439 Ga0105248_10003843
440 Ga0105248_10052757
441 Ga0105248_10155075
442 Ga0105248_10789261
443 Ga0105249_10002082
444 Ga0105249_10015897
445 Ga0105249_10170086
446 Ga0105249_10222704
447 Ga0105249_10327544
448 Ga0157378_10074303
449 Ga0157378_10123865
450 Ga0157378_10723119
451 Ga0163162_10063929
452 Ga0163162_10192946
453 Ga0163163_11055637
454 Ga0157380_10058422
455 Ga0157380_10113666
456 Ga0157380_10353935
457 Ga0157377_10022176
458 Ga0157377_10176805
459 Ga0157379_10240741
460 Ga0157379_10313628
461 Ga0157376_10265465
462 Ga0213876_10027607
463 Ga0213875_10152184
464 Ga0207682_10062365
465 Ga0207688_10003360
466 Ga0207688_10111422
467 Ga0207685_10047589
468 Ga0207645_10060861
469 Ga0207643_10007350
470 Ga0207643_10087770
471 Ga0207662_10000398
472 Ga0207662_10010939
473 Ga0207657_10499231
474 Ga0207649_10343201
475 Ga0207652_10130933
476 Ga0207681_10026672
477 Ga0207681_10031344
478 Ga0207681_10211481
479 Ga0207681_10417265
480 Ga0207650_10012663
481 Ga0207659_10008725
482 Ga0207687_10033560
483 Ga0207687_10038546
484 Ga0207687_10136300
485 Ga0207687_10221231
486 Ga0207700_10198853
487 Ga0207700_10703570
488 Ga0207644_10074970
489 Ga0207644_10320803
490 Ga0207690_10209641
491 Ga0207690_10277190
492 Ga0207706_10041340
493 Ga0207686_10082602
494 Ga0207709_10018901
495 Ga0207670_10009373
496 Ga0207670_10058071
497 Ga0207669_10006390
498 Ga0207669_10013464
499 Ga0207704_10115654
500 Ga0207704_10254453
501 Ga0207691_10041345
502 Ga0207711_10011857
503 Ga0207711_10233924
504 Ga0207679_10210266
505 Ga0207679_10370930
506 Ga0207679_10484542
507 Ga0207651_10112587
508 Ga0207712_10006592
509 Ga0207712_10021590
510 Ga0207712_10082229
511 Ga0207712_10117426
512 Ga0207712_10228519
513 Ga0207712_10408960
514 Ga0207668_10060495
515 Ga0207677_10184738
516 Ga0207677_10487368
517 Ga0207677_10609239
518 Ga0207708_10044161
519 Ga0207641_10162695
520 Ga0207648_10004385
521 Ga0207648_10018128
522 Ga0207674_10006340
523 Ga0207674_10107225
524 Ga0207674_10223269
525 Ga0207675_100044160
526 Ga0207675_100145413
527 Ga0207683_10022082
528 Ga0207683_10022667
529 Ga0207428_10000139
530 Ga0207428_10000765
531 Ga0207428_10023986
532 Ga0268265_10134111
533 Ga0268265_10232440
534 Ga0268265_10486987
535 Ga0268264_10433833
536 Ga0307405_10372430
537 Ga0373950_0006437
538 Ga0373958_0000853
539 Ga0373938_0001973
540 Ga0373929_0000355
541 Ga0373934_0030923
542 Ga0373940_0003208
543 Ga0373949_0001583
544 Ga0373951_0001536
545 Ga0373952_0000209
546 Ga0373932_0000857
547 Ga0373939_0000198
548 Ga0373941_0008017
549 Ga0373956_0052074
550 Ga0373960_0000078
551 Ga0373943_0024410
552 Ga0373955_0032814
553 Ga0373942_0001202
554 Ga0373961_0005970
555 Ga0373962_0002112
556 Ga0373931_0001096
557 Ga0373935_0219468
558 Ga0373935_0432768
559 Ga0373947_0006301
560 Ga0373937_0028158
561 Ga0373925_0010081
562 Ga0436364_0325681
563 Ga0436364_0587501
564 Ga0436364_0767943
565 Ga0436364_0922888
566 Ga0436365_1489555
567 Ga0451577_0050454
568 Ga0453684_0187054
569 Ga0451576_0014251
570 Ga0451576_0337776
571 Ga0495592_0119605
572 Ga0495603_0186307
573 Ga0495653_0345948
574 Ga0495580_0223756
575 Ga0495594_0096864
576 Ga0495594_0226360
577 Ga0495628_0123637
578 Ga0495587_0138432
579 Ga0495667_0244356
580 Ga0495635_0075941
581 Ga0495599_0088017
582 Ga0495599_0253387
583 Ga0495658_0023077
584 Ga0495613_0311005
585 Ga0495675_0153345
586 Ga0495684_0002689
587 Ga0495686_0134797
588 Ga0496103_0413732
589 Ga0496104_0596045
590 Ga0496106_0102726
591 Ga0496106_0185578
592 Ga0496107_0481499
593 Ga0496109_0046956
594 Ga0496110_0038225
595 Ga0496112_0018101
596 Ga0496113_0040400
597 Ga0496114_0708476
598 Ga0501073_0037816
599 Ga0501077_0111843
600 Ga0501080_0176829
601 nmdc:mga03683_27058_c1
602 nmdc:mga03n38_174038_c1
603 nmdc:mga04h51_112132_c1
604 nmdc:mga05p37_109749_c1
605 nmdc:mga05p37_134926_c1
606 nmdc:mga05p37_15679_c1
607 nmdc:mga05p37_437793_c1
608 nmdc:mga05p37_711270_c1
609 nmdc:mga0qj67_102748_c1
610 nmdc:mga0qj67_282190_c1
611 nmdc:mga08y16_11001_c1
612 nmdc:mga08y16_251765_c1
613 nmdc:mga08y16_2997_c1
614 nmdc:mga08y16_563_c1
615 nmdc:mga08y16_61651_c1
616 nmdc:mga08y16_99706_c1
617 nmdc:mga0n895_207985_c1
618 nmdc:mga0n895_383967_c1
619 nmdc:mga0n895_47420_c1
620 nmdc:mga0n895_798_c1
621 nmdc:mga0rr50_16252_c1
622 nmdc:mga0rr50_201_c1
623 nmdc:mga08x19_2093_c1
624 nmdc:mga08x19_213519_c1
625 nmdc:mga08x19_36505_c1
626 nmdc:mga0a205_31982_c1
627 nmdc:mga0a205_98543_c1
628 Ga0500645_007815

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00285

Citrate_synt

Citrate synthase, C-terminal domain

82

280

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g5c-assembly1.cif.gz_D structure of acly-d1026a-substrates, local refinement of ash domain 0.8546 1 243
6qfb-assembly1.cif.gz_B-2 structure of the human atp citrate lyase holoenzyme in complex with citrate, coenzyme a and mg.adp 0.8452 1 243
8g1f-assembly1.cif.gz_B structure of acly-d1026a-products 0.8441 1 244
6qfb-assembly1.cif.gz_A-2 structure of the human atp citrate lyase holoenzyme in complex with citrate, coenzyme a and mg.adp 0.8439 1 243
8g5c-assembly1.cif.gz_A structure of acly-d1026a-substrates, local refinement of ash domain 0.8405 1 243
ID Description Score Start End Superfamily
af_A4HXU4_300_422_1.10.580.10 Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 0.7812 103 203 1.10.580.10
af_Q8I6U7_394_509_1.10.580.10 Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 0.7786 103 203 1.10.580.10
1cscA02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.7701 103 203 1.10.230.10
3hwkA02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.7126 102 202 1.10.230.10
3hwkA02 Mainly Alpha;Orthogonal Bundle;Cytochrome p450-Terp; domain 2;Cytochrome P450-Terp, domain 2 0.7003 102 202 1.10.230.10
ID Description Score Start End GO Terms
AF-A0A1Q7AHT2-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.9634 1 198 GO:0004108
GO:0005829
GO:0005975
GO:0006099
AF-A0A497AH22-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.9623 1 217 GO:0004108
GO:0005829
GO:0005975
GO:0006099
GO:0016829
AF-A0A7V9HJD8-F1-model_v4 Citryl-CoA lyase 0.9612 1 100 GO:0016829
GO:0046912
AF-A0A1Q7UXZ0-F1-model_v4 CoA-binding domain-containing protein 0.9605 3 232 GO:0004775
GO:0004776
GO:0005524
GO:0006099
GO:0006629
GO:0009361
GO:0036440
AF-A0A359F8B3-F1-model_v4 deleted 0.9556 4 76

Map