F402371

General Info

Members Datasets Scaffolds Average Seq Length
313 210 624 122

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0372592|Ga0496109_0372592_732_1151
Length 139
Sequence MPVFDGLRPGMTDWEETLLENMAARVNADANLVRRGKHVNTTFLIAIDNADHLIRIVDGKIVSITPGPFITPNYSFALRAARDAWDRLWSPSPIPGYTDIFALVKKKLLRIEGDLHPFMSNLIYFKGVIAAASRTKEAA

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
131 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
132 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
133 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
134 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
152 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
153 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
156 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
157 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
158 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
159 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
160 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
161 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
162 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
165 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
166 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
170 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
202 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
203 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
204 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
205 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
206 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.39
Nodule 0
Rhizoplane 8.95
Rhizosphere 82.43
Stem 0
Stem Tuber 0
Unclassified 4.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0372592 3300048912 Bacteria 1349
2 JGI25406J46586_10065519 3300003203 Bacteria 1157
3 Ga0065715_10762273 3300005293 Bacteria 625
4 Ga0070676_10133392 3300005328 Bacteria 1573
5 Ga0070683_100032162 3300005329 Bacteria 4776
6 Ga0070683_100363143 3300005329 Bacteria 1379
7 Ga0070683_100463223 3300005329 Bacteria 1210
8 Ga0070690_100024586 3300005330 Bacteria 3705
9 Ga0070690_100737022 3300005330 Bacteria 760
10 Ga0070677_10029494 3300005333 Bacteria 2081
11 Ga0068869_100799124 3300005334 Bacteria 811
12 Ga0070682_100056782 3300005337 Bacteria 2463
13 Ga0070689_100004448 3300005340 Bacteria 9473
14 Ga0070689_100081952 3300005340 Bacteria 2533
15 Ga0070689_100707874 3300005340 Bacteria 880
16 Ga0070689_101238686 3300005340 Bacteria 671
17 Ga0070689_101460693 3300005340 Bacteria 619
18 Ga0070687_100313403 3300005343 Bacteria 1000
19 Ga0070668_100719059 3300005347 Bacteria 882
20 Ga0070669_100038143 3300005353 Bacteria 3487
21 Ga0070669_100447857 3300005353 Unclassified 1064
22 Ga0070669_100671755 3300005353 Bacteria 873
23 Ga0070675_101151501 3300005354 Bacteria 714
24 Ga0070671_100486299 3300005355 Bacteria 1061
25 Ga0070674_100063459 3300005356 Bacteria 2586
26 Ga0070674_100663075 3300005356 Bacteria 888
27 Ga0070673_100388904 3300005364 Unclassified 1245
28 Ga0070673_101012456 3300005364 Bacteria 774
29 Ga0070673_101199230 3300005364 Unclassified 711
30 Ga0070688_100170991 3300005365 Bacteria 1500
31 Ga0070688_100213320 3300005365 Bacteria 1357
32 Ga0070667_100300299 3300005367 Bacteria 1446
33 Ga0070711_102015431 3300005439 Unclassified 508
34 Ga0070700_100497728 3300005441 Bacteria 937
35 Ga0070700_101637442 3300005441 Unclassified 551
36 Ga0070663_101009496 3300005455 Bacteria 724
37 Ga0070678_100054151 3300005456 Bacteria 2921
38 Ga0068867_100288712 3300005459 Bacteria 1348
39 Ga0068867_102046725 3300005459 Bacteria 542
40 Ga0070685_10056726 3300005466 Bacteria 2278
41 Ga0070679_100189769 3300005530 Bacteria 2025
42 Ga0070684_100084634 3300005535 Bacteria 2812
43 Ga0068853_101039832 3300005539 Unclassified 789
44 Ga0070672_100325661 3300005543 Bacteria 1307
45 Ga0070672_100403140 3300005543 Bacteria 1172
46 Ga0070686_100555299 3300005544 Bacteria 899
47 Ga0070686_100784309 3300005544 Bacteria 767
48 Ga0070665_100330992 3300005548 Bacteria 1528
49 Ga0070704_101171892 3300005549 Bacteria 700
50 Ga0070702_100521129 3300005615 Bacteria 877
51 Ga0070702_100990217 3300005615 Bacteria 665
52 Ga0068859_100061518 3300005617 Bacteria 3783
53 Ga0068859_100246650 3300005617 Bacteria 1876
54 Ga0068864_100289960 3300005618 Bacteria 1530
55 Ga0068866_10224348 3300005718 Bacteria 1136
56 Ga0068866_10232822 3300005718 Bacteria 1118
57 Ga0068861_100186820 3300005719 Bacteria 1729
58 Ga0068861_100306778 3300005719 Bacteria 1377
59 Ga0068870_10572190 3300005840 Bacteria 764
60 Ga0068863_100277582 3300005841 Bacteria 1623
61 Ga0068863_101608691 3300005841 Bacteria 659
62 Ga0068858_100448054 3300005842 Bacteria 1244
63 Ga0068858_100731303 3300005842 Bacteria 964
64 Ga0068862_100246345 3300005844 Bacteria 1627
65 Ga0068862_101235685 3300005844 Bacteria 747
66 Ga0081455_10037449 3300005937 Bacteria 4308
67 Ga0081540_1000038 3300005983 Bacteria 138179
68 Ga0081539_10001680 3300005985 Bacteria 35819
69 Ga0075365_10694179 3300006038 Bacteria 719
70 Ga0075368_10458652 3300006042 Bacteria 565
71 Ga0075363_100007753 3300006048 Bacteria 4958
72 Ga0075363_100184512 3300006048 Bacteria 1188
73 Ga0075363_100441281 3300006048 Bacteria 768
74 Ga0075364_10007043 3300006051 Bacteria 6647
75 Ga0075364_10699016 3300006051 Bacteria 692
76 Ga0075432_10157513 3300006058 Bacteria 876
77 Ga0070716_100564426 3300006173 Bacteria 851
78 Ga0075367_11052635 3300006178 Unclassified 520
79 Ga0075369_10467614 3300006186 Bacteria 598
80 Ga0075366_10001455 3300006195 Bacteria 11796
81 Ga0075366_10203152 3300006195 Bacteria 1205
82 Ga0097621_100448795 3300006237 Bacteria 1161
83 Ga0097621_100941393 3300006237 Bacteria 806
84 Ga0097621_101347686 3300006237 Bacteria 675
85 Ga0068871_101780952 3300006358 Bacteria 585
86 Ga0075430_100808034 3300006846 Bacteria 773
87 Ga0075429_100345818 3300006880 Bacteria 1302
88 Ga0068865_100646033 3300006881 Bacteria 899
89 Ga0068865_101879510 3300006881 Bacteria 542
90 Ga0097620_100061518 3300006931 Bacteria 3783
91 Ga0097620_100246648 3300006931 Bacteria 1876
92 Ga0105251_10511041 3300009011 Unclassified 562
93 Ga0111539_10041449 3300009094 Bacteria 5536
94 Ga0111539_12040147 3300009094 Bacteria 665
95 Ga0105245_10318405 3300009098 Bacteria 1531
96 Ga0105245_10423506 3300009098 Bacteria 1335
97 Ga0105245_10904010 3300009098 Bacteria 925
98 Ga0105245_11774318 3300009098 Bacteria 670
99 Ga0105247_11363285 3300009101 Bacteria 572
100 Ga0114129_10278023 3300009147 Bacteria 2238
101 Ga0105243_10496871 3300009148 Bacteria 1155
102 Ga0105243_10580126 3300009148 Bacteria 1076
103 Ga0105243_10619810 3300009148 Bacteria 1044
104 Ga0105243_11822477 3300009148 Bacteria 640
105 Ga0105242_10182468 3300009176 Bacteria 1852
106 Ga0105242_10976487 3300009176 Bacteria 853
107 Ga0105242_11049425 3300009176 Bacteria 826
108 Ga0105248_10066793 3300009177 Bacteria 4038
109 Ga0105248_10079861 3300009177 Bacteria 3676
110 Ga0105248_10444167 3300009177 Bacteria 1461
111 Ga0105237_11923168 3300009545 Bacteria 600
112 Ga0105249_10108068 3300009553 Bacteria 2626
113 Ga0105249_10514323 3300009553 Bacteria 1244
114 Ga0105249_12081271 3300009553 Bacteria 640
115 Ga0099796_10267155 3300010159 Bacteria 715
116 Ga0105246_10104593 3300011119 Bacteria 2068
117 Ga0105246_10535462 3300011119 Bacteria 1001
118 Ga0157374_11666967 3300013296 Bacteria 662
119 Ga0157378_10580228 3300013297 Bacteria 1130
120 Ga0157378_11166605 3300013297 Bacteria 809
121 Ga0157378_11524531 3300013297 Bacteria 713
122 Ga0157378_12079825 3300013297 Bacteria 618
123 Ga0163162_10139357 3300013306 Bacteria 2538
124 Ga0163162_10795545 3300013306 Bacteria 1063
125 Ga0163162_10948008 3300013306 Bacteria 972
126 Ga0157375_10393599 3300013308 Bacteria 1552
127 Ga0157375_10484966 3300013308 Bacteria 1401
128 Ga0163163_10015819 3300014325 Bacteria 6989
129 Ga0157380_11191293 3300014326 Bacteria 805
130 Ga0157380_12657258 3300014326 Bacteria 567
131 Ga0182008_10093156 3300014497 Bacteria 1486
132 Ga0157377_10259431 3300014745 Bacteria 1130
133 Ga0157379_11976136 3300014968 Bacteria 576
134 Ga0157376_10230370 3300014969 Bacteria 1720
135 Ga0157376_10285318 3300014969 Bacteria 1557
136 Ga0157376_11214664 3300014969 Bacteria 782
137 Ga0182007_10143529 3300015262 Bacteria 809
138 Ga0163161_10092584 3300017792 Bacteria 2238
139 Ga0163161_11580223 3300017792 Bacteria 578
140 Ga0213876_10103720 3300021384 Bacteria 1508
141 Ga0207682_10031371 3300025893 Bacteria 2132
142 Ga0207642_10117733 3300025899 Bacteria 1365
143 Ga0207642_11093213 3300025899 Bacteria 515
144 Ga0207688_10518286 3300025901 Bacteria 748
145 Ga0207688_10609888 3300025901 Bacteria 688
146 Ga0207680_11194437 3300025903 Bacteria 542
147 Ga0207645_10312480 3300025907 Bacteria 1047
148 Ga0207643_10301105 3300025908 Bacteria 998
149 Ga0207707_10715053 3300025912 Bacteria 840
150 Ga0207671_10030241 3300025914 Bacteria 4040
151 Ga0207693_11157820 3300025915 Bacteria 585
152 Ga0207662_11195544 3300025918 Bacteria 540
153 Ga0207657_10822280 3300025919 Unclassified 718
154 Ga0207681_10206180 3300025923 Bacteria 1512
155 Ga0207681_10318047 3300025923 Bacteria 1237
156 Ga0207681_10839890 3300025923 Bacteria 768
157 Ga0207681_11015036 3300025923 Bacteria 696
158 Ga0207650_10825260 3300025925 Unclassified 786
159 Ga0207687_10013100 3300025927 Bacteria 5421
160 Ga0207687_10435647 3300025927 Bacteria 1084
161 Ga0207644_10060234 3300025931 Bacteria 2747
162 Ga0207690_10810526 3300025932 Bacteria 774
163 Ga0207706_10861252 3300025933 Bacteria 767
164 Ga0207686_10397569 3300025934 Bacteria 1049
165 Ga0207670_10003229 3300025936 Bacteria 8637
166 Ga0207670_10471519 3300025936 Bacteria 1015
167 Ga0207669_10042648 3300025937 Bacteria 2650
168 Ga0207669_11513798 3300025937 Archaea 572
169 Ga0207669_11683906 3300025937 Bacteria 542
170 Ga0207665_10698882 3300025939 Bacteria 797
171 Ga0207691_10318595 3300025940 Bacteria 1333
172 Ga0207691_10954459 3300025940 Bacteria 716
173 Ga0207711_10017086 3300025941 Bacteria 6027
174 Ga0207711_10458598 3300025941 Bacteria 1187
175 Ga0207689_10226271 3300025942 Bacteria 1546
176 Ga0207661_10137311 3300025944 Bacteria 2101
177 Ga0207651_10385450 3300025960 Bacteria 1189
178 Ga0207651_10696261 3300025960 Bacteria 895
179 Ga0207712_11789747 3300025961 Bacteria 550
180 Ga0207668_10363575 3300025972 Unclassified 1213
181 Ga0207668_11777489 3300025972 Bacteria 556
182 Ga0207658_10591687 3300025986 Bacteria 996
183 Ga0207677_12192567 3300026023 Bacteria 514
184 Ga0207703_10438789 3300026035 Bacteria 1218
185 Ga0207678_10661170 3300026067 Bacteria 918
186 Ga0207708_10338427 3300026075 Bacteria 1232
187 Ga0207708_10511157 3300026075 Bacteria 1008
188 Ga0207708_11610847 3300026075 Bacteria 570
189 Ga0207676_10130030 3300026095 Bacteria 2139
190 Ga0207676_11693767 3300026095 Bacteria 631
191 Ga0207674_10866173 3300026116 Bacteria 871
192 Ga0207675_100242807 3300026118 Bacteria 1741
193 Ga0207675_100283839 3300026118 Bacteria 1609
194 Ga0207683_10091091 3300026121 Bacteria 2716
195 Ga0207698_11137251 3300026142 Bacteria 794
196 Ga0207698_11294444 3300026142 Bacteria 744
197 Ga0207428_10288731 3300027907 Bacteria 1216
198 Ga0207428_10547978 3300027907 Bacteria 837
199 Ga0268265_11950154 3300028380 Bacteria 594
200 Ga0265338_10191512 3300028800 Bacteria 1550
201 Ga0265325_10000300 3300031241 Bacteria 34777
202 Ga0265331_10080129 3300031250 Bacteria 1518
203 Ga0307513_10164601 3300031456 Bacteria 2104
204 Ga0307416_102352356 3300032002 Bacteria 633
205 Ga0373930_0026481 3300034816 Bacteria 1169
206 Ga0373928_0032316 3300035084 Bacteria 1166
207 Ga0373940_0264870 3300035088 Bacteria 583
208 Ga0373949_0050926 3300035090 Bacteria 1043
209 Ga0373932_0148921 3300035112 Bacteria 802
210 Ga0373939_0365854 3300035114 Bacteria 590
211 Ga0373945_0244864 3300035116 Bacteria 756
212 Ga0373956_0120127 3300035119 Bacteria 1227
213 Ga0373943_0221437 3300035170 Bacteria 1054
214 Ga0373946_0282582 3300035171 Bacteria 817
215 Ga0373961_0113694 3300035241 Bacteria 890
216 Ga0373962_0007328 3300035242 Bacteria 2700
217 Ga0373924_0226225 3300035410 Bacteria 827
218 Ga0373931_0026424 3300035691 Bacteria 2954
219 Ga0373935_0005922 3300035692 Bacteria 7247
220 Ga0373935_0461146 3300035692 Bacteria 919
221 Ga0373947_0446623 3300035725 Bacteria 876
222 Ga0373937_0544998 3300036401 Bacteria 1102
223 Ga0373925_0315460 3300037068 Bacteria 1264
224 Ga0373925_0461187 3300037068 Bacteria 1041
225 Ga0373925_0514308 3300037068 Bacteria 983
226 Ga0436364_0364135 3300037853 Bacteria 760
227 Ga0436365_0116825 3300039437 Unclassified 655
228 Ga0436365_0383161 3300039437 Bacteria 3093
229 Ga0436365_1499926 3300039437 Bacteria 1037
230 Ga0436360_0324864 3300039438 Bacteria 1019
231 Ga0436360_0499190 3300039438 Bacteria 1450
232 Ga0439447_097570 3300041407 Bacteria 675
233 Ga0439453_0001400 3300041408 Bacteria 3082
234 Ga0439453_0003178 3300041408 Bacteria 2338
235 Ga0439453_0004905 3300041408 Bacteria 2014
236 Ga0451795_0279965 3300041456 Bacteria 510
237 Ga0451853_2860160 3300041512 Bacteria 680
238 Ga0439431_0039848 3300041997 Bacteria 1193
239 Ga0439441_147546 3300042001 Bacteria 553
240 Ga0439443_005460 3300042003 Bacteria 1699
241 Ga0439443_122600 3300042003 Bacteria 511
242 Ga0439432_137600 3300042006 Bacteria 719
243 Ga0439452_051967 3300042010 Bacteria 936
244 Ga0439456_063106 3300042013 Bacteria 816
245 Ga0439446_0081124 3300042156 Bacteria 1005
246 Ga0439434_0298978 3300042435 Bacteria 556
247 Ga0439435_0050075 3300042436 Bacteria 1193
248 Ga0439435_0056368 3300042436 Bacteria 1136
249 Ga0439459_0142684 3300042438 Bacteria 620
250 Ga0439460_0123898 3300042461 Bacteria 847
251 Ga0495605_0022461 3300046474 Bacteria 3333
252 Ga0495630_0645819 3300046517 Bacteria 810
253 Ga0495645_0291415 3300046543 Bacteria 1070
254 Ga0495685_039152 3300047447 Bacteria 1623
255 Ga0495685_060336 3300047447 Bacteria 1279
256 Ga0495615_0020480 3300048090 Bacteria 1483
257 Ga0496100_0552614 3300048903 Bacteria 891
258 Ga0496100_1236819 3300048903 Bacteria 589
259 Ga0496101_0148856 3300048904 Bacteria 1789
260 Ga0496102_0062557 3300048905 Bacteria 3408
261 Ga0496104_0133032 3300048907 Bacteria 2389
262 Ga0496105_0043770 3300048908 Bacteria 3692
263 Ga0496105_1317812 3300048908 Bacteria 526
264 Ga0496106_0384436 3300048909 Bacteria 1128
265 Ga0496107_0178948 3300048910 Bacteria 1574
266 Ga0496108_0062523 3300048911 Bacteria 3135
267 Ga0496108_0244031 3300048911 Bacteria 1562
268 Ga0496108_0308319 3300048911 Bacteria 1379
269 Ga0496108_0542539 3300048911 Bacteria 1015
270 Ga0496109_0115873 3300048912 Bacteria 2493
271 Ga0496110_0197680 3300048913 Bacteria 1826
272 Ga0496111_0101249 3300048914 Bacteria 2117
273 Ga0496111_0107292 3300048914 Bacteria 2056
274 Ga0496112_0108188 3300048915 Bacteria 2750
275 Ga0496112_0205977 3300048915 Bacteria 1925
276 Ga0496112_1137613 3300048915 Bacteria 698
277 Ga0496113_0111800 3300048916 Bacteria 2127
278 Ga0496113_0254885 3300048916 Bacteria 1401
279 Ga0496114_0147419 3300048917 Bacteria 2040
280 Ga0496114_0399315 3300048917 Bacteria 1217
281 Ga0496115_0077592 3300048918 Bacteria 2701
282 Ga0496115_0102402 3300048918 Bacteria 2348
283 Ga0501067_0438124 3300049583 Bacteria 730
284 Ga0501071_1594079 3300049587 Unclassified 504
285 Ga0501072_0002541 3300049588 Bacteria 13672
286 Ga0501072_0110731 3300049588 Bacteria 2186
287 Ga0501072_0394540 3300049588 Bacteria 1098
288 Ga0501074_0566772 3300049590 Bacteria 804
289 Ga0501076_1080971 3300049592 Bacteria 661
290 Ga0501079_0681743 3300049741 Bacteria 809
291 Ga0501080_0292463 3300049742 Bacteria 1479
292 Ga0501081_0962357 3300049743 Bacteria 644
293 nmdc:mga03n38_26264_c1 3300050490 Bacteria 2403
294 nmdc:mga00v17_280079_c1 3300050491 Bacteria 1082
295 nmdc:mga0yw44_595131_c1 3300050492 Bacteria 751
296 nmdc:mga0k408_12447_c2 3300050493 Bacteria 4394
297 nmdc:mga07m45_371638_c1 3300050496 Bacteria 830
298 nmdc:mga05p37_931729_c1 3300050507 Bacteria 932
299 nmdc:mga08y16_121490_c1 3300050511 Bacteria 2718
300 nmdc:mga08y16_833544_c1 3300050511 Bacteria 913
301 Ga0495601_0167828 3300053077 Bacteria 1434
302 Ga0495612_0027915 3300053078 Bacteria 2271
303 Ga0500635_0161675 3300053080 Bacteria 859
304 Ga0495655_0018184 3300053083 Bacteria 1541
305 Ga0500577_0122633 3300053142 Bacteria 1083
306 Ga0500588_0044700 3300053146 Bacteria 1353
307 Ga0500636_0299007 3300053177 Bacteria 794
308 Ga0501084_0093110 3300054114 Bacteria 2530
309 Ga0590071_021164 3300059421 Bacteria 1533
310 Ga0501082_1617376 3300060353 Bacteria 566
311 Ga0501082_1938165 3300060353 Bacteria 514
312 Ga0530510_0472017 3300061734 Bacteria 950
313 Ga0496109_0372592
314 JGI25406J46586_10065519
315 Ga0065715_10762273
316 Ga0070676_10133392
317 Ga0070683_100032162
318 Ga0070683_100363143
319 Ga0070683_100463223
320 Ga0070690_100024586
321 Ga0070690_100737022
322 Ga0070677_10029494
323 Ga0068869_100799124
324 Ga0070682_100056782
325 Ga0070689_100004448
326 Ga0070689_100081952
327 Ga0070689_100707874
328 Ga0070689_101238686
329 Ga0070689_101460693
330 Ga0070687_100313403
331 Ga0070668_100719059
332 Ga0070669_100038143
333 Ga0070669_100447857
334 Ga0070669_100671755
335 Ga0070675_101151501
336 Ga0070671_100486299
337 Ga0070674_100063459
338 Ga0070674_100663075
339 Ga0070673_100388904
340 Ga0070673_101012456
341 Ga0070673_101199230
342 Ga0070688_100170991
343 Ga0070688_100213320
344 Ga0070667_100300299
345 Ga0070711_102015431
346 Ga0070700_100497728
347 Ga0070700_101637442
348 Ga0070663_101009496
349 Ga0070678_100054151
350 Ga0068867_100288712
351 Ga0068867_102046725
352 Ga0070685_10056726
353 Ga0070679_100189769
354 Ga0070684_100084634
355 Ga0068853_101039832
356 Ga0070672_100325661
357 Ga0070672_100403140
358 Ga0070686_100555299
359 Ga0070686_100784309
360 Ga0070665_100330992
361 Ga0070704_101171892
362 Ga0070702_100521129
363 Ga0070702_100990217
364 Ga0068859_100061518
365 Ga0068859_100246650
366 Ga0068864_100289960
367 Ga0068866_10224348
368 Ga0068866_10232822
369 Ga0068861_100186820
370 Ga0068861_100306778
371 Ga0068870_10572190
372 Ga0068863_100277582
373 Ga0068863_101608691
374 Ga0068858_100448054
375 Ga0068858_100731303
376 Ga0068862_100246345
377 Ga0068862_101235685
378 Ga0081455_10037449
379 Ga0081540_1000038
380 Ga0081539_10001680
381 Ga0075365_10694179
382 Ga0075368_10458652
383 Ga0075363_100007753
384 Ga0075363_100184512
385 Ga0075363_100441281
386 Ga0075364_10007043
387 Ga0075364_10699016
388 Ga0075432_10157513
389 Ga0070716_100564426
390 Ga0075367_11052635
391 Ga0075369_10467614
392 Ga0075366_10001455
393 Ga0075366_10203152
394 Ga0097621_100448795
395 Ga0097621_100941393
396 Ga0097621_101347686
397 Ga0068871_101780952
398 Ga0075430_100808034
399 Ga0075429_100345818
400 Ga0068865_100646033
401 Ga0068865_101879510
402 Ga0097620_100061518
403 Ga0097620_100246648
404 Ga0105251_10511041
405 Ga0111539_10041449
406 Ga0111539_12040147
407 Ga0105245_10318405
408 Ga0105245_10423506
409 Ga0105245_10904010
410 Ga0105245_11774318
411 Ga0105247_11363285
412 Ga0114129_10278023
413 Ga0105243_10496871
414 Ga0105243_10580126
415 Ga0105243_10619810
416 Ga0105243_11822477
417 Ga0105242_10182468
418 Ga0105242_10976487
419 Ga0105242_11049425
420 Ga0105248_10066793
421 Ga0105248_10079861
422 Ga0105248_10444167
423 Ga0105237_11923168
424 Ga0105249_10108068
425 Ga0105249_10514323
426 Ga0105249_12081271
427 Ga0099796_10267155
428 Ga0105246_10104593
429 Ga0105246_10535462
430 Ga0157374_11666967
431 Ga0157378_10580228
432 Ga0157378_11166605
433 Ga0157378_11524531
434 Ga0157378_12079825
435 Ga0163162_10139357
436 Ga0163162_10795545
437 Ga0163162_10948008
438 Ga0157375_10393599
439 Ga0157375_10484966
440 Ga0163163_10015819
441 Ga0157380_11191293
442 Ga0157380_12657258
443 Ga0182008_10093156
444 Ga0157377_10259431
445 Ga0157379_11976136
446 Ga0157376_10230370
447 Ga0157376_10285318
448 Ga0157376_11214664
449 Ga0182007_10143529
450 Ga0163161_10092584
451 Ga0163161_11580223
452 Ga0213876_10103720
453 Ga0207682_10031371
454 Ga0207642_10117733
455 Ga0207642_11093213
456 Ga0207688_10518286
457 Ga0207688_10609888
458 Ga0207680_11194437
459 Ga0207645_10312480
460 Ga0207643_10301105
461 Ga0207707_10715053
462 Ga0207671_10030241
463 Ga0207693_11157820
464 Ga0207662_11195544
465 Ga0207657_10822280
466 Ga0207681_10206180
467 Ga0207681_10318047
468 Ga0207681_10839890
469 Ga0207681_11015036
470 Ga0207650_10825260
471 Ga0207687_10013100
472 Ga0207687_10435647
473 Ga0207644_10060234
474 Ga0207690_10810526
475 Ga0207706_10861252
476 Ga0207686_10397569
477 Ga0207670_10003229
478 Ga0207670_10471519
479 Ga0207669_10042648
480 Ga0207669_11513798
481 Ga0207669_11683906
482 Ga0207665_10698882
483 Ga0207691_10318595
484 Ga0207691_10954459
485 Ga0207711_10017086
486 Ga0207711_10458598
487 Ga0207689_10226271
488 Ga0207661_10137311
489 Ga0207651_10385450
490 Ga0207651_10696261
491 Ga0207712_11789747
492 Ga0207668_10363575
493 Ga0207668_11777489
494 Ga0207658_10591687
495 Ga0207677_12192567
496 Ga0207703_10438789
497 Ga0207678_10661170
498 Ga0207708_10338427
499 Ga0207708_10511157
500 Ga0207708_11610847
501 Ga0207676_10130030
502 Ga0207676_11693767
503 Ga0207674_10866173
504 Ga0207675_100242807
505 Ga0207675_100283839
506 Ga0207683_10091091
507 Ga0207698_11137251
508 Ga0207698_11294444
509 Ga0207428_10288731
510 Ga0207428_10547978
511 Ga0268265_11950154
512 Ga0265338_10191512
513 Ga0265325_10000300
514 Ga0265331_10080129
515 Ga0307513_10164601
516 Ga0307416_102352356
517 Ga0373930_0026481
518 Ga0373928_0032316
519 Ga0373940_0264870
520 Ga0373949_0050926
521 Ga0373932_0148921
522 Ga0373939_0365854
523 Ga0373945_0244864
524 Ga0373956_0120127
525 Ga0373943_0221437
526 Ga0373946_0282582
527 Ga0373961_0113694
528 Ga0373962_0007328
529 Ga0373924_0226225
530 Ga0373931_0026424
531 Ga0373935_0005922
532 Ga0373935_0461146
533 Ga0373947_0446623
534 Ga0373937_0544998
535 Ga0373925_0315460
536 Ga0373925_0461187
537 Ga0373925_0514308
538 Ga0436364_0364135
539 Ga0436365_0116825
540 Ga0436365_0383161
541 Ga0436365_1499926
542 Ga0436360_0324864
543 Ga0436360_0499190
544 Ga0439447_097570
545 Ga0439453_0001400
546 Ga0439453_0003178
547 Ga0439453_0004905
548 Ga0451795_0279965
549 Ga0451853_2860160
550 Ga0439431_0039848
551 Ga0439441_147546
552 Ga0439443_005460
553 Ga0439443_122600
554 Ga0439432_137600
555 Ga0439452_051967
556 Ga0439456_063106
557 Ga0439446_0081124
558 Ga0439434_0298978
559 Ga0439435_0050075
560 Ga0439435_0056368
561 Ga0439459_0142684
562 Ga0439460_0123898
563 Ga0495605_0022461
564 Ga0495630_0645819
565 Ga0495645_0291415
566 Ga0495685_039152
567 Ga0495685_060336
568 Ga0495615_0020480
569 Ga0496100_0552614
570 Ga0496100_1236819
571 Ga0496101_0148856
572 Ga0496102_0062557
573 Ga0496104_0133032
574 Ga0496105_0043770
575 Ga0496105_1317812
576 Ga0496106_0384436
577 Ga0496107_0178948
578 Ga0496108_0062523
579 Ga0496108_0244031
580 Ga0496108_0308319
581 Ga0496108_0542539
582 Ga0496109_0115873
583 Ga0496110_0197680
584 Ga0496111_0101249
585 Ga0496111_0107292
586 Ga0496112_0108188
587 Ga0496112_0205977
588 Ga0496112_1137613
589 Ga0496113_0111800
590 Ga0496113_0254885
591 Ga0496114_0147419
592 Ga0496114_0399315
593 Ga0496115_0077592
594 Ga0496115_0102402
595 Ga0501067_0438124
596 Ga0501071_1594079
597 Ga0501072_0002541
598 Ga0501072_0110731
599 Ga0501072_0394540
600 Ga0501074_0566772
601 Ga0501076_1080971
602 Ga0501079_0681743
603 Ga0501080_0292463
604 Ga0501081_0962357
605 nmdc:mga03n38_26264_c1
606 nmdc:mga00v17_280079_c1
607 nmdc:mga0yw44_595131_c1
608 nmdc:mga0k408_12447_c2
609 nmdc:mga07m45_371638_c1
610 nmdc:mga05p37_931729_c1
611 nmdc:mga08y16_121490_c1
612 nmdc:mga08y16_833544_c1
613 Ga0495601_0167828
614 Ga0495612_0027915
615 Ga0500635_0161675
616 Ga0495655_0018184
617 Ga0500577_0122633
618 Ga0500588_0044700
619 Ga0500636_0299007
620 Ga0501084_0093110
621 Ga0590071_021164
622 Ga0501082_1617376
623 Ga0501082_1938165
624 Ga0530510_0472017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a4g-assembly1.cif.gz_A influenza virus b/beijing/1/87 neuraminidase complexed with zanamivir 0.8479 34 47
1inf-assembly1.cif.gz_A influenza virus b/lee/40 neuraminidase complexed with bana113 inhibitor 0.8355 34 47
2h3g-assembly1.cif.gz_X-2 structure of the type iii pantothenate kinase (coax) from bacillus anthracis 0.8281 25 50
3k38-assembly1.cif.gz_A crystal structure of b/perth neuraminidase d197e mutant 0.8224 34 47
2cx7-assembly1.cif.gz_A crystal structure of sterol carrier protein 2 0.8041 3 117
ID Description Score Start End Superfamily
af_Q9H7M9_43_171_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8681 33 50 2.60.40.10
2aujD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8352 23 51 2.40.50.100
af_Q8I345_279_493_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8323 22 49 3.30.420.40
2h3gX01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8281 25 50 3.30.420.40
af_Q04549_99_232_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8177 23 50 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A140GVV0-F1-model_v4 Alpha/beta fold family hydrolase 0.9827 1 116 GO:0016787
AF-A0A7C7LN59-F1-model_v4 SCP2 domain-containing protein 0.9819 4 118
AF-A0A6B9FHY3-F1-model_v4 SCP2 domain-containing protein 0.981 1 115
AF-A0A2U1Y665-F1-model_v4 SCP2 domain-containing protein 0.9809 4 115
AF-A0A5C7Q7P2-F1-model_v4 SCP2 domain-containing protein 0.9794 4 115

Map