F402361

General Info

Members Datasets Scaffolds Average Seq Length
313 109 310 174

Family's Representative Sequence

Representative Sequence 3300047673|Ga0495593_0094546|Ga0495593_0094546_934_1455
Length 173
Sequence MSVFIRDYAPSDRDRVNQVALAAFAQYEQHYDDWATFRDGIGRMADLADDADLLVAERGGIVGAVVHVGPGRPRNRIFPDQWSIIRMLVVDPQQSGQGIGKRLVAASLQRAHRAGAPVVGLHTSPIMANALSLYLALGFEHDCDLPPIRGVPYSRYVLPQTAIPAALDLLNKR

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221684 Massilia sp. Root133 Isolate Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
12 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
13 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
14 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
19 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
20 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
21 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
22 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
23 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
24 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
25 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
26 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
27 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
28 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
29 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
30 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
31 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
32 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
33 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
34 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
35 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
36 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
37 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
38 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
39 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
40 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
41 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
42 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
43 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
44 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
45 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
46 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
47 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
48 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
49 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
50 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
51 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
52 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
53 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
54 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
55 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
56 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
57 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
58 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
59 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
60 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
61 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
62 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
63 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
64 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
65 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
66 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
67 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
68 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
69 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
70 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
71 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
72 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
73 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
74 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
75 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
76 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
77 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
78 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
79 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
80 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
81 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
82 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
83 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
84 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
85 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
86 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
87 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
88 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
89 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
90 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
91 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
92 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
93 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
94 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
103 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
104 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
105 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
106 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
107 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
108 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
109 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.6
Nodule 0
Rhizoplane 3.19
Rhizosphere 91.37
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10021872 3300003322 Bacteria 3146
2 rootL2_10024406 3300003322 Bacteria 5049
3 Ga0055525_1000029 3300003759 Bacteria 320663
4 Ga0065165_1001666 3300005262 Bacteria 22489
5 Ga0065165_1018187 3300005262 Bacteria 2556
6 Ga0070658_10286725 3300005327 Bacteria 1402
7 Ga0070680_100423458 3300005336 Bacteria 1136
8 Ga0070660_100239537 3300005339 Bacteria 1477
9 Ga0070659_100034061 3300005366 Bacteria 3960
10 Ga0070664_100785502 3300005564 Bacteria 890
11 Ga0157372_10132207 3300013307 Bacteria 2872
12 Ga0157372_10276882 3300013307 Bacteria 1951
13 Ga0209563_100003 3300025230 Bacteria 1932942
14 Ga0209677_106113 3300025253 Bacteria 2945
15 Ga0207660_10430994 3300025917 Bacteria 1065
16 Ga0207657_10004691 3300025919 Bacteria 14430
17 Ga0207690_10240817 3300025932 Bacteria 1393
18 Ga0207667_10196575 3300025949 Bacteria 2069
19 Ga0307408_100295313 3300031548 Bacteria 1355
20 Ga0395899_0020070 3300037312 Bacteria 5070
21 Ga0395899_0033635 3300037312 Bacteria 3849
22 Ga0395899_0167245 3300037312 Bacteria 1550
23 Ga0395899_0174640 3300037312 Bacteria 1511
24 Ga0395899_0555426 3300037312 Bacteria 737
25 Ga0395900_0000263 3300037418 Bacteria 81724
26 Ga0395900_0067567 3300037418 Bacteria 3672
27 Ga0395900_0087668 3300037418 Bacteria 3198
28 Ga0395900_0161433 3300037418 Bacteria 2285
29 Ga0395900_0175862 3300037418 Bacteria 2177
30 Ga0395900_0251962 3300037418 Bacteria 1766
31 Ga0395900_0724152 3300037418 Bacteria 927
32 Ga0395900_1108736 3300037418 Bacteria 708
33 Ga0395898_0093847 3300037466 Bacteria 2883
34 Ga0395898_0139441 3300037466 Bacteria 2321
35 Ga0395898_0163291 3300037466 Bacteria 2130
36 Ga0395898_0194941 3300037466 Bacteria 1935
37 Ga0395898_0480844 3300037466 Bacteria 1181
38 Ga0395898_0709614 3300037466 Bacteria 947
39 Ga0395905_0043380 3300037471 Bacteria 4219
40 Ga0395905_0267477 3300037471 Bacteria 1595
41 Ga0395905_0494854 3300037471 Bacteria 1122
42 Ga0395905_0508967 3300037471 Bacteria 1104
43 Ga0395901_0114131 3300038443 Bacteria 2837
44 Ga0395901_0121638 3300038443 Bacteria 2743
45 Ga0395901_0286153 3300038443 Bacteria 1711
46 Ga0395901_0463729 3300038443 Bacteria 1294
47 Ga0395901_0477881 3300038443 Bacteria 1271
48 Ga0395901_1038169 3300038443 Bacteria 793
49 Ga0466972_0000906 3300044658 Bacteria 14252
50 Ga0466972_0106588 3300044658 Bacteria 1325
51 Ga0466965_0002591 3300044683 Bacteria 7730
52 Ga0466966_0025575 3300044684 Bacteria 3855
53 Ga0466966_0037989 3300044684 Bacteria 3103
54 Ga0466966_0103787 3300044684 Bacteria 1756
55 Ga0466966_0166264 3300044684 Bacteria 1341
56 Ga0466966_0311910 3300044684 Bacteria 945
57 Ga0466961_0107792 3300044693 Bacteria 1753
58 Ga0466961_0195506 3300044693 Bacteria 1252
59 Ga0466961_0260531 3300044693 Bacteria 1063
60 Ga0466963_0539660 3300044694 Bacteria 824
61 Ga0466964_0012573 3300044706 Bacteria 3204
62 Ga0466971_0157511 3300044719 Bacteria 1062
63 Ga0466971_0381289 3300044719 Unclassified 685
64 Ga0466968_0016307 3300044735 Bacteria 2956
65 Ga0466970_0374814 3300044765 Bacteria 810
66 Ga0466957_0167057 3300044842 Bacteria 1431
67 Ga0466957_0339849 3300044842 Bacteria 1017
68 Ga0466960_0028395 3300044901 Bacteria 2560
69 Ga0466959_0048918 3300045049 Bacteria 3106
70 Ga0466959_0102041 3300045049 Bacteria 2053
71 Ga0466958_0263305 3300045836 Bacteria 1104
72 Ga0495617_113534 3300046452 Bacteria 875
73 Ga0495627_000226 3300046453 Bacteria 59863
74 Ga0495603_0083119 3300046455 Bacteria 1875
75 Ga0495590_0019234 3300046457 Bacteria 2435
76 Ga0495590_0033659 3300046457 Bacteria 1791
77 Ga0495590_0126487 3300046457 Bacteria 917
78 Ga0495653_0083139 3300046463 Bacteria 2361
79 Ga0495653_0283844 3300046463 Bacteria 1085
80 Ga0495582_0086321 3300046473 Bacteria 1746
81 Ga0495605_0000183 3300046474 Bacteria 77763
82 Ga0495605_0000226 3300046474 Bacteria 69648
83 Ga0495605_0008635 3300046474 Bacteria 5757
84 Ga0495605_0014323 3300046474 Bacteria 4346
85 Ga0495585_0006039 3300046492 Bacteria 7579
86 Ga0495585_0018567 3300046492 Bacteria 4010
87 Ga0495585_0061388 3300046492 Bacteria 2067
88 Ga0495585_0076110 3300046492 Bacteria 1823
89 Ga0495596_0000468 3300046500 Bacteria 25625
90 Ga0495596_0001323 3300046500 Bacteria 14271
91 Ga0495596_0002705 3300046500 Bacteria 9327
92 Ga0495596_0009241 3300046500 Bacteria 4346
93 Ga0495596_0013999 3300046500 Bacteria 3385
94 Ga0495596_0025842 3300046500 Bacteria 2371
95 Ga0495596_0057532 3300046500 Unclassified 1517
96 Ga0495607_0001538 3300046501 Bacteria 20234
97 Ga0495607_0003691 3300046501 Bacteria 11618
98 Ga0495607_0006293 3300046501 Bacteria 8371
99 Ga0495607_0007215 3300046501 Bacteria 7713
100 Ga0495607_0148185 3300046501 Bacteria 1203
101 Ga0495583_0000308 3300046506 Bacteria 77290
102 Ga0495583_0000942 3300046506 Bacteria 33862
103 Ga0495583_0002703 3300046506 Bacteria 14728
104 Ga0495583_0012864 3300046506 Bacteria 4705
105 Ga0495583_0020621 3300046506 Bacteria 3408
106 Ga0495583_0028163 3300046506 Bacteria 2766
107 Ga0495583_0037657 3300046506 Bacteria 2291
108 Ga0495583_0198359 3300046506 Bacteria 816
109 Ga0495606_0036229 3300046507 Bacteria 3362
110 Ga0495606_0042807 3300046507 Bacteria 3025
111 Ga0495606_0137688 3300046507 Bacteria 1444
112 Ga0495606_0191306 3300046507 Bacteria 1173
113 Ga0495616_0000398 3300046513 Bacteria 33565
114 Ga0495616_0000560 3300046513 Bacteria 28175
115 Ga0495616_0001144 3300046513 Bacteria 18741
116 Ga0495616_0004144 3300046513 Bacteria 9188
117 Ga0495616_0006903 3300046513 Bacteria 6838
118 Ga0495616_0010403 3300046513 Bacteria 5387
119 Ga0495616_0013458 3300046513 Bacteria 4614
120 Ga0495616_0016391 3300046513 Bacteria 4102
121 Ga0495616_0059827 3300046513 Bacteria 1872
122 Ga0495616_0079933 3300046513 Bacteria 1566
123 Ga0495616_0104579 3300046513 Bacteria 1323
124 Ga0495631_0001305 3300046518 Bacteria 15274
125 Ga0495631_0008725 3300046518 Bacteria 5097
126 Ga0495631_0017219 3300046518 Bacteria 3424
127 Ga0495631_0025206 3300046518 Bacteria 2740
128 Ga0495631_0028925 3300046518 Bacteria 2525
129 Ga0495631_0029702 3300046518 Bacteria 2483
130 Ga0495631_0038258 3300046518 Bacteria 2133
131 Ga0495632_0000244 3300046519 Bacteria 53886
132 Ga0495632_0000245 3300046519 Bacteria 53759
133 Ga0495632_0001734 3300046519 Bacteria 17685
134 Ga0495632_0046758 3300046519 Bacteria 2149
135 Ga0495637_0029617 3300046520 Bacteria 2435
136 Ga0495637_0090864 3300046520 Bacteria 1204
137 Ga0495643_0000247 3300046522 Bacteria 79969
138 Ga0495643_0003748 3300046522 Bacteria 10994
139 Ga0495643_0021028 3300046522 Bacteria 3750
140 Ga0495643_0033077 3300046522 Bacteria 2864
141 Ga0495643_0053828 3300046522 Bacteria 2156
142 Ga0495644_0013019 3300046523 Bacteria 3196
143 Ga0495644_0022611 3300046523 Bacteria 2396
144 Ga0495644_0060672 3300046523 Bacteria 1421
145 Ga0495644_0206734 3300046523 Bacteria 757
146 Ga0495648_0006225 3300046524 Bacteria 9766
147 Ga0495648_0012035 3300046524 Bacteria 6482
148 Ga0495648_0019198 3300046524 Bacteria 4816
149 Ga0495648_0068887 3300046524 Bacteria 2061
150 Ga0495642_0000147 3300046528 Bacteria 40989
151 Ga0495642_0001211 3300046528 Bacteria 11859
152 Ga0495642_0001895 3300046528 Bacteria 8914
153 Ga0495642_0031146 3300046528 Bacteria 2138
154 Ga0495642_0055172 3300046528 Bacteria 1640
155 Ga0495642_0155926 3300046528 Bacteria 989
156 Ga0495642_0171248 3300046528 Bacteria 943
157 Ga0495652_0058148 3300046529 Bacteria 3275
158 Ga0495654_0008511 3300046530 Bacteria 5658
159 Ga0495654_0046617 3300046530 Bacteria 2134
160 Ga0495654_0048410 3300046530 Bacteria 2086
161 Ga0495665_0005470 3300046531 Bacteria 6842
162 Ga0495665_0032260 3300046531 Bacteria 2802
163 Ga0495665_0346210 3300046531 Bacteria 757
164 Ga0495640_0068693 3300046533 Bacteria 2384
165 Ga0495586_0126855 3300046535 Bacteria 1427
166 Ga0495587_0090427 3300046536 Bacteria 1768
167 Ga0495609_0002556 3300046538 Bacteria 11117
168 Ga0495609_0006729 3300046538 Bacteria 5829
169 Ga0495609_0012308 3300046538 Bacteria 4057
170 Ga0495609_0050645 3300046538 Bacteria 1851
171 Ga0495609_0063036 3300046538 Bacteria 1636
172 Ga0495597_0000619 3300046542 Bacteria 29010
173 Ga0495597_0044536 3300046542 Bacteria 1973
174 Ga0495597_0066491 3300046542 Bacteria 1562
175 Ga0495645_0226465 3300046543 Bacteria 1255
176 Ga0495633_0007019 3300046558 Bacteria 6567
177 Ga0495656_0027568 3300046615 Bacteria 2270
178 Ga0495656_0032616 3300046615 Bacteria 2121
179 Ga0495656_0266431 3300046615 Bacteria 869
180 Ga0495668_0001789 3300046616 Bacteria 19632
181 Ga0495668_0017345 3300046616 Bacteria 4177
182 Ga0495668_0041268 3300046616 Bacteria 2571
183 Ga0495668_0048161 3300046616 Bacteria 2365
184 Ga0495668_0090833 3300046616 Bacteria 1673
185 Ga0495668_0205836 3300046616 Bacteria 1077
186 Ga0495611_0001244 3300046648 Bacteria 13108
187 Ga0495611_0002508 3300046648 Bacteria 8351
188 Ga0495611_0054560 3300046648 Bacteria 1807
189 Ga0495611_0295925 3300046648 Bacteria 746
190 Ga0495625_0016178 3300046660 Bacteria 5875
191 Ga0495625_0237834 3300046660 Bacteria 1187
192 Ga0495661_0009666 3300046665 Bacteria 6606
193 Ga0495661_0014111 3300046665 Bacteria 5353
194 Ga0495661_0028413 3300046665 Bacteria 3580
195 Ga0495661_0065096 3300046665 Bacteria 2148
196 Ga0495661_0071487 3300046665 Bacteria 2027
197 Ga0495661_0075319 3300046665 Bacteria 1961
198 Ga0495661_0088435 3300046665 Bacteria 1768
199 Ga0495661_0162671 3300046665 Bacteria 1196
200 Ga0495588_0000078 3300046674 Bacteria 214254
201 Ga0495588_0024917 3300046674 Bacteria 2976
202 Ga0495588_0084615 3300046674 Bacteria 1657
203 Ga0495588_0269060 3300046674 Bacteria 898
204 Ga0495588_0313132 3300046674 Bacteria 826
205 Ga0495588_0358086 3300046674 Bacteria 767
206 Ga0495623_0059358 3300046679 Bacteria 2402
207 Ga0495669_0004596 3300046684 Bacteria 5718
208 Ga0495669_0010637 3300046684 Bacteria 3891
209 Ga0495669_0022220 3300046684 Bacteria 2755
210 Ga0495669_0056605 3300046684 Bacteria 1767
211 Ga0495670_0006442 3300046691 Bacteria 5764
212 Ga0495670_0012002 3300046691 Bacteria 4264
213 Ga0495670_0023783 3300046691 Bacteria 3025
214 Ga0495670_0168011 3300046691 Bacteria 1154
215 Ga0495670_0202684 3300046691 Bacteria 1051
216 Ga0495671_0000391 3300046692 Bacteria 36162
217 Ga0495671_0004097 3300046692 Bacteria 8793
218 Ga0495671_0038984 3300046692 Bacteria 2400
219 Ga0495671_0149864 3300046692 Unclassified 1136
220 Ga0495649_0003748 3300046694 Bacteria 10094
221 Ga0495649_0033020 3300046694 Bacteria 2849
222 Ga0495649_0033762 3300046694 Bacteria 2816
223 Ga0495649_0039004 3300046694 Bacteria 2604
224 Ga0495649_0065880 3300046694 Bacteria 1944
225 Ga0495589_0000118 3300046794 Bacteria 73742
226 Ga0495589_0002942 3300046794 Bacteria 9396
227 Ga0495589_0052531 3300046794 Bacteria 2013
228 Ga0495589_0242961 3300046794 Bacteria 842
229 Ga0495589_0278269 3300046794 Unclassified 778
230 Ga0495660_0000070 3300046810 Bacteria 112800
231 Ga0495660_0005051 3300046810 Bacteria 7924
232 Ga0495660_0024973 3300046810 Bacteria 3397
233 Ga0495660_0033025 3300046810 Bacteria 2904
234 Ga0495660_0033510 3300046810 Bacteria 2879
235 Ga0495660_0285939 3300046810 Bacteria 752
236 Ga0495660_0359716 3300046810 Bacteria 645
237 Ga0495581_0089252 3300047315 Bacteria 1788
238 Ga0495604_0024420 3300047317 Bacteria 4822
239 Ga0495604_0048251 3300047317 Bacteria 3313
240 Ga0495672_0002603 3300047320 Bacteria 16359
241 Ga0495672_0009993 3300047320 Bacteria 6805
242 Ga0495672_0281661 3300047320 Bacteria 794
243 Ga0495680_0034199 3300047322 Bacteria 4108
244 Ga0495683_0004309 3300047323 Bacteria 8110
245 Ga0495683_0031658 3300047323 Bacteria 2695
246 Ga0495683_0031899 3300047323 Bacteria 2684
247 Ga0495683_0033514 3300047323 Bacteria 2613
248 Ga0495683_0057636 3300047323 Bacteria 1930
249 Ga0495687_000396 3300047443 Bacteria 54169
250 Ga0495687_000791 3300047443 Bacteria 34019
251 Ga0495687_002304 3300047443 Bacteria 15596
252 Ga0495687_007344 3300047443 Bacteria 6509
253 Ga0495675_0001760 3300047444 Bacteria 12929
254 Ga0495677_0001836 3300047445 Bacteria 8481
255 Ga0495677_0002879 3300047445 Bacteria 6709
256 Ga0495677_0008693 3300047445 Bacteria 3768
257 Ga0495677_0050831 3300047445 Bacteria 1525
258 Ga0495677_0220368 3300047445 Bacteria 739
259 Ga0495679_001841 3300047446 Bacteria 11474
260 Ga0495679_006124 3300047446 Bacteria 5237
261 Ga0495679_131011 3300047446 Bacteria 680
262 Ga0495685_007985 3300047447 Bacteria 3505
263 Ga0495685_233762 3300047447 Bacteria 585
264 Ga0495681_0000205 3300047470 Bacteria 49281
265 Ga0495681_0000515 3300047470 Bacteria 29483
266 Ga0495681_0001240 3300047470 Bacteria 19389
267 Ga0495681_0013658 3300047470 Bacteria 4700
268 Ga0495681_0015597 3300047470 Bacteria 4292
269 Ga0495681_0033002 3300047470 Bacteria 2598
270 Ga0495681_0057495 3300047470 Bacteria 1806
271 Ga0495686_0222996 3300047472 Bacteria 1071
272 Ga0495593_0094546 3300047673 Bacteria 1537
273 Ga0495602_0035204 3300048088 Bacteria 4671
274 Ga0495626_0000028 3300048091 Bacteria 204580
275 Ga0495626_0005340 3300048091 Bacteria 7561
276 Ga0495626_0013199 3300048091 Bacteria 4302
277 Ga0495626_0015566 3300048091 Bacteria 3889
278 Ga0495626_0018870 3300048091 Bacteria 3454
279 Ga0495626_0019180 3300048091 Bacteria 3422
280 Ga0495626_0023648 3300048091 Bacteria 3021
281 Ga0495626_0036171 3300048091 Bacteria 2353
282 Ga0495626_0061121 3300048091 Bacteria 1715
283 Ga0495626_0071148 3300048091 Bacteria 1563
284 Ga0495626_0203327 3300048091 Bacteria 811
285 Ga0496102_0006994 3300048905 Bacteria 9630
286 Ga0496102_0154783 3300048905 Bacteria 2155
287 Ga0496103_0055619 3300048906 Bacteria 2455
288 Ga0496103_0091117 3300048906 Bacteria 1924
289 Ga0496106_0011792 3300048909 Bacteria 6451
290 Ga0496106_0015670 3300048909 Bacteria 5607
291 Ga0496107_0035202 3300048910 Bacteria 3589
292 Ga0496108_0132444 3300048911 Bacteria 2143
293 Ga0496111_0173095 3300048914 Bacteria 1604
294 Ga0496115_0014528 3300048918 Bacteria 5962
295 Ga0496122_0014301 3300048925 Bacteria 7685
296 Ga0496122_0032781 3300048925 Bacteria 4288
297 Ga0496122_0313494 3300048925 Bacteria 838
298 Ga0496123_0014885 3300048926 Bacteria 6417
299 Ga0496124_0027268 3300048927 Bacteria 5132
300 Ga0496124_0034444 3300048927 Bacteria 4444
301 Ga0496125_0103967 3300048928 Bacteria 2082
302 Ga0496125_0126007 3300048928 Bacteria 1815
303 Ga0495678_000844 3300049459 Bacteria 27363
304 Ga0495678_002130 3300049459 Bacteria 14032
305 Ga0495678_002172 3300049459 Bacteria 13805
306 Ga0495678_005492 3300049459 Bacteria 6987
307 Ga0495682_0000868 3300049460 Bacteria 18773
308 Ga0495682_0025703 3300049460 Bacteria 2191
309 Ga0466962_0124012 3300061719 Bacteria 1247
310 Ga0466962_0126344 3300061719 Bacteria 1235

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046463 Ga0495653_0283844 Ga0495653_0283844_430_927 147
2 3300047322 Ga0495680_0034199 Ga0495680_0034199_2644_3141 147
3 3300046536 Ga0495587_0090427 Ga0495587_0090427_177_629 150
4 3300046531 Ga0495665_0346210 Ga0495665_0346210_10_474 154
5 3300044684 Ga0466966_0025575 Ga0466966_0025575_2436_2954 158
6 3300046691 Ga0495670_0023783 Ga0495670_0023783_1365_1862 159
7 3300044684 Ga0466966_0166264 Ga0466966_0166264_111_647 161
8 3300044842 Ga0466957_0339849 Ga0466957_0339849_356_847 163
9 3300046506 Ga0495583_0037657 Ga0495583_0037657_90_590 163
10 3300046519 Ga0495632_0000245 Ga0495632_0000245_39185_39679 163
11 3300046528 Ga0495642_0171248 Ga0495642_0171248_253_753 163
12 3300046665 Ga0495661_0009666 Ga0495661_0009666_4988_5482 163
13 3300046810 Ga0495660_0285939 Ga0495660_0285939_42_554 163
14 3300047443 Ga0495687_007344 Ga0495687_007344_5799_6299 163
15 3300047470 Ga0495681_0001240 Ga0495681_0001240_16616_17128 163
16 3300044693 Ga0466961_0107792 Ga0466961_0107792_278_787 165
17 3300046473 Ga0495582_0086321 Ga0495582_0086321_159_656 165
18 3300046500 Ga0495596_0025842 Ga0495596_0025842_42_560 165
19 3300046500 Ga0495596_0057532 Ga0495596_0057532_958_1476 165
20 3300046506 Ga0495583_0020621 Ga0495583_0020621_2341_2847 165
21 3300046507 Ga0495606_0036229 Ga0495606_0036229_1215_1733 165
22 3300046513 Ga0495616_0016391 Ga0495616_0016391_1422_1940 165
23 3300046518 Ga0495631_0008725 Ga0495631_0008725_815_1333 165
24 3300046529 Ga0495652_0058148 Ga0495652_0058148_2756_3253 165
25 3300046531 Ga0495665_0032260 Ga0495665_0032260_1568_2065 165
26 3300046535 Ga0495586_0126855 Ga0495586_0126855_446_943 165
27 3300046616 Ga0495668_0048161 Ga0495668_0048161_631_1128 165
28 3300046616 Ga0495668_0205836 Ga0495668_0205836_415_918 165
29 3300046679 Ga0495623_0059358 Ga0495623_0059358_1656_2153 165
30 3300046684 Ga0495669_0004596 Ga0495669_0004596_199_699 165
31 3300046692 Ga0495671_0004097 Ga0495671_0004097_776_1276 165
32 3300046692 Ga0495671_0149864 Ga0495671_0149864_349_867 165
33 3300046694 Ga0495649_0065880 Ga0495649_0065880_871_1389 165
34 3300046794 Ga0495589_0278269 Ga0495589_0278269_229_747 165
35 3300047315 Ga0495581_0089252 Ga0495581_0089252_1233_1730 165
36 3300047317 Ga0495604_0048251 Ga0495604_0048251_529_1026 165
37 3300047320 Ga0495672_0009993 Ga0495672_0009993_4601_5113 165
38 3300047323 Ga0495683_0057636 Ga0495683_0057636_1124_1642 165
39 3300047444 Ga0495675_0001760 Ga0495675_0001760_6768_7265 165
40 3300047470 Ga0495681_0000515 Ga0495681_0000515_2438_2941 165
41 3300048091 Ga0495626_0061121 Ga0495626_0061121_290_808 165
42 3300049459 Ga0495678_002130 Ga0495678_002130_11338_11856 165
43 3300049460 Ga0495682_0000868 Ga0495682_0000868_5257_5775 165
44 3300046506 Ga0495583_0000942 Ga0495583_0000942_21466_21975 166
45 3300046513 Ga0495616_0004144 Ga0495616_0004144_7810_8319 166
46 3300046518 Ga0495631_0017219 Ga0495631_0017219_562_1074 166
47 3300046519 Ga0495632_0001734 Ga0495632_0001734_1207_1740 166
48 3300046615 Ga0495656_0266431 Ga0495656_0266431_312_821 166
49 3300046692 Ga0495671_0000391 Ga0495671_0000391_959_1471 166
50 3300046694 Ga0495649_0039004 Ga0495649_0039004_248_760 166
51 3300046810 Ga0495660_0005051 Ga0495660_0005051_5778_6311 166
52 3300047445 Ga0495677_0220368 Ga0495677_0220368_124_624 166
53 3300047470 Ga0495681_0057495 Ga0495681_0057495_900_1436 166
54 3300049459 Ga0495678_002172 Ga0495678_002172_532_1065 166
55 3300046665 Ga0495661_0065096 Ga0495661_0065096_1436_1975 167
56 3300046691 Ga0495670_0168011 Ga0495670_0168011_38_580 167
57 iso_pu_bacteria 2643221556 2643802691 167
58 iso_pu_bacteria 2643221684 2644472196 167
59 3300046463 Ga0495653_0083139 Ga0495653_0083139_1167_1685 168
60 3300046500 Ga0495596_0000468 Ga0495596_0000468_1645_2157 168
61 3300046500 Ga0495596_0001323 Ga0495596_0001323_6491_7009 168
62 3300046506 Ga0495583_0028163 Ga0495583_0028163_1994_2506 168
63 3300046616 Ga0495668_0090833 Ga0495668_0090833_430_948 168
64 3300046660 Ga0495625_0237834 Ga0495625_0237834_290_802 168
65 3300046694 Ga0495649_0033762 Ga0495649_0033762_487_1008 168
66 3300048088 Ga0495602_0035204 Ga0495602_0035204_1460_1978 168
67 3300046457 Ga0495590_0019234 Ga0495590_0019234_169_678 169
68 3300046500 Ga0495596_0009241 Ga0495596_0009241_2219_2728 169
69 3300046542 Ga0495597_0000619 Ga0495597_0000619_5600_6109 169
70 3300046794 Ga0495589_0002942 Ga0495589_0002942_4880_5389 169
71 3300047443 Ga0495687_000791 Ga0495687_000791_22345_22854 169
72 3300048909 Ga0496106_0015670 Ga0496106_0015670_2885_3394 169
73 3300037312 Ga0395899_0033635 Ga0395899_0033635_2397_2909 170
74 3300037312 Ga0395899_0555426 Ga0395899_0555426_102_614 170
75 3300037418 Ga0395900_0161433 Ga0395900_0161433_941_1453 170
76 3300037466 Ga0395898_0139441 Ga0395898_0139441_1681_2193 170
77 3300037466 Ga0395898_0163291 Ga0395898_0163291_1083_1595 170
78 3300038443 Ga0395901_1038169 Ga0395901_1038169_227_739 170
79 3300046452 Ga0495617_113534 Ga0495617_113534_164_679 170
80 3300046453 Ga0495627_000226 Ga0495627_000226_26679_27191 170
81 3300046455 Ga0495603_0083119 Ga0495603_0083119_884_1396 170
82 3300046457 Ga0495590_0126487 Ga0495590_0126487_75_590 170
83 3300046474 Ga0495605_0000226 Ga0495605_0000226_21332_21844 170
84 3300046474 Ga0495605_0014323 Ga0495605_0014323_17_529 170
85 3300046492 Ga0495585_0061388 Ga0495585_0061388_116_628 170
86 3300046500 Ga0495596_0002705 Ga0495596_0002705_2793_3305 170
87 3300046501 Ga0495607_0007215 Ga0495607_0007215_5557_6069 170
88 3300046501 Ga0495607_0148185 Ga0495607_0148185_445_960 170
89 3300046506 Ga0495583_0012864 Ga0495583_0012864_3498_4013 170
90 3300046513 Ga0495616_0000398 Ga0495616_0000398_17043_17555 170
91 3300046513 Ga0495616_0001144 Ga0495616_0001144_4773_5285 170
92 3300046513 Ga0495616_0059827 Ga0495616_0059827_507_1022 170
93 3300046518 Ga0495631_0001305 Ga0495631_0001305_1678_2190 170
94 3300046518 Ga0495631_0028925 Ga0495631_0028925_1374_1886 170
95 3300046519 Ga0495632_0000244 Ga0495632_0000244_29272_29784 170
96 3300046519 Ga0495632_0046758 Ga0495632_0046758_890_1405 170
97 3300046520 Ga0495637_0029617 Ga0495637_0029617_1763_2278 170
98 3300046520 Ga0495637_0090864 Ga0495637_0090864_638_1153 170
99 3300046522 Ga0495643_0033077 Ga0495643_0033077_1916_2431 170
100 3300046523 Ga0495644_0013019 Ga0495644_0013019_946_1458 170
101 3300046524 Ga0495648_0006225 Ga0495648_0006225_8088_8600 170
102 3300046524 Ga0495648_0019198 Ga0495648_0019198_1269_1784 170
103 3300046524 Ga0495648_0068887 Ga0495648_0068887_1410_1925 170
104 3300046528 Ga0495642_0000147 Ga0495642_0000147_12975_13487 170
105 3300046528 Ga0495642_0001895 Ga0495642_0001895_258_770 170
106 3300046528 Ga0495642_0155926 Ga0495642_0155926_112_627 170
107 3300046530 Ga0495654_0008511 Ga0495654_0008511_1571_2086 170
108 3300046530 Ga0495654_0046617 Ga0495654_0046617_598_1110 170
109 3300046530 Ga0495654_0048410 Ga0495654_0048410_353_865 170
110 3300046538 Ga0495609_0002556 Ga0495609_0002556_4040_4552 170
111 3300046538 Ga0495609_0006729 Ga0495609_0006729_953_1468 170
112 3300046538 Ga0495609_0012308 Ga0495609_0012308_898_1410 170
113 3300046538 Ga0495609_0063036 Ga0495609_0063036_765_1280 170
114 3300046616 Ga0495668_0001789 Ga0495668_0001789_11607_12119 170
115 3300046648 Ga0495611_0054560 Ga0495611_0054560_1162_1674 170
116 3300046660 Ga0495625_0016178 Ga0495625_0016178_424_939 170
117 3300046665 Ga0495661_0071487 Ga0495661_0071487_548_1063 170
118 3300046665 Ga0495661_0075319 Ga0495661_0075319_326_841 170
119 3300046674 Ga0495588_0024917 Ga0495588_0024917_1506_2018 170
120 3300046684 Ga0495669_0056605 Ga0495669_0056605_255_767 170
121 3300046691 Ga0495670_0006442 Ga0495670_0006442_4901_5431 170
122 3300046692 Ga0495671_0038984 Ga0495671_0038984_1339_1854 170
123 3300046810 Ga0495660_0033025 Ga0495660_0033025_1879_2391 170
124 3300046810 Ga0495660_0359716 Ga0495660_0359716_109_624 170
125 3300047445 Ga0495677_0002879 Ga0495677_0002879_2379_2891 170
126 3300047446 Ga0495679_001841 Ga0495679_001841_6402_6917 170
127 3300047447 Ga0495685_007985 Ga0495685_007985_1521_2036 170
128 3300047470 Ga0495681_0000205 Ga0495681_0000205_23190_23702 170
129 3300047470 Ga0495681_0015597 Ga0495681_0015597_1522_2037 170
130 3300047472 Ga0495686_0222996 Ga0495686_0222996_528_1040 170
131 3300048091 Ga0495626_0071148 Ga0495626_0071148_50_565 170
132 3300049459 Ga0495678_000844 Ga0495678_000844_20192_20707 170
133 3300049460 Ga0495682_0025703 Ga0495682_0025703_877_1392 170
134 3300005262 Ga0065165_1018187 Ga0065165_10181873 171
135 3300013307 Ga0157372_10276882 Ga0157372_102768822 171
136 3300037312 Ga0395899_0167245 Ga0395899_0167245_83_610 171
137 3300037312 Ga0395899_0174640 Ga0395899_0174640_12_551 171
138 3300037418 Ga0395900_0067567 Ga0395900_0067567_1724_2245 171
139 3300037418 Ga0395900_0175862 Ga0395900_0175862_1422_1937 171
140 3300037418 Ga0395900_0251962 Ga0395900_0251962_1154_1693 171
141 3300037418 Ga0395900_1108736 Ga0395900_1108736_108_635 171
142 3300037466 Ga0395898_0093847 Ga0395898_0093847_74_613 171
143 3300037466 Ga0395898_0194941 Ga0395898_0194941_1087_1608 171
144 3300037466 Ga0395898_0480844 Ga0395898_0480844_74_601 171
145 3300037466 Ga0395898_0709614 Ga0395898_0709614_356_877 171
146 3300037471 Ga0395905_0043380 Ga0395905_0043380_2717_3238 171
147 3300037471 Ga0395905_0267477 Ga0395905_0267477_719_1240 171
148 3300037471 Ga0395905_0494854 Ga0395905_0494854_140_667 171
149 3300038443 Ga0395901_0286153 Ga0395901_0286153_538_1077 171
150 3300038443 Ga0395901_0463729 Ga0395901_0463729_446_967 171
151 3300038443 Ga0395901_0477881 Ga0395901_0477881_128_649 171
152 3300046492 Ga0495585_0006039 Ga0495585_0006039_6317_6832 171
153 3300046492 Ga0495585_0018567 Ga0495585_0018567_520_1038 171
154 3300046500 Ga0495596_0013999 Ga0495596_0013999_2259_2774 171
155 3300046506 Ga0495583_0198359 Ga0495583_0198359_154_672 171
156 3300046518 Ga0495631_0038258 Ga0495631_0038258_1129_1644 171
157 3300046523 Ga0495644_0022611 Ga0495644_0022611_1076_1591 171
158 3300046528 Ga0495642_0001211 Ga0495642_0001211_7776_8294 171
159 3300046615 Ga0495656_0032616 Ga0495656_0032616_662_1219 171
160 3300046648 Ga0495611_0001244 Ga0495611_0001244_6322_6837 171
161 3300046674 Ga0495588_0269060 Ga0495588_0269060_115_630 171
162 3300046684 Ga0495669_0010637 Ga0495669_0010637_2249_2764 171
163 3300046691 Ga0495670_0202684 Ga0495670_0202684_338_856 171
164 3300046810 Ga0495660_0033510 Ga0495660_0033510_1817_2332 171
165 3300048091 Ga0495626_0023648 Ga0495626_0023648_266_781 171
166 3300048091 Ga0495626_0036171 Ga0495626_0036171_802_1317 171
167 3300048906 Ga0496103_0091117 Ga0496103_0091117_592_1113 171
168 3300048909 Ga0496106_0011792 Ga0496106_0011792_5100_5621 171
169 3300048910 Ga0496107_0035202 Ga0496107_0035202_19_540 171
170 3300048925 Ga0496122_0313494 Ga0496122_0313494_263_799 171
171 3300048927 Ga0496124_0027268 Ga0496124_0027268_634_1149 171
172 3300048927 Ga0496124_0034444 Ga0496124_0034444_1039_1575 171
173 3300048928 Ga0496125_0126007 Ga0496125_0126007_853_1368 171
174 iso_pu_bacteria 8047673197 8047675305 171
175 3300005262 Ga0065165_1001666 Ga0065165_10016664 172
176 3300005564 Ga0070664_100785502 Ga0070664_1007855022 172
177 3300013307 Ga0157372_10132207 Ga0157372_101322072 172
178 3300046513 Ga0495616_0013458 Ga0495616_0013458_1009_1530 172
179 3300046513 Ga0495616_0079933 Ga0495616_0079933_461_982 172
180 3300046518 Ga0495631_0025206 Ga0495631_0025206_2080_2601 172
181 3300046518 Ga0495631_0029702 Ga0495631_0029702_137_658 172
182 3300046528 Ga0495642_0055172 Ga0495642_0055172_688_1209 172
183 3300046531 Ga0495665_0005470 Ga0495665_0005470_5236_5784 172
184 3300046533 Ga0495640_0068693 Ga0495640_0068693_42_563 172
185 3300046543 Ga0495645_0226465 Ga0495645_0226465_243_761 172
186 3300046616 Ga0495668_0041268 Ga0495668_0041268_409_930 172
187 3300046648 Ga0495611_0295925 Ga0495611_0295925_132_653 172
188 3300046665 Ga0495661_0028413 Ga0495661_0028413_2862_3383 172
189 3300046674 Ga0495588_0084615 Ga0495588_0084615_208_729 172
190 3300046674 Ga0495588_0313132 Ga0495588_0313132_101_634 172
191 3300046674 Ga0495588_0358086 Ga0495588_0358086_148_681 172
192 3300046691 Ga0495670_0012002 Ga0495670_0012002_1550_2071 172
193 3300047317 Ga0495604_0024420 Ga0495604_0024420_2378_2926 172
194 3300047323 Ga0495683_0031658 Ga0495683_0031658_2004_2525 172
195 3300047323 Ga0495683_0033514 Ga0495683_0033514_158_679 172
196 3300047445 Ga0495677_0050831 Ga0495677_0050831_801_1322 172
197 3300047470 Ga0495681_0033002 Ga0495681_0033002_1700_2221 172
198 3300048091 Ga0495626_0013199 Ga0495626_0013199_1738_2274 172
199 3300048918 Ga0496115_0014528 Ga0496115_0014528_4830_5363 172
200 3300003322 rootL2_10024406 rootL2_100244064 173
201 3300003759 Ga0055525_1000029 Ga0055525_1000029278 173
202 3300005327 Ga0070658_10286725 Ga0070658_102867252 173
203 3300005336 Ga0070680_100423458 Ga0070680_1004234581 173
204 3300005339 Ga0070660_100239537 Ga0070660_1002395372 173
205 3300005366 Ga0070659_100034061 Ga0070659_1000340614 173
206 3300025230 Ga0209563_100003 Ga0209563_100003441 173
207 3300025253 Ga0209677_106113 Ga0209677_1061133 173
208 3300025917 Ga0207660_10430994 Ga0207660_104309942 173
209 3300025919 Ga0207657_10004691 Ga0207657_100046916 173
210 3300025932 Ga0207690_10240817 Ga0207690_102408172 173
211 3300037312 Ga0395899_0020070 Ga0395899_0020070_1208_1729 173
212 3300037418 Ga0395900_0000263 Ga0395900_0000263_13213_13734 173
213 3300037418 Ga0395900_0087668 Ga0395900_0087668_1029_1550 173
214 3300037471 Ga0395905_0508967 Ga0395905_0508967_238_759 173
215 3300038443 Ga0395901_0114131 Ga0395901_0114131_102_623 173
216 3300038443 Ga0395901_0121638 Ga0395901_0121638_513_1034 173
217 3300047673 Ga0495593_0094546 Ga0495593_0094546_934_1455 173
218 3300048905 Ga0496102_0006994 Ga0496102_0006994_2260_2781 173
219 3300048906 Ga0496103_0055619 Ga0496103_0055619_174_695 173
220 3300048914 Ga0496111_0173095 Ga0496111_0173095_435_971 173
221 3300048925 Ga0496122_0014301 Ga0496122_0014301_1489_2010 173
222 3300048928 Ga0496125_0103967 Ga0496125_0103967_154_675 173
223 3300044658 Ga0466972_0000906 Ga0466972_0000906_3388_3912 174
224 3300044683 Ga0466965_0002591 Ga0466965_0002591_6267_6791 174
225 3300044706 Ga0466964_0012573 Ga0466964_0012573_820_1344 174
226 3300044735 Ga0466968_0016307 Ga0466968_0016307_2295_2819 174
227 3300044842 Ga0466957_0167057 Ga0466957_0167057_138_662 174
228 3300044901 Ga0466960_0028395 Ga0466960_0028395_222_746 174
229 3300046474 Ga0495605_0008635 Ga0495605_0008635_3393_3929 174
230 3300046492 Ga0495585_0076110 Ga0495585_0076110_138_677 174
231 3300046501 Ga0495607_0006293 Ga0495607_0006293_3648_4187 174
232 3300046506 Ga0495583_0000308 Ga0495583_0000308_16672_17211 174
233 3300046507 Ga0495606_0191306 Ga0495606_0191306_598_1137 174
234 3300046513 Ga0495616_0010403 Ga0495616_0010403_4711_5250 174
235 3300046522 Ga0495643_0053828 Ga0495643_0053828_52_579 174
236 3300046523 Ga0495644_0060672 Ga0495644_0060672_21_560 174
237 3300046523 Ga0495644_0206734 Ga0495644_0206734_108_647 174
238 3300046538 Ga0495609_0050645 Ga0495609_0050645_424_963 174
239 3300046558 Ga0495633_0007019 Ga0495633_0007019_985_1524 174
240 3300046616 Ga0495668_0017345 Ga0495668_0017345_3528_4067 174
241 3300046648 Ga0495611_0002508 Ga0495611_0002508_4674_5213 174
242 3300046665 Ga0495661_0014111 Ga0495661_0014111_3639_4178 174
243 3300046684 Ga0495669_0022220 Ga0495669_0022220_437_976 174
244 3300046694 Ga0495649_0003748 Ga0495649_0003748_7860_8399 174
245 3300046694 Ga0495649_0033020 Ga0495649_0033020_2197_2736 174
246 3300046794 Ga0495589_0052531 Ga0495589_0052531_848_1387 174
247 3300046794 Ga0495589_0242961 Ga0495589_0242961_266_805 174
248 3300046810 Ga0495660_0024973 Ga0495660_0024973_132_671 174
249 3300047320 Ga0495672_0281661 Ga0495672_0281661_121_645 174
250 3300047323 Ga0495683_0004309 Ga0495683_0004309_7395_7934 174
251 3300047445 Ga0495677_0001836 Ga0495677_0001836_6266_6805 174
252 3300047446 Ga0495679_006124 Ga0495679_006124_4561_5100 174
253 3300047446 Ga0495679_131011 Ga0495679_131011_25_549 174
254 3300047447 Ga0495685_233762 Ga0495685_233762_12_539 174
255 3300047470 Ga0495681_0013658 Ga0495681_0013658_4024_4563 174
256 3300048091 Ga0495626_0005340 Ga0495626_0005340_1037_1576 174
257 3300048091 Ga0495626_0015566 Ga0495626_0015566_3157_3696 174
258 3300048091 Ga0495626_0019180 Ga0495626_0019180_200_727 174
259 3300048091 Ga0495626_0203327 Ga0495626_0203327_234_761 174
260 3300049459 Ga0495678_005492 Ga0495678_005492_3616_4155 174
261 3300003322 rootL2_10021872 rootL2_100218724 175
262 3300025949 Ga0207667_10196575 Ga0207667_101965752 175
263 3300031548 Ga0307408_100295313 Ga0307408_1002953132 175
264 3300037418 Ga0395900_0724152 Ga0395900_0724152_230_778 175
265 3300044658 Ga0466972_0106588 Ga0466972_0106588_574_1110 175
266 3300044684 Ga0466966_0037989 Ga0466966_0037989_313_852 175
267 3300044684 Ga0466966_0103787 Ga0466966_0103787_827_1363 175
268 3300044684 Ga0466966_0311910 Ga0466966_0311910_88_615 175
269 3300044693 Ga0466961_0195506 Ga0466961_0195506_320_859 175
270 3300044693 Ga0466961_0260531 Ga0466961_0260531_138_674 175
271 3300044694 Ga0466963_0539660 Ga0466963_0539660_133_675 175
272 3300044719 Ga0466971_0157511 Ga0466971_0157511_77_634 175
273 3300044719 Ga0466971_0381289 Ga0466971_0381289_56_592 175
274 3300044765 Ga0466970_0374814 Ga0466970_0374814_103_630 175
275 3300045049 Ga0466959_0048918 Ga0466959_0048918_618_1157 175
276 3300045049 Ga0466959_0102041 Ga0466959_0102041_1008_1565 175
277 3300045836 Ga0466958_0263305 Ga0466958_0263305_221_757 175
278 3300046457 Ga0495590_0033659 Ga0495590_0033659_1171_1740 175
279 3300046474 Ga0495605_0000183 Ga0495605_0000183_62050_62619 175
280 3300046501 Ga0495607_0001538 Ga0495607_0001538_417_986 175
281 3300046501 Ga0495607_0003691 Ga0495607_0003691_10709_11320 175
282 3300046506 Ga0495583_0002703 Ga0495583_0002703_6352_6891 175
283 3300046507 Ga0495606_0042807 Ga0495606_0042807_1874_2419 175
284 3300046507 Ga0495606_0137688 Ga0495606_0137688_796_1323 175
285 3300046513 Ga0495616_0000560 Ga0495616_0000560_11546_12085 175
286 3300046513 Ga0495616_0006903 Ga0495616_0006903_3629_4240 175
287 3300046513 Ga0495616_0104579 Ga0495616_0104579_267_815 175
288 3300046522 Ga0495643_0000247 Ga0495643_0000247_11849_12388 175
289 3300046522 Ga0495643_0003748 Ga0495643_0003748_8301_8870 175
290 3300046522 Ga0495643_0021028 Ga0495643_0021028_644_1255 175
291 3300046524 Ga0495648_0012035 Ga0495648_0012035_3588_4199 175
292 3300046528 Ga0495642_0031146 Ga0495642_0031146_228_839 175
293 3300046542 Ga0495597_0044536 Ga0495597_0044536_11_550 175
294 3300046542 Ga0495597_0066491 Ga0495597_0066491_559_1128 175
295 3300046615 Ga0495656_0027568 Ga0495656_0027568_298_837 175
296 3300046665 Ga0495661_0088435 Ga0495661_0088435_377_988 175
297 3300046665 Ga0495661_0162671 Ga0495661_0162671_436_1005 175
298 3300046674 Ga0495588_0000078 Ga0495588_0000078_130596_131135 175
299 3300046794 Ga0495589_0000118 Ga0495589_0000118_2125_2694 175
300 3300046810 Ga0495660_0000070 Ga0495660_0000070_97665_98234 175
301 3300047320 Ga0495672_0002603 Ga0495672_0002603_5418_5987 175
302 3300047323 Ga0495683_0031899 Ga0495683_0031899_1601_2170 175
303 3300047443 Ga0495687_000396 Ga0495687_000396_27731_28276 175
304 3300047443 Ga0495687_002304 Ga0495687_002304_11847_12416 175
305 3300047445 Ga0495677_0008693 Ga0495677_0008693_146_715 175
306 3300048091 Ga0495626_0000028 Ga0495626_0000028_98424_98993 175
307 3300048091 Ga0495626_0018870 Ga0495626_0018870_1243_1782 175
308 3300048905 Ga0496102_0154783 Ga0496102_0154783_179_712 175
309 3300048911 Ga0496108_0132444 Ga0496108_0132444_856_1410 175
310 3300048925 Ga0496122_0032781 Ga0496122_0032781_2519_3052 175
311 3300048926 Ga0496123_0014885 Ga0496123_0014885_3531_4064 175
312 3300061719 Ga0466962_0124012 Ga0466962_0124012_317_853 175
313 3300061719 Ga0466962_0126344 Ga0466962_0126344_511_1050 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

23

154

0.77

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

13

139

0.75

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

49

141

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v8h-assembly1.cif.gz_D crystal structure of thymidylate synthase from burkholderia thailandensis 0.8706 120 161
3v8h-assembly2.cif.gz_C crystal structure of thymidylate synthase from burkholderia thailandensis 0.8618 120 161
3v8h-assembly1.cif.gz_A crystal structure of thymidylate synthase from burkholderia thailandensis 0.8595 120 161
4pv6-assembly8.cif.gz_N crystal structure analysis of ard1 from thermoplasma volcanium 0.8566 3 161
1tiq-assembly1.cif.gz_A crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.8541 3 161
ID Description Score Start End Superfamily
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9287 54 148 3.40.630.30
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.911 103 161 3.40.630.30
af_K7VFD8_74_198_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.873 59 161 3.40.630.30
af_E7EZI9_69_205_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8687 51 147 3.40.630.30
3v8hC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.8617 120 161 3.30.572.10
ID Description Score Start End GO Terms
AF-A0A4P6P1B6-F1-model_v4 GNAT family N-acetyltransferase 0.9784 4 161 GO:0008080
AF-A0A7Y7NPX0-F1-model_v4 GNAT family N-acetyltransferase 0.9498 42 161 GO:0008080
AF-A0A7W4VNE5-F1-model_v4 Ribosomal protein S18 acetylase RimI-like enzyme 0.9423 4 161 GO:0005840
GO:0016747
AF-A0A4P6P1B6-F1-model_v4 GNAT family N-acetyltransferase 0.9376 4 161 GO:0008080
AF-A0A327W8R5-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9346 1 161 GO:0016747

Feature Viewer

pLDDT pTM Quality
95.7 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map