F402256

General Info

Members Datasets Scaffolds Average Seq Length
313 197 626 187

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100127780|Ga0307409_1001277802
Length 211
Sequence MTTTGDAPDGAGAEAGPAGAGRLAPLPPDRWPPGMKGALAALRPENPRHPYPSRAPGRPKGLNVLGMLALHPELARAFHTVNGPVLFATSLTVRQRELLVLRVAARRDAEYEWRQHVVLAGDAGIDAADVARIGAGPDAPGWSPLEAALVRAADELVADAMIGDATWAVLAAELDEHQLMDLVFTVGAYDVLAMALKSFGIALDDDLRHRD

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
67 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
68 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
71 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
72 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
76 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
77 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
78 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
80 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
81 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
85 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
98 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
99 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
100 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
109 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
110 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
111 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
112 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
125 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
167 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
168 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
171 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
172 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
173 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
174 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
175 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
176 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
177 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
178 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
179 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
180 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
181 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
182 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
183 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
184 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
185 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
186 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
187 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
188 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
192 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
193 2671180195 Frankia sp. CcI49 Isolate Nodule
194 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
195 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
196 2773857922 Frankia sp. CcI49 Isolate Nodule
197 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.81
Metatranscriptomes 0.32
Isolates 2.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.86
Nodule 1.28
Rhizoplane 2.56
Rhizosphere 79.23
Stem 0
Stem Tuber 0
Unclassified 3.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100127780 3300031995 Bacteria 2166
2 Ga0070676_10477574 3300005328 Bacteria 881
3 Ga0070683_100432435 3300005329 Bacteria 1256
4 Ga0070680_100000092 3300005336 Bacteria 50891
5 Ga0068868_100182480 3300005338 Bacteria 1742
6 Ga0070675_100320528 3300005354 Bacteria 1369
7 Ga0070713_100015776 3300005436 Bacteria 5661
8 Ga0070710_10030789 3300005437 Bacteria 2890
9 Ga0070711_100101364 3300005439 Bacteria 2095
10 Ga0070700_100469839 3300005441 Bacteria 961
11 Ga0070708_100258923 3300005445 Bacteria 1635
12 Ga0070708_100877204 3300005445 Bacteria 843
13 Ga0070678_100312600 3300005456 Bacteria 1339
14 Ga0070681_10000054 3300005458 Bacteria 80396
15 Ga0070706_100124771 3300005467 Bacteria 2400
16 Ga0070707_100048260 3300005468 Bacteria 4079
17 Ga0070707_100135759 3300005468 Bacteria 2393
18 Ga0070698_100025810 3300005471 Bacteria 6123
19 Ga0070699_100222202 3300005518 Bacteria 1683
20 Ga0070679_100000022 3300005530 Bacteria 123735
21 Ga0070684_100776106 3300005535 Unclassified 895
22 Ga0070697_100118382 3300005536 Bacteria 2213
23 Ga0070665_100793389 3300005548 Bacteria 960
24 Ga0068861_100417210 3300005719 Bacteria 1195
25 Ga0068860_101570546 3300005843 Bacteria 680
26 Ga0081455_10049587 3300005937 Bacteria 3618
27 Ga0081455_10215530 3300005937 Bacteria 1427
28 Ga0081539_10010865 3300005985 Bacteria 7313
29 Ga0070717_10402928 3300006028 Unclassified 1229
30 Ga0075365_10084881 3300006038 Bacteria 2150
31 Ga0075365_10264498 3300006038 Bacteria 1209
32 Ga0075365_10309484 3300006038 Bacteria 1112
33 Ga0075365_10544142 3300006038 Bacteria 821
34 Ga0075365_10692570 3300006038 Bacteria 720
35 Ga0075363_100297243 3300006048 Bacteria 936
36 Ga0075364_10025818 3300006051 Bacteria 3742
37 Ga0075364_10274864 3300006051 Bacteria 1146
38 Ga0070712_100106578 3300006175 Bacteria 2084
39 Ga0075428_100165208 3300006844 Bacteria 2401
40 Ga0075428_100223118 3300006844 Bacteria 2035
41 Ga0075430_100003076 3300006846 Bacteria 13935
42 Ga0075430_100004383 3300006846 Bacteria 11913
43 Ga0075430_100044420 3300006846 Bacteria 3757
44 Ga0075431_100006998 3300006847 Bacteria 11216
45 Ga0075431_100024926 3300006847 Bacteria 6132
46 Ga0075431_100053743 3300006847 Bacteria 4152
47 Ga0075431_100838574 3300006847 Bacteria 891
48 Ga0075431_100874103 3300006847 Bacteria 869
49 Ga0075429_100008333 3300006880 Bacteria 9018
50 Ga0075429_100016645 3300006880 Bacteria 6368
51 Ga0075429_100157079 3300006880 Bacteria 1991
52 Ga0075429_100341122 3300006880 Unclassified 1312
53 Ga0111539_10004723 3300009094 Bacteria 17802
54 Ga0111539_10240621 3300009094 Bacteria 2107
55 Ga0105245_10742351 3300009098 Bacteria 1017
56 Ga0114129_10003736 3300009147 Bacteria 21460
57 Ga0114129_10032513 3300009147 Bacteria 7372
58 Ga0114129_11569564 3300009147 Bacteria 807
59 Ga0105243_10039507 3300009148 Bacteria 3679
60 Ga0105243_11427877 3300009148 Bacteria 713
61 Ga0105242_10350156 3300009176 Bacteria 1364
62 Ga0105248_11562447 3300009177 Bacteria 747
63 Ga0105239_11538583 3300010375 Bacteria 769
64 Ga0157378_10705924 3300013297 Bacteria 1028
65 Ga0163163_10901974 3300014325 Unclassified 947
66 Ga0206353_11326752 3300020082 Bacteria 1038
67 Ga0207692_10149987 3300025898 Bacteria 1334
68 Ga0207699_10086186 3300025906 Unclassified 1961
69 Ga0207684_10070998 3300025910 Bacteria 2959
70 Ga0207707_10000041 3300025912 Bacteria 130140
71 Ga0207693_10125979 3300025915 Bacteria 2013
72 Ga0207660_10000448 3300025917 Bacteria 27098
73 Ga0207652_10000033 3300025921 Bacteria 139131
74 Ga0207646_10111938 3300025922 Bacteria 2450
75 Ga0207646_10193443 3300025922 Bacteria 1837
76 Ga0207659_10091279 3300025926 Bacteria 2275
77 Ga0207700_10250861 3300025928 Bacteria 1512
78 Ga0207709_10075761 3300025935 Bacteria 2151
79 Ga0207661_10071402 3300025944 Bacteria 2837
80 Ga0207712_10192385 3300025961 Bacteria 1611
81 Ga0207668_10591531 3300025972 Bacteria 966
82 Ga0207677_10058168 3300026023 Bacteria 2660
83 Ga0207708_10606804 3300026075 Bacteria 928
84 Ga0207683_10110810 3300026121 Unclassified 2457
85 Ga0268266_10072759 3300028379 Bacteria 2982
86 Ga0268264_11203785 3300028381 Bacteria 767
87 Ga0307517_10005164 3300028786 Bacteria 19809
88 Ga0307517_10252277 3300028786 Bacteria 1034
89 Ga0265338_10097474 3300028800 Bacteria 2409
90 Ga0307511_10002497 3300030521 Bacteria 19219
91 Ga0307511_10078428 3300030521 Bacteria 2343
92 Ga0307511_10086664 3300030521 Bacteria 2155
93 Ga0307511_10307202 3300030521 Bacteria 711
94 Ga0265327_10007948 3300031251 Bacteria 8027
95 Ga0265327_10016611 3300031251 Bacteria 4664
96 Ga0265327_10043992 3300031251 Bacteria 2384
97 Ga0307509_10034137 3300031507 Bacteria 5591
98 Ga0307508_10097070 3300031616 Bacteria 2539
99 Ga0307508_10249990 3300031616 Bacteria 1369
100 Ga0316576_10038514 3300031727 Bacteria 3429
101 Ga0307516_10048046 3300031730 Bacteria 4201
102 Ga0307518_10103284 3300031838 Bacteria 2038
103 Ga0307411_10126966 3300032005 Bacteria 1857
104 Ga0307415_100191647 3300032126 Bacteria 1614
105 Ga0307507_10000003 3300033179 Bacteria 371707
106 Ga0307507_10008069 3300033179 Bacteria 14818
107 Ga0307510_10002830 3300033180 Bacteria 19918
108 Ga0307510_10027322 3300033180 Bacteria 6539
109 Ga0307510_10035941 3300033180 Bacteria 5522
110 Ga0373934_0008364 3300035086 Bacteria 3856
111 Ga0373936_0093979 3300035113 Bacteria 1259
112 Ga0373954_0064929 3300035118 Bacteria 1727
113 Ga0373960_0178918 3300035121 Unclassified 739
114 Ga0373961_0055020 3300035241 Bacteria 1191
115 Ga0373931_0102125 3300035691 Bacteria 1614
116 Ga0373937_0657509 3300036401 Bacteria 994
117 Ga0451847_0487024 3300041503 Bacteria 776
118 Ga0451853_2337110 3300041512 Unclassified 619
119 Ga0466967_0158905 3300045976 Bacteria 2120
120 Ga0495592_0000605 3300046454 Bacteria 25317
121 Ga0495592_0104314 3300046454 Bacteria 2016
122 Ga0495592_0477987 3300046454 Bacteria 776
123 Ga0495629_0064868 3300046459 Bacteria 2549
124 Ga0495651_0002697 3300046462 Bacteria 13778
125 Ga0495651_0003594 3300046462 Bacteria 11899
126 Ga0495651_0005442 3300046462 Bacteria 9713
127 Ga0495651_0536522 3300046462 Bacteria 745
128 Ga0495653_0020397 3300046463 Bacteria 5373
129 Ga0495653_0022970 3300046463 Bacteria 5043
130 Ga0495653_0156709 3300046463 Bacteria 1585
131 Ga0495653_0265866 3300046463 Bacteria 1132
132 Ga0495662_0002868 3300046476 Bacteria 8721
133 Ga0495662_0034052 3300046476 Bacteria 2460
134 Ga0495664_0002788 3300046477 Bacteria 9401
135 Ga0495664_0039766 3300046477 Bacteria 2779
136 Ga0495664_0331003 3300046477 Bacteria 918
137 Ga0495608_0014064 3300046511 Bacteria 5554
138 Ga0495608_0060042 3300046511 Bacteria 2503
139 Ga0495618_0206074 3300046514 Bacteria 1244
140 Ga0495618_0378717 3300046514 Bacteria 868
141 Ga0495628_0033593 3300046516 Bacteria 4132
142 Ga0495628_0054437 3300046516 Bacteria 3155
143 Ga0495628_0254344 3300046516 Bacteria 1310
144 Ga0495630_0013656 3300046517 Bacteria 5905
145 Ga0495630_0123001 3300046517 Bacteria 1968
146 Ga0495632_0063931 3300046519 Bacteria 1781
147 Ga0495666_0078861 3300046526 Bacteria 1560
148 Ga0495652_0003628 3300046529 Bacteria 15113
149 Ga0495652_0063877 3300046529 Bacteria 3099
150 Ga0495652_0408761 3300046529 Bacteria 959
151 Ga0495665_0008618 3300046531 Bacteria 5534
152 Ga0495640_0088029 3300046533 Bacteria 2053
153 Ga0495640_0105402 3300046533 Bacteria 1847
154 Ga0495640_0147611 3300046533 Bacteria 1512
155 Ga0495640_0164174 3300046533 Bacteria 1421
156 Ga0495586_0008310 3300046535 Bacteria 5526
157 Ga0495586_0024684 3300046535 Bacteria 3215
158 Ga0495587_0003871 3300046536 Bacteria 9932
159 Ga0495587_0006043 3300046536 Bacteria 7894
160 Ga0495587_0018966 3300046536 Bacteria 4263
161 Ga0495587_0103460 3300046536 Bacteria 1639
162 Ga0495645_0069321 3300046543 Bacteria 2545
163 Ga0495645_0137799 3300046543 Bacteria 1705
164 Ga0495667_0033435 3300046559 Bacteria 3441
165 Ga0495667_0096795 3300046559 Bacteria 1910
166 Ga0495667_0395604 3300046559 Bacteria 870
167 Ga0495634_0019867 3300046642 Bacteria 4768
168 Ga0495634_0109467 3300046642 Bacteria 1777
169 Ga0495635_0000692 3300046663 Bacteria 21712
170 Ga0495635_0048536 3300046663 Bacteria 2926
171 Ga0495635_0125866 3300046663 Bacteria 1747
172 Ga0495659_0373239 3300046664 Bacteria 612
173 Ga0495657_0000085 3300046675 Bacteria 82569
174 Ga0495657_0010543 3300046675 Bacteria 6948
175 Ga0495657_0022382 3300046675 Bacteria 4528
176 Ga0495657_0175318 3300046675 Bacteria 1318
177 Ga0495599_0089531 3300046678 Bacteria 1920
178 Ga0495599_0131785 3300046678 Bacteria 1552
179 Ga0495623_0028661 3300046679 Bacteria 3582
180 Ga0495623_0083082 3300046679 Bacteria 1978
181 Ga0495623_0083085 3300046679 Bacteria 1978
182 Ga0495623_0306989 3300046679 Bacteria 875
183 Ga0495646_0003149 3300046680 Bacteria 10241
184 Ga0495646_0010406 3300046680 Bacteria 5914
185 Ga0495658_0183602 3300046683 Bacteria 1298
186 Ga0495613_0000645 3300046689 Bacteria 27674
187 Ga0495613_0000649 3300046689 Bacteria 27637
188 Ga0495613_0012663 3300046689 Bacteria 6270
189 Ga0495670_0006912 3300046691 Bacteria 5588
190 Ga0495600_0002414 3300046809 Bacteria 10711
191 Ga0495600_0028551 3300046809 Bacteria 3610
192 Ga0495600_0190589 3300046809 Bacteria 1318
193 Ga0495660_0099725 3300046810 Bacteria 1497
194 Ga0495604_0013674 3300047317 Bacteria 6472
195 Ga0495604_0024065 3300047317 Bacteria 4861
196 Ga0495604_0490180 3300047317 Bacteria 798
197 Ga0495674_0011897 3300047319 Bacteria 8202
198 Ga0495674_0221362 3300047319 Bacteria 1564
199 Ga0495676_0000632 3300047321 Bacteria 29176
200 Ga0495680_0005985 3300047322 Bacteria 11373
201 Ga0495687_001483 3300047443 Bacteria 21445
202 Ga0495687_087855 3300047443 Bacteria 1198
203 Ga0495675_0002048 3300047444 Bacteria 12057
204 Ga0495675_0070325 3300047444 Bacteria 2209
205 Ga0495675_0255776 3300047444 Bacteria 1050
206 Ga0495679_051779 3300047446 Bacteria 1230
207 Ga0495685_008124 3300047447 Bacteria 3476
208 Ga0495684_0026677 3300047471 Bacteria 4439
209 Ga0495684_0155272 3300047471 Bacteria 1709
210 Ga0495686_0192726 3300047472 Bacteria 1174
211 Ga0495593_0002170 3300047673 Bacteria 11734
212 Ga0495593_0010330 3300047673 Bacteria 5397
213 Ga0495602_0084023 3300048088 Bacteria 2664
214 Ga0495602_0143123 3300048088 Bacteria 1890
215 Ga0495602_0156155 3300048088 Bacteria 1786
216 Ga0495614_0007916 3300048089 Bacteria 4723
217 Ga0496100_0006339 3300048903 Bacteria 6446
218 Ga0496102_0066942 3300048905 Bacteria 3293
219 Ga0496104_0048727 3300048907 Bacteria 3994
220 Ga0496106_0072505 3300048909 Bacteria 2634
221 Ga0496109_0512430 3300048912 Unclassified 1132
222 Ga0496110_0636180 3300048913 Unclassified 966
223 Ga0496114_0039703 3300048917 Bacteria 3895
224 Ga0496115_0001291 3300048918 Bacteria 17897
225 Ga0501033_0007631 3300049570 Bacteria 8408
226 Ga0501034_0423219 3300049571 Bacteria 1252
227 Ga0501037_0481249 3300049573 Bacteria 844
228 Ga0501039_0355329 3300049575 Bacteria 1151
229 Ga0501042_0177751 3300049578 Bacteria 1535
230 Ga0501046_0100561 3300049580 Bacteria 2219
231 Ga0501069_0012342 3300049585 Bacteria 4540
232 Ga0501070_0023935 3300049586 Bacteria 5118
233 Ga0501071_0016840 3300049587 Bacteria 5029
234 Ga0501071_0379676 3300049587 Bacteria 1077
235 Ga0501072_0063748 3300049588 Bacteria 2907
236 Ga0501072_0101806 3300049588 Bacteria 2283
237 Ga0501073_0002770 3300049589 Bacteria 13128
238 Ga0501073_0181429 3300049589 Bacteria 1457
239 Ga0501074_0216317 3300049590 Bacteria 1365
240 Ga0501074_0355433 3300049590 Bacteria 1040
241 Ga0501075_0196472 3300049591 Bacteria 1538
242 Ga0501076_0024054 3300049592 Bacteria 4704
243 Ga0501079_0004950 3300049741 Bacteria 9877
244 Ga0501079_0054118 3300049741 Bacteria 3095
245 Ga0501080_0192671 3300049742 Bacteria 1873
246 Ga0501080_0256041 3300049742 Bacteria 1595
247 Ga0501083_0000364 3300049744 Bacteria 28777
248 Ga0501083_0001980 3300049744 Bacteria 14085
249 Ga0501083_0231013 3300049744 Bacteria 1205
250 Ga0501044_0153001 3300049823 Bacteria 2288
251 Ga0501044_0206834 3300049823 Bacteria 1919
252 Ga0501045_0004883 3300049824 Bacteria 9284
253 nmdc:mga00v17_2265_c1 3300050491 Bacteria 9863
254 nmdc:mga00v17_296088_c1 3300050491 Bacteria 1051
255 nmdc:mga0yw44_32799_c1 3300050492 Bacteria 2234
256 nmdc:mga0yw44_58732_c1 3300050492 Bacteria 2351
257 nmdc:mga0yw44_83979_c1 3300050492 Bacteria 2001
258 nmdc:mga0yw44_96789_c1 3300050492 Bacteria 1874
259 nmdc:mga05p37_1125327_c1 3300050507 Bacteria 820
260 nmdc:mga05p37_34438_c1 3300050507 Bacteria 6204
261 nmdc:mga09592_33031_c1 3300050508 Bacteria 4317
262 nmdc:mga09592_47279_c1 3300050508 Bacteria 3627
263 nmdc:mga0qj67_283_c1 3300050509 Bacteria 35322
264 nmdc:mga0qj67_89512_c1 3300050509 Bacteria 2472
265 nmdc:mga0qj67_912924_c1 3300050509 Bacteria 692
266 nmdc:mga06r32_136177_c1 3300050510 Bacteria 2431
267 nmdc:mga06r32_229205_c1 3300050510 Bacteria 1846
268 nmdc:mga06r32_301494_c1 3300050510 Bacteria 1588
269 nmdc:mga06r32_5649_c1 3300050510 Bacteria 11252
270 nmdc:mga06r32_855_c1 3300050510 Bacteria 27030
271 nmdc:mga08y16_930344_c1 3300050511 Bacteria 854
272 Ga0495601_0000403 3300053077 Bacteria 22823
273 Ga0495601_0081791 3300053077 Bacteria 2073
274 Ga0495601_0095784 3300053077 Bacteria 1914
275 Ga0495612_0022165 3300053078 Bacteria 2546
276 Ga0495655_0075723 3300053083 Bacteria 951
277 Ga0495595_0003352 3300053084 Bacteria 6357
278 Ga0495619_0204050 3300053085 Bacteria 1369
279 Ga0500647_0216219 3300053091 Bacteria 861
280 Ga0500583_0039600 3300053092 Bacteria 2130
281 Ga0500583_0431836 3300053092 Bacteria 628
282 Ga0500651_0162499 3300053093 Bacteria 1335
283 Ga0500566_0000606 3300053094 Bacteria 20147
284 Ga0500641_0044373 3300053096 Bacteria 1808
285 Ga0500654_050375 3300053099 Bacteria 2249
286 Ga0500560_155192 3300053107 Bacteria 759
287 Ga0500569_051234 3300053109 Bacteria 1246
288 Ga0500582_233183 3300053114 Bacteria 603
289 Ga0500594_0066845 3300053118 Bacteria 1049
290 Ga0500621_145817 3300053126 Bacteria 893
291 Ga0500652_195166 3300053131 Bacteria 823
292 Ga0500561_0092879 3300053137 Bacteria 894
293 Ga0500573_0074912 3300053140 Bacteria 1927
294 Ga0500579_156414 3300053143 Bacteria 976
295 Ga0500600_0049880 3300053149 Bacteria 2377
296 Ga0500634_0023973 3300053161 Bacteria 3317
297 Ga0500656_001206 3300053732 Bacteria 2183
298 Ga0500587_012257 3300053739 Bacteria 1081
299 Ga0501084_0003600 3300054114 Bacteria 12584
300 Ga0501084_0013186 3300054114 Bacteria 6838
301 Ga0501084_0189576 3300054114 Bacteria 1735
302 Ga0501082_0025849 3300060353 Bacteria 5061
303 Ga0501082_0101989 3300060353 Bacteria 2482
304 Ga0530510_0001899 3300061734 Bacteria 14275
305 2585313787 2582581314 Bacteria 11452267
306 2671839601 2671180195 Bacteria 9757215
307 2686536390 2684623035 Bacteria 8032739
308 2686536546 2684623035 Bacteria 8032739
309 2686539602 2684623035 Bacteria 8032739
310 2689991213 2687453743 Bacteria 8361025
311 2689996516 2687453743 Bacteria 8361025
312 2774857757 2773857922 Bacteria 9757215
313 3003006629 3002998708 Bacteria 11715108
314 Ga0307409_100127780
315 Ga0070676_10477574
316 Ga0070683_100432435
317 Ga0070680_100000092
318 Ga0068868_100182480
319 Ga0070675_100320528
320 Ga0070713_100015776
321 Ga0070710_10030789
322 Ga0070711_100101364
323 Ga0070700_100469839
324 Ga0070708_100258923
325 Ga0070708_100877204
326 Ga0070678_100312600
327 Ga0070681_10000054
328 Ga0070706_100124771
329 Ga0070707_100048260
330 Ga0070707_100135759
331 Ga0070698_100025810
332 Ga0070699_100222202
333 Ga0070679_100000022
334 Ga0070684_100776106
335 Ga0070697_100118382
336 Ga0070665_100793389
337 Ga0068861_100417210
338 Ga0068860_101570546
339 Ga0081455_10049587
340 Ga0081455_10215530
341 Ga0081539_10010865
342 Ga0070717_10402928
343 Ga0075365_10084881
344 Ga0075365_10264498
345 Ga0075365_10309484
346 Ga0075365_10544142
347 Ga0075365_10692570
348 Ga0075363_100297243
349 Ga0075364_10025818
350 Ga0075364_10274864
351 Ga0070712_100106578
352 Ga0075428_100165208
353 Ga0075428_100223118
354 Ga0075430_100003076
355 Ga0075430_100004383
356 Ga0075430_100044420
357 Ga0075431_100006998
358 Ga0075431_100024926
359 Ga0075431_100053743
360 Ga0075431_100838574
361 Ga0075431_100874103
362 Ga0075429_100008333
363 Ga0075429_100016645
364 Ga0075429_100157079
365 Ga0075429_100341122
366 Ga0111539_10004723
367 Ga0111539_10240621
368 Ga0105245_10742351
369 Ga0114129_10003736
370 Ga0114129_10032513
371 Ga0114129_11569564
372 Ga0105243_10039507
373 Ga0105243_11427877
374 Ga0105242_10350156
375 Ga0105248_11562447
376 Ga0105239_11538583
377 Ga0157378_10705924
378 Ga0163163_10901974
379 Ga0206353_11326752
380 Ga0207692_10149987
381 Ga0207699_10086186
382 Ga0207684_10070998
383 Ga0207707_10000041
384 Ga0207693_10125979
385 Ga0207660_10000448
386 Ga0207652_10000033
387 Ga0207646_10111938
388 Ga0207646_10193443
389 Ga0207659_10091279
390 Ga0207700_10250861
391 Ga0207709_10075761
392 Ga0207661_10071402
393 Ga0207712_10192385
394 Ga0207668_10591531
395 Ga0207677_10058168
396 Ga0207708_10606804
397 Ga0207683_10110810
398 Ga0268266_10072759
399 Ga0268264_11203785
400 Ga0307517_10005164
401 Ga0307517_10252277
402 Ga0265338_10097474
403 Ga0307511_10002497
404 Ga0307511_10078428
405 Ga0307511_10086664
406 Ga0307511_10307202
407 Ga0265327_10007948
408 Ga0265327_10016611
409 Ga0265327_10043992
410 Ga0307509_10034137
411 Ga0307508_10097070
412 Ga0307508_10249990
413 Ga0316576_10038514
414 Ga0307516_10048046
415 Ga0307518_10103284
416 Ga0307411_10126966
417 Ga0307415_100191647
418 Ga0307507_10000003
419 Ga0307507_10008069
420 Ga0307510_10002830
421 Ga0307510_10027322
422 Ga0307510_10035941
423 Ga0373934_0008364
424 Ga0373936_0093979
425 Ga0373954_0064929
426 Ga0373960_0178918
427 Ga0373961_0055020
428 Ga0373931_0102125
429 Ga0373937_0657509
430 Ga0451847_0487024
431 Ga0451853_2337110
432 Ga0466967_0158905
433 Ga0495592_0000605
434 Ga0495592_0104314
435 Ga0495592_0477987
436 Ga0495629_0064868
437 Ga0495651_0002697
438 Ga0495651_0003594
439 Ga0495651_0005442
440 Ga0495651_0536522
441 Ga0495653_0020397
442 Ga0495653_0022970
443 Ga0495653_0156709
444 Ga0495653_0265866
445 Ga0495662_0002868
446 Ga0495662_0034052
447 Ga0495664_0002788
448 Ga0495664_0039766
449 Ga0495664_0331003
450 Ga0495608_0014064
451 Ga0495608_0060042
452 Ga0495618_0206074
453 Ga0495618_0378717
454 Ga0495628_0033593
455 Ga0495628_0054437
456 Ga0495628_0254344
457 Ga0495630_0013656
458 Ga0495630_0123001
459 Ga0495632_0063931
460 Ga0495666_0078861
461 Ga0495652_0003628
462 Ga0495652_0063877
463 Ga0495652_0408761
464 Ga0495665_0008618
465 Ga0495640_0088029
466 Ga0495640_0105402
467 Ga0495640_0147611
468 Ga0495640_0164174
469 Ga0495586_0008310
470 Ga0495586_0024684
471 Ga0495587_0003871
472 Ga0495587_0006043
473 Ga0495587_0018966
474 Ga0495587_0103460
475 Ga0495645_0069321
476 Ga0495645_0137799
477 Ga0495667_0033435
478 Ga0495667_0096795
479 Ga0495667_0395604
480 Ga0495634_0019867
481 Ga0495634_0109467
482 Ga0495635_0000692
483 Ga0495635_0048536
484 Ga0495635_0125866
485 Ga0495659_0373239
486 Ga0495657_0000085
487 Ga0495657_0010543
488 Ga0495657_0022382
489 Ga0495657_0175318
490 Ga0495599_0089531
491 Ga0495599_0131785
492 Ga0495623_0028661
493 Ga0495623_0083082
494 Ga0495623_0083085
495 Ga0495623_0306989
496 Ga0495646_0003149
497 Ga0495646_0010406
498 Ga0495658_0183602
499 Ga0495613_0000645
500 Ga0495613_0000649
501 Ga0495613_0012663
502 Ga0495670_0006912
503 Ga0495600_0002414
504 Ga0495600_0028551
505 Ga0495600_0190589
506 Ga0495660_0099725
507 Ga0495604_0013674
508 Ga0495604_0024065
509 Ga0495604_0490180
510 Ga0495674_0011897
511 Ga0495674_0221362
512 Ga0495676_0000632
513 Ga0495680_0005985
514 Ga0495687_001483
515 Ga0495687_087855
516 Ga0495675_0002048
517 Ga0495675_0070325
518 Ga0495675_0255776
519 Ga0495679_051779
520 Ga0495685_008124
521 Ga0495684_0026677
522 Ga0495684_0155272
523 Ga0495686_0192726
524 Ga0495593_0002170
525 Ga0495593_0010330
526 Ga0495602_0084023
527 Ga0495602_0143123
528 Ga0495602_0156155
529 Ga0495614_0007916
530 Ga0496100_0006339
531 Ga0496102_0066942
532 Ga0496104_0048727
533 Ga0496106_0072505
534 Ga0496109_0512430
535 Ga0496110_0636180
536 Ga0496114_0039703
537 Ga0496115_0001291
538 Ga0501033_0007631
539 Ga0501034_0423219
540 Ga0501037_0481249
541 Ga0501039_0355329
542 Ga0501042_0177751
543 Ga0501046_0100561
544 Ga0501069_0012342
545 Ga0501070_0023935
546 Ga0501071_0016840
547 Ga0501071_0379676
548 Ga0501072_0063748
549 Ga0501072_0101806
550 Ga0501073_0002770
551 Ga0501073_0181429
552 Ga0501074_0216317
553 Ga0501074_0355433
554 Ga0501075_0196472
555 Ga0501076_0024054
556 Ga0501079_0004950
557 Ga0501079_0054118
558 Ga0501080_0192671
559 Ga0501080_0256041
560 Ga0501083_0000364
561 Ga0501083_0001980
562 Ga0501083_0231013
563 Ga0501044_0153001
564 Ga0501044_0206834
565 Ga0501045_0004883
566 nmdc:mga00v17_2265_c1
567 nmdc:mga00v17_296088_c1
568 nmdc:mga0yw44_32799_c1
569 nmdc:mga0yw44_58732_c1
570 nmdc:mga0yw44_83979_c1
571 nmdc:mga0yw44_96789_c1
572 nmdc:mga05p37_1125327_c1
573 nmdc:mga05p37_34438_c1
574 nmdc:mga09592_33031_c1
575 nmdc:mga09592_47279_c1
576 nmdc:mga0qj67_283_c1
577 nmdc:mga0qj67_89512_c1
578 nmdc:mga0qj67_912924_c1
579 nmdc:mga06r32_136177_c1
580 nmdc:mga06r32_229205_c1
581 nmdc:mga06r32_301494_c1
582 nmdc:mga06r32_5649_c1
583 nmdc:mga06r32_855_c1
584 nmdc:mga08y16_930344_c1
585 Ga0495601_0000403
586 Ga0495601_0081791
587 Ga0495601_0095784
588 Ga0495612_0022165
589 Ga0495655_0075723
590 Ga0495595_0003352
591 Ga0495619_0204050
592 Ga0500647_0216219
593 Ga0500583_0039600
594 Ga0500583_0431836
595 Ga0500651_0162499
596 Ga0500566_0000606
597 Ga0500641_0044373
598 Ga0500654_050375
599 Ga0500560_155192
600 Ga0500569_051234
601 Ga0500582_233183
602 Ga0500594_0066845
603 Ga0500621_145817
604 Ga0500652_195166
605 Ga0500561_0092879
606 Ga0500573_0074912
607 Ga0500579_156414
608 Ga0500600_0049880
609 Ga0500634_0023973
610 Ga0500656_001206
611 Ga0500587_012257
612 Ga0501084_0003600
613 Ga0501084_0013186
614 Ga0501084_0189576
615 Ga0501082_0025849
616 Ga0501082_0101989
617 Ga0530510_0001899
618 2585313787
619 2671839601
620 2686536390
621 2686536546
622 2686539602
623 2689991213
624 2689996516
625 2774857757
626 3003006629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

72

155

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9001 59 189
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.8978 56 192
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.895 56 192
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.8813 59 189
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.8435 56 192
ID Description Score Start End Superfamily
af_O53905_23_180_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9556 51 193 1.20.1290.10
af_O53749_49_187_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.93 61 192 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8979 56 192 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8956 58 183 1.20.1290.10
af_P76222_42_172_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8898 65 192 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A7X7GIN7-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9887 85 192 GO:0051920
AF-A0A836TRR2-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9855 55 193 GO:0051920
AF-A0A0F9TG12-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9836 57 193 GO:0051920
AF-A0A2S8MA71-F1-model_v4 deleted 0.982 59 201
AF-A0A0L8KZW9-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9817 51 193 GO:0051920

Map