F402253

General Info

Members Datasets Scaffolds Average Seq Length
313 214 626 280

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10000083|Ga0307407_100000834
Length 328
Sequence VYGVQFADDDLVAAVATGPEAPCFFFHLRIFRLALGTWPEGAHAPRPRMTTVLEILDGGTRYLEKRGIEDARRNMQHLVAHQLGCTRMELYLRFDQPIEETDLVPLRDVLKRRGEGEPLQHLLGTVWFHQHDFKTDARALIPRPETEELVEMILKFPDLPENARVLDMGCGSGVLGLSLAAARPGWQVILADISPDALALTRENAAKIGLENVELVQSDLFSSIDGSFDLIAANLPYVPESDRPTLTREVQHDPALALFGGDDGLDVIRRFLPQAVEKLRPTGWIALEIGHDQGAHVASLMADAGFTGIEVKSDLSGVARFPIARAAN

Samples

Sample ID Description Type Environment
1 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
138 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
139 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
143 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
157 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
158 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
159 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 8.63
Rhizosphere 89.14
Stem 0
Stem Tuber 0
Unclassified 15.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307407_10000083 3300031903 Bacteria 33326
2 JGI24035J26624_1001386 3300002126 Bacteria 2288
3 JGI24035J26624_1001711 3300002126 Unclassified 2051
4 rootH2_10018918 3300003320 Bacteria 8870
5 rootL2_10202537 3300003322 Bacteria 1658
6 rootH1_10005999 3300003323 Bacteria 2228
7 Ga0065704_10006741 3300005289 Unclassified 4215
8 Ga0065704_10101170 3300005289 Bacteria 2247
9 Ga0065712_10001360 3300005290 Bacteria 9622
10 Ga0065712_10109979 3300005290 Bacteria 1845
11 Ga0065715_10001454 3300005293 Bacteria 6210
12 Ga0065715_10286057 3300005293 Bacteria 1074
13 Ga0065707_10039495 3300005295 Unclassified 1017
14 Ga0065707_10115885 3300005295 Unclassified 2254
15 Ga0070658_10403238 3300005327 Bacteria 1175
16 Ga0070683_100009534 3300005329 Bacteria 8311
17 Ga0070683_100099077 3300005329 Bacteria 2743
18 Ga0070683_100171205 3300005329 Unclassified 2061
19 Ga0070690_100159602 3300005330 Bacteria 1544
20 Ga0068868_100080721 3300005338 Bacteria 2607
21 Ga0070660_100240757 3300005339 Bacteria 1474
22 Ga0070689_100002926 3300005340 Bacteria 11222
23 Ga0070689_100013434 3300005340 Bacteria 5924
24 Ga0070687_100037463 3300005343 Bacteria 2425
25 Ga0070668_100157209 3300005347 Bacteria 1842
26 Ga0070675_100004347 3300005354 Bacteria 10808
27 Ga0070675_100068931 3300005354 Bacteria 2929
28 Ga0070671_100022363 3300005355 Bacteria 5163
29 Ga0070671_100082657 3300005355 Unclassified 2685
30 Ga0070673_100105572 3300005364 Bacteria 2327
31 Ga0070673_100222404 3300005364 Unclassified 1634
32 Ga0070688_100004581 3300005365 Bacteria 7212
33 Ga0070688_100224049 3300005365 Bacteria 1327
34 Ga0070659_100001243 3300005366 Bacteria 18491
35 Ga0070709_10020850 3300005434 Bacteria 3812
36 Ga0070709_10184223 3300005434 Bacteria 1468
37 Ga0070714_100272361 3300005435 Bacteria 1570
38 Ga0070714_100409849 3300005435 Unclassified 1282
39 Ga0070713_100069418 3300005436 Bacteria 2971
40 Ga0070713_100111632 3300005436 Unclassified 2384
41 Ga0070710_10011738 3300005437 Bacteria 4335
42 Ga0070701_10094770 3300005438 Bacteria 1643
43 Ga0070711_100018712 3300005439 Bacteria 4428
44 Ga0070711_100511249 3300005439 Unclassified 992
45 Ga0070700_100025077 3300005441 Bacteria 3509
46 Ga0070694_100013498 3300005444 Bacteria 5102
47 Ga0070708_100091461 3300005445 Bacteria 2771
48 Ga0070708_100303452 3300005445 Bacteria 1503
49 Ga0070663_100023661 3300005455 Unclassified 4120
50 Ga0070678_100086952 3300005456 Bacteria 2386
51 Ga0070662_100060537 3300005457 Bacteria 2761
52 Ga0070662_100101644 3300005457 Bacteria 2176
53 Ga0070681_10053666 3300005458 Unclassified 4017
54 Ga0068867_100000046 3300005459 Bacteria 75834
55 Ga0070685_10017937 3300005466 Bacteria 3799
56 Ga0070706_100011262 3300005467 Bacteria 8307
57 Ga0070706_100045801 3300005467 Bacteria 4038
58 Ga0070706_100175858 3300005467 Bacteria 1999
59 Ga0070707_100000711 3300005468 Bacteria 33208
60 Ga0070707_100013468 3300005468 Bacteria 7651
61 Ga0070707_100143677 3300005468 Bacteria 2322
62 Ga0070698_100023308 3300005471 Bacteria 6472
63 Ga0070698_100402024 3300005471 Bacteria 1303
64 Ga0070699_100094940 3300005518 Bacteria 2610
65 Ga0070699_100151290 3300005518 Bacteria 2053
66 Ga0070699_100257885 3300005518 Unclassified 1559
67 Ga0070679_100175493 3300005530 Bacteria 2115
68 Ga0070684_100000223 3300005535 Bacteria 39444
69 Ga0070684_100115662 3300005535 Bacteria 2409
70 Ga0070684_100393931 3300005535 Bacteria 1277
71 Ga0070697_100010974 3300005536 Bacteria 7078
72 Ga0070697_100020035 3300005536 Bacteria 5286
73 Ga0070697_100075157 3300005536 Bacteria 2777
74 Ga0070697_100092769 3300005536 Bacteria 2499
75 Ga0070697_100108558 3300005536 Bacteria 2310
76 Ga0070697_100112208 3300005536 Bacteria 2273
77 Ga0070697_100251892 3300005536 Bacteria 1510
78 Ga0070672_100220498 3300005543 Bacteria 1591
79 Ga0070693_100186487 3300005547 Bacteria 1339
80 Ga0070665_100029760 3300005548 Bacteria 5495
81 Ga0070704_100003211 3300005549 Bacteria 9349
82 Ga0070664_100226710 3300005564 Unclassified 1674
83 Ga0068856_100065206 3300005614 Bacteria 3598
84 Ga0068859_100023425 3300005617 Bacteria 6196
85 Ga0068866_10237995 3300005718 Unclassified 1107
86 Ga0068861_100236060 3300005719 Bacteria 1553
87 Ga0068863_100012823 3300005841 Bacteria 8084
88 Ga0068863_100127175 3300005841 Bacteria 2432
89 Ga0068858_100008668 3300005842 Bacteria 9764
90 Ga0068860_100052029 3300005843 Bacteria 3896
91 Ga0081455_10001318 3300005937 Bacteria 30770
92 Ga0081455_10003905 3300005937 Bacteria 16973
93 Ga0081455_10016047 3300005937 Bacteria 7246
94 Ga0081455_10058724 3300005937 Bacteria 3253
95 Ga0081540_1006048 3300005983 Bacteria 8899
96 Ga0081540_1063212 3300005983 Unclassified 1753
97 Ga0081539_10008958 3300005985 Bacteria 8518
98 Ga0081539_10053191 3300005985 Bacteria 2268
99 Ga0081539_10098781 3300005985 Bacteria 1492
100 Ga0070715_10022596 3300006163 Bacteria 2454
101 Ga0070715_10028598 3300006163 Bacteria 2237
102 Ga0070716_100179994 3300006173 Unclassified 1387
103 Ga0070712_100029905 3300006175 Bacteria 3655
104 Ga0070712_100281541 3300006175 Bacteria 1339
105 Ga0097620_100023424 3300006931 Bacteria 6196
106 Ga0099795_10120838 3300007788 Bacteria 1047
107 Ga0105240_10488065 3300009093 Bacteria 1372
108 Ga0111539_10310712 3300009094 Bacteria 1834
109 Ga0105245_10572459 3300009098 Bacteria 1153
110 Ga0114129_10133340 3300009147 Bacteria 3410
111 Ga0114129_10250271 3300009147 Unclassified 2379
112 Ga0105243_10000040 3300009148 Bacteria 160788
113 Ga0105241_10143442 3300009174 Bacteria 1947
114 Ga0105242_10190516 3300009176 Bacteria 1815
115 Ga0105248_10119223 3300009177 Bacteria 2976
116 Ga0105249_10022717 3300009553 Bacteria 5621
117 Ga0105249_10591697 3300009553 Bacteria 1163
118 Ga0105239_10269364 3300010375 Bacteria 1915
119 Ga0105246_10162339 3300011119 Bacteria 1703
120 Ga0157316_1009619 3300012510 Bacteria 872
121 Ga0157370_10150635 3300013104 Bacteria 2165
122 Ga0157369_10088790 3300013105 Bacteria 3300
123 Ga0157374_10180216 3300013296 Bacteria 2063
124 Ga0157374_10410072 3300013296 Unclassified 1353
125 Ga0157378_10060934 3300013297 Bacteria 3367
126 Ga0157378_10172559 3300013297 Bacteria 2029
127 Ga0157378_10177369 3300013297 Unclassified 2002
128 Ga0157378_10271886 3300013297 Unclassified 1630
129 Ga0157378_10281282 3300013297 Unclassified 1604
130 Ga0157378_10359322 3300013297 Bacteria 1425
131 Ga0157378_10477681 3300013297 Bacteria 1241
132 Ga0157378_10664095 3300013297 Bacteria 1059
133 Ga0163162_10229202 3300013306 Bacteria 1988
134 Ga0163162_10256241 3300013306 Unclassified 1881
135 Ga0157372_10009388 3300013307 Bacteria 10407
136 Ga0157372_10140740 3300013307 Bacteria 2779
137 Ga0157372_10262016 3300013307 Bacteria 2007
138 Ga0157375_10003948 3300013308 Bacteria 12859
139 Ga0157375_10116041 3300013308 Bacteria 2781
140 Ga0157375_10204007 3300013308 Bacteria 2133
141 Ga0163163_10007737 3300014325 Bacteria 9496
142 Ga0163163_10119344 3300014325 Unclassified 2670
143 Ga0182008_10104837 3300014497 Unclassified 1399
144 Ga0157377_10007595 3300014745 Bacteria 5244
145 Ga0157379_10015619 3300014968 Bacteria 6668
146 Ga0157379_10142789 3300014968 Bacteria 2158
147 Ga0157376_10289320 3300014969 Bacteria 1546
148 Ga0182007_10066108 3300015262 Unclassified 1184
149 Ga0163161_10207253 3300017792 Bacteria 1513
150 Ga0207666_1000285 3300025271 Bacteria 7206
151 Ga0207673_1001673 3300025290 Unclassified 2451
152 Ga0207697_10000692 3300025315 Bacteria 19173
153 Ga0207697_10000728 3300025315 Bacteria 18701
154 Ga0207697_10006408 3300025315 Bacteria 5329
155 Ga0207647_10017779 3300025904 Bacteria 4825
156 Ga0207705_10251348 3300025909 Unclassified 1348
157 Ga0207705_10296871 3300025909 Bacteria 1239
158 Ga0207684_10013805 3300025910 Bacteria 6976
159 Ga0207684_10022532 3300025910 Bacteria 5377
160 Ga0207684_10183146 3300025910 Unclassified 1806
161 Ga0207707_10396495 3300025912 Bacteria 1185
162 Ga0207693_10010140 3300025915 Bacteria 7653
163 Ga0207663_10166838 3300025916 Bacteria 1560
164 Ga0207662_10021401 3300025918 Bacteria 3696
165 Ga0207657_10306884 3300025919 Bacteria 1256
166 Ga0207649_10017888 3300025920 Bacteria 4020
167 Ga0207649_10156684 3300025920 Bacteria 1574
168 Ga0207652_10122481 3300025921 Bacteria 2314
169 Ga0207646_10000413 3300025922 Bacteria 57255
170 Ga0207646_10002843 3300025922 Bacteria 20115
171 Ga0207646_10025992 3300025922 Bacteria 5351
172 Ga0207681_10175571 3300025923 Bacteria 1628
173 Ga0207659_10011925 3300025926 Bacteria 5505
174 Ga0207687_10210430 3300025927 Bacteria 1525
175 Ga0207664_10073848 3300025929 Bacteria 2753
176 Ga0207644_10105746 3300025931 Bacteria 2121
177 Ga0207690_10005910 3300025932 Bacteria 7246
178 Ga0207706_10021961 3300025933 Bacteria 5728
179 Ga0207709_10001238 3300025935 Bacteria 18336
180 Ga0207670_10001997 3300025936 Bacteria 10702
181 Ga0207670_10027715 3300025936 Bacteria 3586
182 Ga0207670_10203974 3300025936 Bacteria 1504
183 Ga0207669_10026658 3300025937 Unclassified 3149
184 Ga0207665_10024818 3300025939 Bacteria 3955
185 Ga0207665_10196648 3300025939 Unclassified 1467
186 Ga0207691_10018883 3300025940 Bacteria 6530
187 Ga0207689_10042525 3300025942 Bacteria 3758
188 Ga0207661_10089491 3300025944 Bacteria 2561
189 Ga0207679_10021677 3300025945 Bacteria 4361
190 Ga0207679_10188803 3300025945 Unclassified 1711
191 Ga0207712_10032838 3300025961 Bacteria 3505
192 Ga0207712_10324870 3300025961 Bacteria 1271
193 Ga0207668_10108025 3300025972 Bacteria 2082
194 Ga0207668_10324714 3300025972 Bacteria 1278
195 Ga0207658_10254355 3300025986 Bacteria 1494
196 Ga0207703_10072534 3300026035 Bacteria 2846
197 Ga0207703_10432838 3300026035 Bacteria 1226
198 Ga0207678_10006623 3300026067 Bacteria 10269
199 Ga0207708_10009552 3300026075 Bacteria 7191
200 Ga0207641_10070806 3300026088 Bacteria 2997
201 Ga0207648_10000208 3300026089 Bacteria 62964
202 Ga0207676_10116835 3300026095 Bacteria 2242
203 Ga0207675_100255504 3300026118 Bacteria 1697
204 Ga0207428_10438271 3300027907 Bacteria 953
205 Ga0268266_10077887 3300028379 Bacteria 2883
206 Ga0268264_10014613 3300028381 Bacteria 6451
207 Ga0265338_10027137 3300028800 Bacteria 5753
208 Ga0265331_10019132 3300031250 Bacteria 3539
209 Ga0265327_10009758 3300031251 Bacteria 6865
210 Ga0265327_10014891 3300031251 Bacteria 5062
211 Ga0307408_100000034 3300031548 Bacteria 208605
212 Ga0316575_10020871 3300031665 Bacteria 2516
213 Ga0316576_10019499 3300031727 Bacteria 4649
214 Ga0316576_10172498 3300031727 Bacteria 1632
215 Ga0316578_10012946 3300031728 Bacteria 4409
216 Ga0307412_10000080 3300031911 Bacteria 94834
217 Ga0307411_10039633 3300032005 Bacteria 2982
218 Ga0316580_10003324 3300032139 Bacteria 4551
219 Ga0373953_0057787 3300035117 Unclassified 1580
220 Ga0373954_0024118 3300035118 Bacteria 2772
221 Ga0373956_0189286 3300035119 Bacteria 974
222 Ga0373957_0119952 3300035120 Unclassified 1064
223 Ga0373955_0055717 3300035172 Bacteria 2166
224 Ga0316574_0000716 3300035398 Bacteria 14178
225 Ga0373935_0073857 3300035692 Bacteria 2204
226 Ga0373935_0086004 3300035692 Bacteria 2051
227 Ga0373927_0172747 3300035695 Bacteria 1417
228 Ga0373947_0002289 3300035725 Bacteria 11579
229 Ga0373947_0260183 3300035725 Unclassified 1150
230 Ga0373937_0071624 3300036401 Bacteria 3196
231 Ga0316584_0034701 3300036712 Bacteria 3740
232 Ga0373925_0109762 3300037068 Bacteria 2130
233 Ga0373925_0125934 3300037068 Bacteria 1993
234 Ga0436363_0962363 3300039450 Bacteria 1105
235 Ga0439453_0005296 3300041408 Bacteria 1958
236 Ga0450890_000092 3300042127 Bacteria 15055
237 Ga0450892_000184 3300042130 Bacteria 7203
238 Ga0450893_0000293 3300042532 Bacteria 6858
239 Ga0451577_0003742 3300042876 Bacteria 16590
240 Ga0451577_0417308 3300042876 Bacteria 1218
241 Ga0451576_0198148 3300045051 Bacteria 2098
242 Ga0495592_0360606 3300046454 Unclassified 930
243 Ga0495603_0059292 3300046455 Unclassified 2263
244 Ga0495629_0160398 3300046459 Bacteria 1562
245 Ga0495629_0247339 3300046459 Bacteria 1227
246 Ga0495582_0010224 3300046473 Bacteria 5166
247 Ga0495608_0178239 3300046511 Unclassified 1345
248 Ga0495652_0021792 3300046529 Bacteria 5696
249 Ga0495586_0090522 3300046535 Bacteria 1690
250 Ga0495586_0148223 3300046535 Bacteria 1319
251 Ga0495587_0025654 3300046536 Bacteria 3600
252 Ga0495598_0057738 3300046537 Bacteria 1189
253 Ga0495645_0013403 3300046543 Bacteria 5794
254 Ga0495667_0083975 3300046559 Bacteria 2068
255 Ga0495634_0016650 3300046642 Bacteria 5254
256 Ga0495634_0076669 3300046642 Bacteria 2194
257 Ga0495588_0167827 3300046674 Bacteria 1161
258 Ga0495599_0041897 3300046678 Bacteria 2873
259 Ga0495623_0021804 3300046679 Bacteria 4137
260 Ga0495646_0012149 3300046680 Bacteria 5475
261 Ga0495647_0023567 3300046681 Bacteria 2233
262 Ga0495647_0099916 3300046681 Bacteria 1200
263 Ga0495600_0196643 3300046809 Bacteria 1296
264 Ga0495604_0011722 3300047317 Bacteria 6970
265 Ga0495674_0018121 3300047319 Bacteria 6553
266 Ga0495676_0172387 3300047321 Unclassified 1522
267 Ga0495675_0008434 3300047444 Bacteria 6384
268 Ga0495675_0068034 3300047444 Bacteria 2250
269 Ga0495684_0059364 3300047471 Bacteria 2913
270 Ga0495602_0024197 3300048088 Bacteria 5896
271 Ga0496100_0124166 3300048903 Bacteria 1810
272 Ga0496100_0217111 3300048903 Bacteria 1402
273 Ga0496102_0073608 3300048905 Bacteria 3139
274 Ga0496102_0082859 3300048905 Bacteria 2958
275 Ga0496102_0485814 3300048905 Bacteria 1157
276 Ga0496103_0073662 3300048906 Bacteria 2139
277 Ga0496103_0078377 3300048906 Bacteria 2075
278 Ga0496103_0098829 3300048906 Bacteria 1846
279 Ga0496104_0090417 3300048907 Bacteria 2925
280 Ga0496104_0107365 3300048907 Bacteria 2675
281 Ga0496105_0245586 3300048908 Bacteria 1451
282 Ga0496106_0008862 3300048909 Bacteria 7438
283 Ga0496106_0160116 3300048909 Bacteria 1780
284 Ga0496107_0283540 3300048910 Bacteria 1233
285 Ga0496108_0019361 3300048911 Bacteria 5589
286 Ga0496108_0049142 3300048911 Unclassified 3528
287 Ga0496109_0021148 3300048912 Bacteria 5752
288 Ga0496110_0128847 3300048913 Bacteria 2284
289 Ga0496110_0156239 3300048913 Bacteria 2066
290 Ga0496111_0183266 3300048914 Bacteria 1557
291 Ga0496112_0366961 3300048915 Bacteria 1381
292 Ga0496112_0667003 3300048915 Unclassified 969
293 Ga0496112_0921627 3300048915 Unclassified 795
294 Ga0496113_0000857 3300048916 Bacteria 15922
295 Ga0496114_0050611 3300048917 Bacteria 3458
296 Ga0496114_0091038 3300048917 Bacteria 2590
297 Ga0496115_0007355 3300048918 Bacteria 8102
298 Ga0496125_0000147 3300048928 Bacteria 154731
299 Ga0501038_0003416 3300049574 Bacteria 14797
300 Ga0501067_0119199 3300049583 Unclassified 1468
301 Ga0501070_0021194 3300049586 Bacteria 5455
302 Ga0501073_0047830 3300049589 Bacteria 3005
303 Ga0501080_0028296 3300049742 Bacteria 5213
304 nmdc:mga05p37_183017_c1 3300050507 Unclassified 2548
305 nmdc:mga08y16_841171_c1 3300050511 Bacteria 908
306 nmdc:mga0n895_167914_c1 3300050512 Bacteria 2226
307 nmdc:mga0n895_750440_c1 3300050512 Unclassified 969
308 nmdc:mga0rr50_443864_c1 3300050513 Unclassified 1099
309 nmdc:mga0a205_565347_c1 3300050515 Unclassified 992
310 Ga0495619_0186281 3300053085 Bacteria 1436
311 Ga0495619_0438406 3300053085 Unclassified 901
312 Ga0500556_0007005 3300053104 Bacteria 3216
313 Ga0500616_0020370 3300053153 Bacteria 3726
314 Ga0307407_10000083
315 JGI24035J26624_1001386
316 JGI24035J26624_1001711
317 rootH2_10018918
318 rootL2_10202537
319 rootH1_10005999
320 Ga0065704_10006741
321 Ga0065704_10101170
322 Ga0065712_10001360
323 Ga0065712_10109979
324 Ga0065715_10001454
325 Ga0065715_10286057
326 Ga0065707_10039495
327 Ga0065707_10115885
328 Ga0070658_10403238
329 Ga0070683_100009534
330 Ga0070683_100099077
331 Ga0070683_100171205
332 Ga0070690_100159602
333 Ga0068868_100080721
334 Ga0070660_100240757
335 Ga0070689_100002926
336 Ga0070689_100013434
337 Ga0070687_100037463
338 Ga0070668_100157209
339 Ga0070675_100004347
340 Ga0070675_100068931
341 Ga0070671_100022363
342 Ga0070671_100082657
343 Ga0070673_100105572
344 Ga0070673_100222404
345 Ga0070688_100004581
346 Ga0070688_100224049
347 Ga0070659_100001243
348 Ga0070709_10020850
349 Ga0070709_10184223
350 Ga0070714_100272361
351 Ga0070714_100409849
352 Ga0070713_100069418
353 Ga0070713_100111632
354 Ga0070710_10011738
355 Ga0070701_10094770
356 Ga0070711_100018712
357 Ga0070711_100511249
358 Ga0070700_100025077
359 Ga0070694_100013498
360 Ga0070708_100091461
361 Ga0070708_100303452
362 Ga0070663_100023661
363 Ga0070678_100086952
364 Ga0070662_100060537
365 Ga0070662_100101644
366 Ga0070681_10053666
367 Ga0068867_100000046
368 Ga0070685_10017937
369 Ga0070706_100011262
370 Ga0070706_100045801
371 Ga0070706_100175858
372 Ga0070707_100000711
373 Ga0070707_100013468
374 Ga0070707_100143677
375 Ga0070698_100023308
376 Ga0070698_100402024
377 Ga0070699_100094940
378 Ga0070699_100151290
379 Ga0070699_100257885
380 Ga0070679_100175493
381 Ga0070684_100000223
382 Ga0070684_100115662
383 Ga0070684_100393931
384 Ga0070697_100010974
385 Ga0070697_100020035
386 Ga0070697_100075157
387 Ga0070697_100092769
388 Ga0070697_100108558
389 Ga0070697_100112208
390 Ga0070697_100251892
391 Ga0070672_100220498
392 Ga0070693_100186487
393 Ga0070665_100029760
394 Ga0070704_100003211
395 Ga0070664_100226710
396 Ga0068856_100065206
397 Ga0068859_100023425
398 Ga0068866_10237995
399 Ga0068861_100236060
400 Ga0068863_100012823
401 Ga0068863_100127175
402 Ga0068858_100008668
403 Ga0068860_100052029
404 Ga0081455_10001318
405 Ga0081455_10003905
406 Ga0081455_10016047
407 Ga0081455_10058724
408 Ga0081540_1006048
409 Ga0081540_1063212
410 Ga0081539_10008958
411 Ga0081539_10053191
412 Ga0081539_10098781
413 Ga0070715_10022596
414 Ga0070715_10028598
415 Ga0070716_100179994
416 Ga0070712_100029905
417 Ga0070712_100281541
418 Ga0097620_100023424
419 Ga0099795_10120838
420 Ga0105240_10488065
421 Ga0111539_10310712
422 Ga0105245_10572459
423 Ga0114129_10133340
424 Ga0114129_10250271
425 Ga0105243_10000040
426 Ga0105241_10143442
427 Ga0105242_10190516
428 Ga0105248_10119223
429 Ga0105249_10022717
430 Ga0105249_10591697
431 Ga0105239_10269364
432 Ga0105246_10162339
433 Ga0157316_1009619
434 Ga0157370_10150635
435 Ga0157369_10088790
436 Ga0157374_10180216
437 Ga0157374_10410072
438 Ga0157378_10060934
439 Ga0157378_10172559
440 Ga0157378_10177369
441 Ga0157378_10271886
442 Ga0157378_10281282
443 Ga0157378_10359322
444 Ga0157378_10477681
445 Ga0157378_10664095
446 Ga0163162_10229202
447 Ga0163162_10256241
448 Ga0157372_10009388
449 Ga0157372_10140740
450 Ga0157372_10262016
451 Ga0157375_10003948
452 Ga0157375_10116041
453 Ga0157375_10204007
454 Ga0163163_10007737
455 Ga0163163_10119344
456 Ga0182008_10104837
457 Ga0157377_10007595
458 Ga0157379_10015619
459 Ga0157379_10142789
460 Ga0157376_10289320
461 Ga0182007_10066108
462 Ga0163161_10207253
463 Ga0207666_1000285
464 Ga0207673_1001673
465 Ga0207697_10000692
466 Ga0207697_10000728
467 Ga0207697_10006408
468 Ga0207647_10017779
469 Ga0207705_10251348
470 Ga0207705_10296871
471 Ga0207684_10013805
472 Ga0207684_10022532
473 Ga0207684_10183146
474 Ga0207707_10396495
475 Ga0207693_10010140
476 Ga0207663_10166838
477 Ga0207662_10021401
478 Ga0207657_10306884
479 Ga0207649_10017888
480 Ga0207649_10156684
481 Ga0207652_10122481
482 Ga0207646_10000413
483 Ga0207646_10002843
484 Ga0207646_10025992
485 Ga0207681_10175571
486 Ga0207659_10011925
487 Ga0207687_10210430
488 Ga0207664_10073848
489 Ga0207644_10105746
490 Ga0207690_10005910
491 Ga0207706_10021961
492 Ga0207709_10001238
493 Ga0207670_10001997
494 Ga0207670_10027715
495 Ga0207670_10203974
496 Ga0207669_10026658
497 Ga0207665_10024818
498 Ga0207665_10196648
499 Ga0207691_10018883
500 Ga0207689_10042525
501 Ga0207661_10089491
502 Ga0207679_10021677
503 Ga0207679_10188803
504 Ga0207712_10032838
505 Ga0207712_10324870
506 Ga0207668_10108025
507 Ga0207668_10324714
508 Ga0207658_10254355
509 Ga0207703_10072534
510 Ga0207703_10432838
511 Ga0207678_10006623
512 Ga0207708_10009552
513 Ga0207641_10070806
514 Ga0207648_10000208
515 Ga0207676_10116835
516 Ga0207675_100255504
517 Ga0207428_10438271
518 Ga0268266_10077887
519 Ga0268264_10014613
520 Ga0265338_10027137
521 Ga0265331_10019132
522 Ga0265327_10009758
523 Ga0265327_10014891
524 Ga0307408_100000034
525 Ga0316575_10020871
526 Ga0316576_10019499
527 Ga0316576_10172498
528 Ga0316578_10012946
529 Ga0307412_10000080
530 Ga0307411_10039633
531 Ga0316580_10003324
532 Ga0373953_0057787
533 Ga0373954_0024118
534 Ga0373956_0189286
535 Ga0373957_0119952
536 Ga0373955_0055717
537 Ga0316574_0000716
538 Ga0373935_0073857
539 Ga0373935_0086004
540 Ga0373927_0172747
541 Ga0373947_0002289
542 Ga0373947_0260183
543 Ga0373937_0071624
544 Ga0316584_0034701
545 Ga0373925_0109762
546 Ga0373925_0125934
547 Ga0436363_0962363
548 Ga0439453_0005296
549 Ga0450890_000092
550 Ga0450892_000184
551 Ga0450893_0000293
552 Ga0451577_0003742
553 Ga0451577_0417308
554 Ga0451576_0198148
555 Ga0495592_0360606
556 Ga0495603_0059292
557 Ga0495629_0160398
558 Ga0495629_0247339
559 Ga0495582_0010224
560 Ga0495608_0178239
561 Ga0495652_0021792
562 Ga0495586_0090522
563 Ga0495586_0148223
564 Ga0495587_0025654
565 Ga0495598_0057738
566 Ga0495645_0013403
567 Ga0495667_0083975
568 Ga0495634_0016650
569 Ga0495634_0076669
570 Ga0495588_0167827
571 Ga0495599_0041897
572 Ga0495623_0021804
573 Ga0495646_0012149
574 Ga0495647_0023567
575 Ga0495647_0099916
576 Ga0495600_0196643
577 Ga0495604_0011722
578 Ga0495674_0018121
579 Ga0495676_0172387
580 Ga0495675_0008434
581 Ga0495675_0068034
582 Ga0495684_0059364
583 Ga0495602_0024197
584 Ga0496100_0124166
585 Ga0496100_0217111
586 Ga0496102_0073608
587 Ga0496102_0082859
588 Ga0496102_0485814
589 Ga0496103_0073662
590 Ga0496103_0078377
591 Ga0496103_0098829
592 Ga0496104_0090417
593 Ga0496104_0107365
594 Ga0496105_0245586
595 Ga0496106_0008862
596 Ga0496106_0160116
597 Ga0496107_0283540
598 Ga0496108_0019361
599 Ga0496108_0049142
600 Ga0496109_0021148
601 Ga0496110_0128847
602 Ga0496110_0156239
603 Ga0496111_0183266
604 Ga0496112_0366961
605 Ga0496112_0667003
606 Ga0496112_0921627
607 Ga0496113_0000857
608 Ga0496114_0050611
609 Ga0496114_0091038
610 Ga0496115_0007355
611 Ga0496125_0000147
612 Ga0501038_0003416
613 Ga0501067_0119199
614 Ga0501070_0021194
615 Ga0501073_0047830
616 Ga0501080_0028296
617 nmdc:mga05p37_183017_c1
618 nmdc:mga08y16_841171_c1
619 nmdc:mga0n895_167914_c1
620 nmdc:mga0n895_750440_c1
621 nmdc:mga0rr50_443864_c1
622 nmdc:mga0a205_565347_c1
623 Ga0495619_0186281
624 Ga0495619_0438406
625 Ga0500556_0007005
626 Ga0500616_0020370

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17827

PrmC_N

PrmC N-terminal domain

54

124

0.98

PF13649

Methyltransf_25

Methyltransferase domain

165

252

0.93

PF13847

Methyltransf_31

Methyltransferase domain

159

283

0.9

PF05175

MTS

Methyltransferase small domain

146

258

0.89

PF08241

Methyltransf_11

Methyltransferase domain

166

251

0.87

PF08242

Methyltransf_12

Methyltransferase domain

166

237

0.86

PF10294

Methyltransf_16

Lysine methyltransferase

147

222

0.85

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

150

252

0.84

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

147

237

0.83

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

143

260

0.79

PF13489

Methyltransf_23

Methyltransferase domain

142

235

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.9429 5 279
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.9297 5 279
1sg9-assembly2.cif.gz_B crystal structure of thermotoga maritima protein hemk, an n5-glutamine methyltransferase 0.9213 5 276
1vq1-assembly1.cif.gz_A crystal structure of n5-glutamine methyltransferase, hemk(ec 2.1.1.-) (tm0488) from thermotoga maritima at 2.80 a resolution 0.9103 1 276
1nv9-assembly1.cif.gz_A hemk, apo structure 0.9088 5 276
ID Description Score Start End Superfamily
af_P0ACC1_1_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9701 1 84 1.10.8.10
2b3tA01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.962 1 86 1.10.8.10
2b3tA01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.951 1 86 1.10.8.10
af_P0ACC1_1_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9477 1 84 1.10.8.10
af_Q9FMI5_170_376_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9445 86 278 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1F5V0E0-F1-model_v4 Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) 0.9799 1 279 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A2N2F731-F1-model_v4 Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) 0.9766 1 280 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A7C7ZL70-F1-model_v4 Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) 0.9732 1 280 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A2N2F731-F1-model_v4 Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC) 0.9732 1 280 GO:0003676
GO:0032259
GO:0036009
GO:0102559
AF-A0A2G2JYK8-F1-model_v4 deleted 0.973 1 280

Map