F402196

General Info

Members Datasets Scaffolds Average Seq Length
313 195 626 198

Family's Representative Sequence

Representative Sequence 3300020082|Ga0206353_11381802|Ga0206353_113818022
Length 209
Sequence VIANRAAMRHDQGVRSTPSALSDSSPAVQAWSGEQFAARVDEAMQIYAQAMGYPRTAADQRAITARRHTHNQGFACRAAVVPDQTTTGMLAGFGYGYTTAAGQWWHDLVRKALPEPLGREWLTDAFELSELHVLPELQGRGLGRQVLLELAAGIPHSAMLLSTPDADTRAFRLYRNLGFVELRRRYLFPGDARPFAVLGARLPLEPPGR

Samples

Sample ID Description Type Environment
1 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
125 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
126 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
127 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
128 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
129 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
130 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
131 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
132 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
133 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
134 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
138 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
175 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 1.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.35
Rhizosphere 90.73
Stem 0
Stem Tuber 0
Unclassified 12.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206353_11381802 3300020082 Bacteria 1217
2 rootL2_10298474 3300003322 Unclassified 1093
3 rootH1_10086269 3300003323 Bacteria 1164
4 rootH1_10211507 3300003323 Bacteria 1523
5 Ga0070658_10289288 3300005327 Bacteria 1396
6 Ga0068869_100030279 3300005334 Bacteria 3798
7 Ga0070666_10039993 3300005335 Bacteria 3128
8 Ga0070682_100016750 3300005337 Bacteria 4265
9 Ga0068868_100014383 3300005338 Bacteria 5832
10 Ga0070660_100026181 3300005339 Bacteria 4342
11 Ga0070691_10013293 3300005341 Bacteria 3771
12 Ga0070687_100019829 3300005343 Bacteria 3136
13 Ga0070669_100070040 3300005353 Bacteria 2592
14 Ga0070675_100211539 3300005354 Unclassified 1686
15 Ga0070671_100206095 3300005355 Bacteria 1668
16 Ga0070674_100007907 3300005356 Bacteria 6293
17 Ga0070659_100014779 3300005366 Bacteria 5838
18 Ga0070667_100067339 3300005367 Bacteria 3044
19 Ga0070709_10115207 3300005434 Unclassified 1812
20 Ga0070713_100035396 3300005436 Bacteria 4019
21 Ga0070710_10083741 3300005437 Bacteria 1867
22 Ga0070701_10009656 3300005438 Bacteria 4233
23 Ga0070711_100135731 3300005439 Bacteria 1838
24 Ga0070705_100005924 3300005440 Bacteria 5977
25 Ga0070694_100004941 3300005444 Bacteria 8042
26 Ga0070678_100063691 3300005456 Bacteria 2729
27 Ga0070681_10597175 3300005458 Bacteria 1018
28 Ga0070685_10115327 3300005466 Bacteria 1661
29 Ga0070684_100871358 3300005535 Bacteria 843
30 Ga0070697_100153079 3300005536 Unclassified 1945
31 Ga0068853_100091615 3300005539 Bacteria 2674
32 Ga0070672_100032570 3300005543 Bacteria 3936
33 Ga0070686_100154558 3300005544 Bacteria 1610
34 Ga0070695_100005472 3300005545 Bacteria 7477
35 Ga0070696_100057337 3300005546 Bacteria 2718
36 Ga0070665_100044507 3300005548 Bacteria 4457
37 Ga0070665_100060863 3300005548 Bacteria 3785
38 Ga0068854_100033496 3300005578 Bacteria 3582
39 Ga0068856_100023954 3300005614 Bacteria 5937
40 Ga0068856_100034417 3300005614 Bacteria 4962
41 Ga0068856_100068707 3300005614 Bacteria 3503
42 Ga0068856_100925957 3300005614 Bacteria 890
43 Ga0070702_100022025 3300005615 Bacteria 3363
44 Ga0068852_100219334 3300005616 Bacteria 1808
45 Ga0068859_100155547 3300005617 Bacteria 2363
46 Ga0068864_100086321 3300005618 Bacteria 2760
47 Ga0068861_100015135 3300005719 Bacteria 5429
48 Ga0068851_10086998 3300005834 Bacteria 1640
49 Ga0068863_100028265 3300005841 Bacteria 5354
50 Ga0068858_100023468 3300005842 Bacteria 5745
51 Ga0068860_100011884 3300005843 Bacteria 8583
52 Ga0068862_100174073 3300005844 Bacteria 1928
53 Ga0081455_10009254 3300005937 Bacteria 10145
54 Ga0081540_1001746 3300005983 Bacteria 18261
55 Ga0070717_10008542 3300006028 Bacteria 7648
56 Ga0075432_10079327 3300006058 Unclassified 1188
57 Ga0070715_10030994 3300006163 Bacteria 2167
58 Ga0070716_100025812 3300006173 Bacteria 3140
59 Ga0070712_100042281 3300006175 Bacteria 3133
60 Ga0097621_100102992 3300006237 Bacteria 2404
61 Ga0068871_100079893 3300006358 Bacteria 2707
62 Ga0075433_10028859 3300006852 Bacteria 4720
63 Ga0075434_100028563 3300006871 Bacteria 5482
64 Ga0068865_100090479 3300006881 Bacteria 2219
65 Ga0075436_100017420 3300006914 Bacteria 4918
66 Ga0097620_100009918 3300006931 Bacteria 9616
67 Ga0097620_100155534 3300006931 Bacteria 2363
68 Ga0075435_100077719 3300007076 Bacteria 2721
69 Ga0105240_10099685 3300009093 Bacteria 3536
70 Ga0105240_10116536 3300009093 Bacteria 3222
71 Ga0105240_10696268 3300009093 Bacteria 1109
72 Ga0105245_10116768 3300009098 Bacteria 2488
73 Ga0105247_10013626 3300009101 Bacteria 4876
74 Ga0105247_10048474 3300009101 Bacteria 2609
75 Ga0114129_10747375 3300009147 Unclassified 1252
76 Ga0105243_10076365 3300009148 Bacteria 2722
77 Ga0105241_10071831 3300009174 Bacteria 2688
78 Ga0105241_10179110 3300009174 Bacteria 1757
79 Ga0105241_10227360 3300009174 Bacteria 1571
80 Ga0105242_10006345 3300009176 Bacteria 9106
81 Ga0105248_10038882 3300009177 Bacteria 5326
82 Ga0105237_10008917 3300009545 Bacteria 10806
83 Ga0105237_10218597 3300009545 Bacteria 1906
84 Ga0105237_10615805 3300009545 Bacteria 1093
85 Ga0105238_10081165 3300009551 Bacteria 3232
86 Ga0105238_10848504 3300009551 Bacteria 930
87 Ga0105249_10361148 3300009553 Unclassified 1474
88 Ga0105239_10064577 3300010375 Bacteria 4018
89 Ga0105239_10164011 3300010375 Bacteria 2484
90 Ga0105246_10010990 3300011119 Bacteria 5612
91 Ga0157373_10164176 3300013100 Unclassified 1563
92 Ga0157371_10014754 3300013102 Bacteria 5880
93 Ga0157370_10010580 3300013104 Bacteria 9713
94 Ga0157369_10012407 3300013105 Bacteria 9673
95 Ga0157369_10102006 3300013105 Bacteria 3058
96 Ga0157374_10006233 3300013296 Bacteria 10114
97 Ga0157374_10682154 3300013296 Bacteria 1040
98 Ga0157378_10014228 3300013297 Bacteria 6964
99 Ga0163163_10309819 3300014325 Bacteria 1631
100 Ga0157380_10012219 3300014326 Bacteria 6221
101 Ga0157377_10013192 3300014745 Bacteria 4177
102 Ga0157376_10007771 3300014969 Bacteria 7686
103 Ga0206356_11419751 3300020070 Bacteria 1513
104 Ga0206354_11637747 3300020081 Bacteria 1197
105 Ga0206353_10308023 3300020082 Bacteria 12415
106 Ga0206353_11123508 3300020082 Bacteria 4022
107 Ga0206353_11808626 3300020082 Bacteria 1578
108 Ga0207710_10014085 3300025900 Bacteria 3368
109 Ga0207710_10024940 3300025900 Bacteria 2578
110 Ga0207680_10014811 3300025903 Bacteria 4050
111 Ga0207647_10199111 3300025904 Bacteria 1159
112 Ga0207647_10204900 3300025904 Bacteria 1140
113 Ga0207685_10018388 3300025905 Bacteria 2281
114 Ga0207654_10064606 3300025911 Bacteria 2152
115 Ga0207695_10167150 3300025913 Bacteria 2127
116 Ga0207695_10226313 3300025913 Bacteria 1776
117 Ga0207671_10182148 3300025914 Bacteria 1635
118 Ga0207671_10352098 3300025914 Unclassified 1168
119 Ga0207671_10482169 3300025914 Bacteria 988
120 Ga0207693_10001320 3300025915 Bacteria 21976
121 Ga0207660_10511397 3300025917 Bacteria 975
122 Ga0207662_10050130 3300025918 Bacteria 2479
123 Ga0207657_10011013 3300025919 Bacteria 8990
124 Ga0207657_10328183 3300025919 Bacteria 1209
125 Ga0207681_10811121 3300025923 Unclassified 782
126 Ga0207664_10179943 3300025929 Bacteria 1815
127 Ga0207644_10075722 3300025931 Bacteria 2474
128 Ga0207709_10029630 3300025935 Bacteria 3177
129 Ga0207670_10206872 3300025936 Unclassified 1494
130 Ga0207669_10066730 3300025937 Bacteria 2239
131 Ga0207665_10001015 3300025939 Bacteria 18941
132 Ga0207689_10061725 3300025942 Bacteria 3083
133 Ga0207679_10050405 3300025945 Bacteria 3042
134 Ga0207667_10203216 3300025949 Bacteria 2032
135 Ga0207668_10036261 3300025972 Bacteria 3290
136 Ga0207640_10050027 3300025981 Bacteria 2709
137 Ga0207703_10044077 3300026035 Bacteria 3583
138 Ga0207639_10452217 3300026041 Unclassified 1166
139 Ga0207639_10967980 3300026041 Bacteria 797
140 Ga0207678_10031545 3300026067 Bacteria 4623
141 Ga0207678_10234536 3300026067 Bacteria 1571
142 Ga0207702_10128823 3300026078 Bacteria 2275
143 Ga0207641_10231786 3300026088 Bacteria 1716
144 Ga0207648_10600787 3300026089 Unclassified 1014
145 Ga0207674_10129415 3300026116 Bacteria 2488
146 Ga0207675_100002089 3300026118 Bacteria 19837
147 Ga0207683_10000917 3300026121 Bacteria 27116
148 Ga0207698_10195594 3300026142 Bacteria 1806
149 Ga0207698_11227013 3300026142 Bacteria 764
150 Ga0268266_10194509 3300028379 Bacteria 1853
151 Ga0268265_10080150 3300028380 Bacteria 2574
152 Ga0268264_10055993 3300028381 Bacteria 3295
153 Ga0373948_0006301 3300034817 Bacteria 1957
154 Ga0373950_0034545 3300034818 Unclassified 948
155 Ga0373959_0021269 3300034820 Unclassified 1244
156 Ga0373938_0011119 3300034957 Unclassified 1667
157 Ga0373928_0025901 3300035084 Unclassified 1268
158 Ga0373929_0084211 3300035085 Unclassified 779
159 Ga0373940_0004390 3300035088 Bacteria 2977
160 Ga0373949_0024633 3300035090 Unclassified 1400
161 Ga0373951_0045513 3300035091 Unclassified 1068
162 Ga0373952_0003845 3300035092 Bacteria 2721
163 Ga0373932_0007358 3300035112 Bacteria 2621
164 Ga0373939_0016155 3300035114 Bacteria 1964
165 Ga0373954_0314773 3300035118 Unclassified 772
166 Ga0373960_0120743 3300035121 Unclassified 869
167 Ga0373942_0018479 3300035207 Bacteria 1731
168 Ga0373961_0091448 3300035241 Unclassified 972
169 Ga0373931_0011900 3300035691 Bacteria 4208
170 Ga0373925_1046887 3300037068 Unclassified 672
171 Ga0436365_0329407 3300039437 Bacteria 2237
172 Ga0466969_0029267 3300044656 Bacteria 2813
173 Ga0466972_0021758 3300044658 Bacteria 3195
174 Ga0466972_0059120 3300044658 Bacteria 1840
175 Ga0466965_0063975 3300044683 Bacteria 1841
176 Ga0466965_0110069 3300044683 Unclassified 1415
177 Ga0466965_0542607 3300044683 Unclassified 656
178 Ga0466966_0008124 3300044684 Bacteria 6955
179 Ga0466966_0043997 3300044684 Bacteria 2860
180 Ga0466966_0100758 3300044684 Bacteria 1787
181 Ga0466966_0232151 3300044684 Unclassified 1113
182 Ga0466961_0010427 3300044693 Bacteria 5930
183 Ga0466961_0017814 3300044693 Bacteria 4564
184 Ga0466961_0042568 3300044693 Bacteria 2911
185 Ga0466961_0050216 3300044693 Bacteria 2664
186 Ga0466961_0119531 3300044693 Bacteria 1655
187 Ga0466961_0188374 3300044693 Bacteria 1279
188 Ga0466961_0228458 3300044693 Bacteria 1145
189 Ga0466961_0237748 3300044693 Unclassified 1120
190 Ga0466961_0284561 3300044693 Bacteria 1011
191 Ga0466961_0421130 3300044693 Bacteria 809
192 Ga0466963_0001657 3300044694 Bacteria 12144
193 Ga0466963_0011647 3300044694 Bacteria 5357
194 Ga0466963_0014325 3300044694 Bacteria 4887
195 Ga0466963_0078848 3300044694 Bacteria 2227
196 Ga0466963_0245432 3300044694 Bacteria 1256
197 Ga0466963_0294923 3300044694 Bacteria 1140
198 Ga0466963_0358413 3300044694 Bacteria 1027
199 Ga0466963_0380566 3300044694 Bacteria 995
200 Ga0466964_0003559 3300044706 Bacteria 5691
201 Ga0466964_0014072 3300044706 Bacteria 3040
202 Ga0466964_0062963 3300044706 Bacteria 1548
203 Ga0466971_0004732 3300044719 Bacteria 5888
204 Ga0466971_0030352 3300044719 Bacteria 2419
205 Ga0466971_0059052 3300044719 Bacteria 1732
206 Ga0466971_0082243 3300044719 Bacteria 1470
207 Ga0466971_0104250 3300044719 Bacteria 1305
208 Ga0466971_0126969 3300044719 Bacteria 1182
209 Ga0466968_0142704 3300044735 Bacteria 1096
210 Ga0466970_0008328 3300044765 Bacteria 5216
211 Ga0466970_0051259 3300044765 Bacteria 2202
212 Ga0466970_0069462 3300044765 Bacteria 1894
213 Ga0466970_0102276 3300044765 Bacteria 1561
214 Ga0466970_0126330 3300044765 Bacteria 1403
215 Ga0466970_0260403 3300044765 Bacteria 973
216 Ga0466957_0046577 3300044842 Bacteria 2633
217 Ga0466957_0056207 3300044842 Bacteria 2406
218 Ga0466957_0065144 3300044842 Bacteria 2243
219 Ga0466957_0127710 3300044842 Bacteria 1626
220 Ga0466957_0252934 3300044842 Bacteria 1172
221 Ga0466957_0315147 3300044842 Bacteria 1054
222 Ga0466957_0679385 3300044842 Unclassified 725
223 Ga0466960_0091876 3300044901 Unclassified 1549
224 Ga0466960_0293054 3300044901 Bacteria 915
225 Ga0466960_0320099 3300044901 Unclassified 878
226 Ga0466960_0441827 3300044901 Bacteria 755
227 Ga0466960_0458489 3300044901 Bacteria 742
228 Ga0466959_0026498 3300045049 Bacteria 4297
229 Ga0466959_0037140 3300045049 Bacteria 3599
230 Ga0466959_0134893 3300045049 Bacteria 1748
231 Ga0466959_0143047 3300045049 Bacteria 1689
232 Ga0466959_0317440 3300045049 Bacteria 1065
233 Ga0466959_0596889 3300045049 Bacteria 743
234 Ga0466958_0024238 3300045836 Bacteria 3570
235 Ga0466958_0042395 3300045836 Bacteria 2740
236 Ga0466958_0058339 3300045836 Bacteria 2347
237 Ga0466958_0127599 3300045836 Bacteria 1595
238 Ga0466958_0395042 3300045836 Bacteria 892
239 Ga0466958_0396987 3300045836 Bacteria 890
240 Ga0466958_0527181 3300045836 Bacteria 767
241 Ga0466967_0001205 3300045976 Bacteria 14558
242 Ga0466967_0001830 3300045976 Bacteria 12798
243 Ga0466967_0042046 3300045976 Bacteria 3946
244 Ga0466967_0044230 3300045976 Bacteria 3861
245 Ga0466967_0065649 3300045976 Bacteria 3231
246 Ga0466967_0080734 3300045976 Bacteria 2935
247 Ga0466967_0107808 3300045976 Bacteria 2555
248 Ga0466967_0266039 3300045976 Bacteria 1641
249 Ga0466967_0268443 3300045976 Bacteria 1634
250 Ga0466967_0397554 3300045976 Bacteria 1340
251 Ga0466967_0494078 3300045976 Bacteria 1200
252 Ga0466967_0585311 3300045976 Bacteria 1100
253 Ga0466967_0934124 3300045976 Bacteria 863
254 Ga0495641_0220852 3300046461 Bacteria 850
255 Ga0495672_0199143 3300047320 Bacteria 1003
256 Ga0496100_0101730 3300048903 Unclassified 1981
257 Ga0496101_0031392 3300048904 Bacteria 3734
258 Ga0496102_0000072 3300048905 Bacteria 150284
259 Ga0496102_0005871 3300048905 Bacteria 10452
260 Ga0496102_0013676 3300048905 Bacteria 7034
261 Ga0496102_0024595 3300048905 Bacteria 5355
262 Ga0496103_0000053 3300048906 Bacteria 148944
263 Ga0496103_0014364 3300048906 Bacteria 4704
264 Ga0496103_0018039 3300048906 Bacteria 4230
265 Ga0496103_0247700 3300048906 Bacteria 1146
266 Ga0496104_0282288 3300048907 Bacteria 1573
267 Ga0496105_0139071 3300048908 Bacteria 1999
268 Ga0496105_0160307 3300048908 Bacteria 1847
269 Ga0496107_0362473 3300048910 Unclassified 1078
270 Ga0496108_0224202 3300048911 Unclassified 1633
271 Ga0496109_0147088 3300048912 Bacteria 2205
272 Ga0496110_0218385 3300048913 Bacteria 1733
273 Ga0496110_0592665 3300048913 Bacteria 1006
274 Ga0496111_0218301 3300048914 Unclassified 1416
275 Ga0496112_0113893 3300048915 Bacteria 2675
276 Ga0496113_0004146 3300048916 Bacteria 8842
277 Ga0496114_0064159 3300048917 Bacteria 3075
278 Ga0496114_0344913 3300048917 Bacteria 1317
279 Ga0496119_0000287 3300048922 Bacteria 70711
280 Ga0496120_0010760 3300048923 Bacteria 6343
281 Ga0501031_0051342 3300049568 Bacteria 2686
282 Ga0501032_0092327 3300049569 Bacteria 2008
283 Ga0501033_0061600 3300049570 Bacteria 2765
284 Ga0501033_0247461 3300049570 Bacteria 1264
285 Ga0501034_0153340 3300049571 Bacteria 2279
286 Ga0501037_0267005 3300049573 Bacteria 1195
287 Ga0501038_0155334 3300049574 Bacteria 1863
288 Ga0501038_0646347 3300049574 Bacteria 797
289 Ga0501043_0057328 3300049579 Bacteria 3059
290 Ga0501043_0790509 3300049579 Unclassified 687
291 Ga0501047_0344084 3300049581 Bacteria 1328
292 Ga0501048_0000993 3300049582 Bacteria 21113
293 Ga0501048_0411085 3300049582 Bacteria 968
294 Ga0501067_0214081 3300049583 Bacteria 1073
295 Ga0501070_0104240 3300049586 Bacteria 2345
296 Ga0501070_0449068 3300049586 Bacteria 1040
297 Ga0501070_0580843 3300049586 Unclassified 895
298 Ga0501070_1027133 3300049586 Unclassified 638
299 Ga0501074_0122011 3300049590 Bacteria 1864
300 Ga0501080_0108895 3300049742 Bacteria 2568
301 Ga0501035_0108870 3300049822 Bacteria 2429
302 Ga0501035_0162188 3300049822 Bacteria 1934
303 Ga0501035_0181239 3300049822 Bacteria 1815
304 Ga0501044_0371139 3300049823 Unclassified 1347
305 Ga0501044_0557639 3300049823 Bacteria 1042
306 nmdc:mga0n895_127508_c1 3300050512 Bacteria 2569
307 nmdc:mga0rr50_324806_c1 3300050513 Bacteria 1291
308 nmdc:mga08x19_71381_c1 3300050514 Bacteria 2264
309 nmdc:mga0a205_8007_c1 3300050515 Bacteria 8999
310 Ga0466962_0007680 3300061719 Bacteria 5167
311 Ga0466962_0033181 3300061719 Bacteria 2470
312 Ga0466962_0052883 3300061719 Bacteria 1941
313 Ga0466962_0080843 3300061719 Bacteria 1554
314 Ga0206353_11381802
315 rootL2_10298474
316 rootH1_10086269
317 rootH1_10211507
318 Ga0070658_10289288
319 Ga0068869_100030279
320 Ga0070666_10039993
321 Ga0070682_100016750
322 Ga0068868_100014383
323 Ga0070660_100026181
324 Ga0070691_10013293
325 Ga0070687_100019829
326 Ga0070669_100070040
327 Ga0070675_100211539
328 Ga0070671_100206095
329 Ga0070674_100007907
330 Ga0070659_100014779
331 Ga0070667_100067339
332 Ga0070709_10115207
333 Ga0070713_100035396
334 Ga0070710_10083741
335 Ga0070701_10009656
336 Ga0070711_100135731
337 Ga0070705_100005924
338 Ga0070694_100004941
339 Ga0070678_100063691
340 Ga0070681_10597175
341 Ga0070685_10115327
342 Ga0070684_100871358
343 Ga0070697_100153079
344 Ga0068853_100091615
345 Ga0070672_100032570
346 Ga0070686_100154558
347 Ga0070695_100005472
348 Ga0070696_100057337
349 Ga0070665_100044507
350 Ga0070665_100060863
351 Ga0068854_100033496
352 Ga0068856_100023954
353 Ga0068856_100034417
354 Ga0068856_100068707
355 Ga0068856_100925957
356 Ga0070702_100022025
357 Ga0068852_100219334
358 Ga0068859_100155547
359 Ga0068864_100086321
360 Ga0068861_100015135
361 Ga0068851_10086998
362 Ga0068863_100028265
363 Ga0068858_100023468
364 Ga0068860_100011884
365 Ga0068862_100174073
366 Ga0081455_10009254
367 Ga0081540_1001746
368 Ga0070717_10008542
369 Ga0075432_10079327
370 Ga0070715_10030994
371 Ga0070716_100025812
372 Ga0070712_100042281
373 Ga0097621_100102992
374 Ga0068871_100079893
375 Ga0075433_10028859
376 Ga0075434_100028563
377 Ga0068865_100090479
378 Ga0075436_100017420
379 Ga0097620_100009918
380 Ga0097620_100155534
381 Ga0075435_100077719
382 Ga0105240_10099685
383 Ga0105240_10116536
384 Ga0105240_10696268
385 Ga0105245_10116768
386 Ga0105247_10013626
387 Ga0105247_10048474
388 Ga0114129_10747375
389 Ga0105243_10076365
390 Ga0105241_10071831
391 Ga0105241_10179110
392 Ga0105241_10227360
393 Ga0105242_10006345
394 Ga0105248_10038882
395 Ga0105237_10008917
396 Ga0105237_10218597
397 Ga0105237_10615805
398 Ga0105238_10081165
399 Ga0105238_10848504
400 Ga0105249_10361148
401 Ga0105239_10064577
402 Ga0105239_10164011
403 Ga0105246_10010990
404 Ga0157373_10164176
405 Ga0157371_10014754
406 Ga0157370_10010580
407 Ga0157369_10012407
408 Ga0157369_10102006
409 Ga0157374_10006233
410 Ga0157374_10682154
411 Ga0157378_10014228
412 Ga0163163_10309819
413 Ga0157380_10012219
414 Ga0157377_10013192
415 Ga0157376_10007771
416 Ga0206356_11419751
417 Ga0206354_11637747
418 Ga0206353_10308023
419 Ga0206353_11123508
420 Ga0206353_11808626
421 Ga0207710_10014085
422 Ga0207710_10024940
423 Ga0207680_10014811
424 Ga0207647_10199111
425 Ga0207647_10204900
426 Ga0207685_10018388
427 Ga0207654_10064606
428 Ga0207695_10167150
429 Ga0207695_10226313
430 Ga0207671_10182148
431 Ga0207671_10352098
432 Ga0207671_10482169
433 Ga0207693_10001320
434 Ga0207660_10511397
435 Ga0207662_10050130
436 Ga0207657_10011013
437 Ga0207657_10328183
438 Ga0207681_10811121
439 Ga0207664_10179943
440 Ga0207644_10075722
441 Ga0207709_10029630
442 Ga0207670_10206872
443 Ga0207669_10066730
444 Ga0207665_10001015
445 Ga0207689_10061725
446 Ga0207679_10050405
447 Ga0207667_10203216
448 Ga0207668_10036261
449 Ga0207640_10050027
450 Ga0207703_10044077
451 Ga0207639_10452217
452 Ga0207639_10967980
453 Ga0207678_10031545
454 Ga0207678_10234536
455 Ga0207702_10128823
456 Ga0207641_10231786
457 Ga0207648_10600787
458 Ga0207674_10129415
459 Ga0207675_100002089
460 Ga0207683_10000917
461 Ga0207698_10195594
462 Ga0207698_11227013
463 Ga0268266_10194509
464 Ga0268265_10080150
465 Ga0268264_10055993
466 Ga0373948_0006301
467 Ga0373950_0034545
468 Ga0373959_0021269
469 Ga0373938_0011119
470 Ga0373928_0025901
471 Ga0373929_0084211
472 Ga0373940_0004390
473 Ga0373949_0024633
474 Ga0373951_0045513
475 Ga0373952_0003845
476 Ga0373932_0007358
477 Ga0373939_0016155
478 Ga0373954_0314773
479 Ga0373960_0120743
480 Ga0373942_0018479
481 Ga0373961_0091448
482 Ga0373931_0011900
483 Ga0373925_1046887
484 Ga0436365_0329407
485 Ga0466969_0029267
486 Ga0466972_0021758
487 Ga0466972_0059120
488 Ga0466965_0063975
489 Ga0466965_0110069
490 Ga0466965_0542607
491 Ga0466966_0008124
492 Ga0466966_0043997
493 Ga0466966_0100758
494 Ga0466966_0232151
495 Ga0466961_0010427
496 Ga0466961_0017814
497 Ga0466961_0042568
498 Ga0466961_0050216
499 Ga0466961_0119531
500 Ga0466961_0188374
501 Ga0466961_0228458
502 Ga0466961_0237748
503 Ga0466961_0284561
504 Ga0466961_0421130
505 Ga0466963_0001657
506 Ga0466963_0011647
507 Ga0466963_0014325
508 Ga0466963_0078848
509 Ga0466963_0245432
510 Ga0466963_0294923
511 Ga0466963_0358413
512 Ga0466963_0380566
513 Ga0466964_0003559
514 Ga0466964_0014072
515 Ga0466964_0062963
516 Ga0466971_0004732
517 Ga0466971_0030352
518 Ga0466971_0059052
519 Ga0466971_0082243
520 Ga0466971_0104250
521 Ga0466971_0126969
522 Ga0466968_0142704
523 Ga0466970_0008328
524 Ga0466970_0051259
525 Ga0466970_0069462
526 Ga0466970_0102276
527 Ga0466970_0126330
528 Ga0466970_0260403
529 Ga0466957_0046577
530 Ga0466957_0056207
531 Ga0466957_0065144
532 Ga0466957_0127710
533 Ga0466957_0252934
534 Ga0466957_0315147
535 Ga0466957_0679385
536 Ga0466960_0091876
537 Ga0466960_0293054
538 Ga0466960_0320099
539 Ga0466960_0441827
540 Ga0466960_0458489
541 Ga0466959_0026498
542 Ga0466959_0037140
543 Ga0466959_0134893
544 Ga0466959_0143047
545 Ga0466959_0317440
546 Ga0466959_0596889
547 Ga0466958_0024238
548 Ga0466958_0042395
549 Ga0466958_0058339
550 Ga0466958_0127599
551 Ga0466958_0395042
552 Ga0466958_0396987
553 Ga0466958_0527181
554 Ga0466967_0001205
555 Ga0466967_0001830
556 Ga0466967_0042046
557 Ga0466967_0044230
558 Ga0466967_0065649
559 Ga0466967_0080734
560 Ga0466967_0107808
561 Ga0466967_0266039
562 Ga0466967_0268443
563 Ga0466967_0397554
564 Ga0466967_0494078
565 Ga0466967_0585311
566 Ga0466967_0934124
567 Ga0495641_0220852
568 Ga0495672_0199143
569 Ga0496100_0101730
570 Ga0496101_0031392
571 Ga0496102_0000072
572 Ga0496102_0005871
573 Ga0496102_0013676
574 Ga0496102_0024595
575 Ga0496103_0000053
576 Ga0496103_0014364
577 Ga0496103_0018039
578 Ga0496103_0247700
579 Ga0496104_0282288
580 Ga0496105_0139071
581 Ga0496105_0160307
582 Ga0496107_0362473
583 Ga0496108_0224202
584 Ga0496109_0147088
585 Ga0496110_0218385
586 Ga0496110_0592665
587 Ga0496111_0218301
588 Ga0496112_0113893
589 Ga0496113_0004146
590 Ga0496114_0064159
591 Ga0496114_0344913
592 Ga0496119_0000287
593 Ga0496120_0010760
594 Ga0501031_0051342
595 Ga0501032_0092327
596 Ga0501033_0061600
597 Ga0501033_0247461
598 Ga0501034_0153340
599 Ga0501037_0267005
600 Ga0501038_0155334
601 Ga0501038_0646347
602 Ga0501043_0057328
603 Ga0501043_0790509
604 Ga0501047_0344084
605 Ga0501048_0000993
606 Ga0501048_0411085
607 Ga0501067_0214081
608 Ga0501070_0104240
609 Ga0501070_0449068
610 Ga0501070_0580843
611 Ga0501070_1027133
612 Ga0501074_0122011
613 Ga0501080_0108895
614 Ga0501035_0108870
615 Ga0501035_0162188
616 Ga0501035_0181239
617 Ga0501044_0371139
618 Ga0501044_0557639
619 nmdc:mga0n895_127508_c1
620 nmdc:mga0rr50_324806_c1
621 nmdc:mga08x19_71381_c1
622 nmdc:mga0a205_8007_c1
623 Ga0466962_0007680
624 Ga0466962_0033181
625 Ga0466962_0052883
626 Ga0466962_0080843

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

116

188

0.89

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

86

181

0.76

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

40

179

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.8147 60 183
7ypu-assembly2.cif.gz_D orfe-coa-glycylthricin complex 0.812 60 183
7ypu-assembly2.cif.gz_C orfe-coa-glycylthricin complex 0.8026 60 183
2r7h-assembly1.cif.gz_A crystal structure of a putative acetyltransferase of the gnat family (dde_3044) from desulfovibrio desulfuricans subsp. at 1.85 a resolution 0.7991 12 183
7ypv-assembly1.cif.gz_B crystal structure of ore-st-f 0.797 60 183
ID Description Score Start End Superfamily
af_O53504_27_192_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9505 36 172 3.40.630.30
5i0cA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8532 62 134 3.40.630.30
af_Q7XUY6_156_314_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8376 108 184 3.40.630.30
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8307 70 134 3.40.630.30
1y9wB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8263 60 184 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1I3YWK4-F1-model_v4 Ribosomal protein S18 acetylase RimI 0.9801 12 186 GO:0005840
GO:0016747
AF-A0A522B314-F1-model_v4 GNAT family N-acetyltransferase 0.9797 12 184 GO:0016747
AF-A0A1G7V9I6-F1-model_v4 Ribosomal protein S18 acetylase RimI 0.9792 12 187 GO:0005840
GO:0016747
AF-A0A0N0ASC2-F1-model_v4 Acetyltransferase 0.9787 17 187 GO:0016747
AF-A0A7J9Y0N1-F1-model_v4 GNAT family N-acetyltransferase 0.9786 13 185 GO:0016747

Map