F402016

General Info

Members Datasets Scaffolds Average Seq Length
313 201 313 199

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10149489|Ga0070658_101494892
Length 219
Sequence VRDSAGACPSHNVSLINRECPLSFTTEFLSEVSQIVSKLDPAAVERCVAKLAEVRARGGRLFFLGVGGSAANASHAVNDFRKIAGFEAYAPTDNVSELTARVNDESWESVFVSWLKGSRLTSKDGIVVFSVGGGDLEKNISPNLVRAVQFAKETGAAVVGIVGRSGGYTAQVADACVIVPTVNPTHVTPHSEAFQAVVWHLFVSHPALKTGQTKWESAK

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
120 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
159 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
160 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
161 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.96
Nodule 0
Rhizoplane 2.56
Rhizosphere 90.1
Stem 0
Stem Tuber 0
Unclassified 6.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10419228 3300005293 Bacteria 860
2 Ga0070658_10149489 3300005327 Unclassified 1955
3 Ga0070680_100036722 3300005336 Bacteria 3959
4 Ga0070680_100162631 3300005336 Bacteria 1876
5 Ga0070682_100013455 3300005337 Bacteria 4707
6 Ga0068868_100199612 3300005338 Bacteria 1667
7 Ga0070660_100007332 3300005339 Bacteria 7686
8 Ga0070660_100530231 3300005339 Unclassified 981
9 Ga0070689_100351759 3300005340 Bacteria 1236
10 Ga0070691_10010897 3300005341 Bacteria 4151
11 Ga0070691_10029020 3300005341 Bacteria 2587
12 Ga0070661_100035954 3300005344 Bacteria 3600
13 Ga0070661_100230370 3300005344 Bacteria 1424
14 Ga0070669_100419561 3300005353 Bacteria 1098
15 Ga0070671_100192642 3300005355 Bacteria 1728
16 Ga0070673_100037566 3300005364 Bacteria 3691
17 Ga0070667_100400547 3300005367 Bacteria 1249
18 Ga0070709_10166709 3300005434 Bacteria 1536
19 Ga0070713_100002612 3300005436 Bacteria 11768
20 Ga0070713_100091199 3300005436 Bacteria 2621
21 Ga0070713_100411883 3300005436 Bacteria 1264
22 Ga0070710_10001045 3300005437 Bacteria 13169
23 Ga0070701_10198810 3300005438 Bacteria 1183
24 Ga0070705_100117942 3300005440 Bacteria 1708
25 Ga0070700_100131056 3300005441 Bacteria 1692
26 Ga0070694_100000478 3300005444 Bacteria 21966
27 Ga0070694_100331848 3300005444 Bacteria 1173
28 Ga0070678_100272228 3300005456 Bacteria 1429
29 Ga0070662_100033512 3300005457 Bacteria 3617
30 Ga0070681_10280397 3300005458 Bacteria 1577
31 Ga0070681_10426511 3300005458 Bacteria 1238
32 Ga0070685_10188354 3300005466 Bacteria 1333
33 Ga0070707_100211303 3300005468 Bacteria 1891
34 Ga0070698_100757560 3300005471 Unclassified 914
35 Ga0070699_100012854 3300005518 Bacteria 7217
36 Ga0070679_100997944 3300005530 Bacteria 781
37 Ga0070684_100460287 3300005535 Bacteria 1176
38 Ga0070697_100318065 3300005536 Bacteria 1340
39 Ga0070697_100323777 3300005536 Unclassified 1328
40 Ga0068853_100622489 3300005539 Unclassified 1026
41 Ga0070672_100182511 3300005543 Bacteria 1749
42 Ga0070672_100431699 3300005543 Bacteria 1133
43 Ga0070695_100038228 3300005545 Bacteria 3027
44 Ga0070695_100058668 3300005545 Bacteria 2489
45 Ga0070696_100002512 3300005546 Bacteria 12144
46 Ga0070696_100235763 3300005546 Bacteria 1378
47 Ga0070696_100435914 3300005546 Bacteria 1031
48 Ga0070693_100002083 3300005547 Bacteria 9155
49 Ga0070693_100026914 3300005547 Bacteria 3109
50 Ga0070665_100002244 3300005548 Bacteria 21508
51 Ga0070704_100156348 3300005549 Bacteria 1798
52 Ga0068855_100001156 3300005563 Bacteria 32706
53 Ga0068855_100003998 3300005563 Bacteria 18007
54 Ga0068855_100604837 3300005563 Bacteria 1182
55 Ga0070664_100004765 3300005564 Bacteria 10872
56 Ga0070664_100214058 3300005564 Bacteria 1722
57 Ga0070664_100729646 3300005564 Bacteria 924
58 Ga0068854_100011152 3300005578 Bacteria 5837
59 Ga0068854_100144757 3300005578 Bacteria 1827
60 Ga0068856_100002286 3300005614 Bacteria 19772
61 Ga0068856_100005808 3300005614 Bacteria 12159
62 Ga0068856_100520967 3300005614 Bacteria 1210
63 Ga0068859_100325792 3300005617 Bacteria 1630
64 Ga0068864_100126188 3300005618 Bacteria 2294
65 Ga0068864_100236933 3300005618 Bacteria 1689
66 Ga0068864_100309712 3300005618 Bacteria 1480
67 Ga0068870_10007091 3300005840 Bacteria 4980
68 Ga0068863_100092384 3300005841 Bacteria 2871
69 Ga0068863_100593173 3300005841 Bacteria 1096
70 Ga0068858_100050910 3300005842 Unclassified 3833
71 Ga0068858_100909989 3300005842 Bacteria 860
72 Ga0068860_100296253 3300005843 Bacteria 1584
73 Ga0068862_100007069 3300005844 Bacteria 9320
74 Ga0081455_10259867 3300005937 Bacteria 1265
75 Ga0081538_10013909 3300005981 Bacteria 6341
76 Ga0070717_10027175 3300006028 Unclassified 4571
77 Ga0070715_10011561 3300006163 Unclassified 3183
78 Ga0070715_10143535 3300006163 Bacteria 1162
79 Ga0068871_100038546 3300006358 Unclassified 3818
80 Ga0075428_100103393 3300006844 Bacteria 3106
81 Ga0075430_100185548 3300006846 Bacteria 1730
82 Ga0075431_100000162 3300006847 Bacteria 46892
83 Ga0075431_100053723 3300006847 Bacteria 4153
84 Ga0075433_10292132 3300006852 Bacteria 1443
85 Ga0075433_10384277 3300006852 Bacteria 1239
86 Ga0075434_101128068 3300006871 Bacteria 797
87 Ga0068865_100116173 3300006881 Unclassified 1982
88 Ga0075436_100227167 3300006914 Bacteria 1325
89 Ga0097620_100325764 3300006931 Bacteria 1630
90 Ga0075435_100039584 3300007076 Bacteria 3762
91 Ga0105245_10157519 3300009098 Unclassified 2152
92 Ga0105245_10265378 3300009098 Bacteria 1672
93 Ga0114129_10006777 3300009147 Bacteria 16265
94 Ga0114129_10027899 3300009147 Bacteria 7995
95 Ga0105243_10116816 3300009148 Bacteria 2242
96 Ga0105242_10049394 3300009176 Unclassified 3424
97 Ga0105242_10334694 3300009176 Bacteria 1393
98 Ga0105238_10007987 3300009551 Bacteria 10586
99 Ga0105249_10050289 3300009553 Bacteria 3800
100 Ga0105249_10111740 3300009553 Bacteria 2584
101 Ga0105246_10127590 3300011119 Bacteria 1895
102 Ga0157370_10081818 3300013104 Unclassified 3038
103 Ga0157370_10083804 3300013104 Bacteria 2997
104 Ga0157370_10139500 3300013104 Bacteria 2259
105 Ga0157370_10159175 3300013104 Bacteria 2101
106 Ga0157369_10000445 3300013105 Bacteria 54768
107 Ga0157369_10581451 3300013105 Bacteria 1157
108 Ga0157374_10009326 3300013296 Bacteria 8418
109 Ga0163162_11050451 3300013306 Unclassified 922
110 Ga0157372_10093944 3300013307 Bacteria 3414
111 Ga0157375_10337244 3300013308 Bacteria 1673
112 Ga0157375_10562643 3300013308 Unclassified 1301
113 Ga0163163_10151782 3300014325 Bacteria 2360
114 Ga0157380_10145669 3300014326 Bacteria 2041
115 Ga0157376_10129280 3300014969 Bacteria 2251
116 Ga0213873_10089877 3300021358 Bacteria 871
117 Ga0213876_10001172 3300021384 Bacteria 16571
118 Ga0213876_10008517 3300021384 Bacteria 5552
119 Ga0213876_10048939 3300021384 Bacteria 2232
120 Ga0213875_10008424 3300021388 Bacteria 5285
121 Ga0213871_10004813 3300021441 Bacteria 2734
122 Ga0207685_10000729 3300025905 Bacteria 5977
123 Ga0207643_10004885 3300025908 Bacteria 7174
124 Ga0207643_10038476 3300025908 Bacteria 2686
125 Ga0207707_10002640 3300025912 Bacteria 16015
126 Ga0207707_10365143 3300025912 Bacteria 1243
127 Ga0207660_10024717 3300025917 Bacteria 4070
128 Ga0207660_10026226 3300025917 Bacteria 3967
129 Ga0207660_10200331 3300025917 Bacteria 1559
130 Ga0207657_10009385 3300025919 Bacteria 9841
131 Ga0207649_10018731 3300025920 Bacteria 3944
132 Ga0207652_10003730 3300025921 Bacteria 12504
133 Ga0207652_10654484 3300025921 Bacteria 939
134 Ga0207646_10178443 3300025922 Bacteria 1918
135 Ga0207681_11118115 3300025923 Bacteria 662
136 Ga0207694_10004858 3300025924 Bacteria 10435
137 Ga0207650_10011361 3300025925 Bacteria 6129
138 Ga0207650_10514614 3300025925 Bacteria 1001
139 Ga0207687_10249564 3300025927 Bacteria 1410
140 Ga0207700_10436064 3300025928 Bacteria 1153
141 Ga0207664_10015603 3300025929 Bacteria 5520
142 Ga0207644_10212962 3300025931 Bacteria 1529
143 Ga0207690_10005427 3300025932 Bacteria 7509
144 Ga0207706_10024138 3300025933 Bacteria 5453
145 Ga0207686_10055905 3300025934 Bacteria 2478
146 Ga0207709_10023713 3300025935 Bacteria 3495
147 Ga0207689_10071322 3300025942 Bacteria 2853
148 Ga0207679_10001260 3300025945 Bacteria 16057
149 Ga0207679_10180280 3300025945 Bacteria 1747
150 Ga0207679_10357906 3300025945 Bacteria 1274
151 Ga0207667_10039022 3300025949 Bacteria 5063
152 Ga0207667_10857741 3300025949 Bacteria 902
153 Ga0207712_10066587 3300025961 Bacteria 2575
154 Ga0207712_10561195 3300025961 Bacteria 983
155 Ga0207640_10006671 3300025981 Bacteria 6343
156 Ga0207703_10046028 3300026035 Bacteria 3512
157 Ga0207639_10092417 3300026041 Bacteria 2425
158 Ga0207639_10456016 3300026041 Unclassified 1161
159 Ga0207702_10222811 3300026078 Bacteria 1758
160 Ga0207702_10348427 3300026078 Bacteria 1416
161 Ga0207702_10908588 3300026078 Bacteria 872
162 Ga0207641_10274116 3300026088 Bacteria 1584
163 Ga0207641_10667793 3300026088 Bacteria 1022
164 Ga0207648_10589634 3300026089 Unclassified 1024
165 Ga0207676_10047969 3300026095 Bacteria 3313
166 Ga0207676_10076357 3300026095 Bacteria 2707
167 Ga0207674_10000181 3300026116 Bacteria 77248
168 Ga0207674_10023854 3300026116 Bacteria 6544
169 Ga0207675_100060818 3300026118 Bacteria 3526
170 Ga0207683_10208984 3300026121 Bacteria 1776
171 Ga0207698_11221200 3300026142 Bacteria 766
172 Ga0268266_10002062 3300028379 Bacteria 22269
173 Ga0268264_10033678 3300028381 Bacteria 4211
174 Ga0265319_1083241 3300028563 Unclassified 1014
175 Ga0265334_10076172 3300028573 Bacteria 1242
176 Ga0265318_10026562 3300028577 Bacteria 2279
177 Ga0265323_10000106 3300028653 Bacteria 48787
178 Ga0265323_10001932 3300028653 Bacteria 9777
179 Ga0265323_10002890 3300028653 Bacteria 7710
180 Ga0265323_10012403 3300028653 Bacteria 3415
181 Ga0265323_10012687 3300028653 Bacteria 3371
182 Ga0265323_10023691 3300028653 Bacteria 2339
183 Ga0265338_10000184 3300028800 Bacteria 116834
184 Ga0265338_10001238 3300028800 Bacteria 42063
185 Ga0265338_10001285 3300028800 Bacteria 41182
186 Ga0265338_10016368 3300028800 Bacteria 8075
187 Ga0265338_10018462 3300028800 Bacteria 7464
188 Ga0265338_10047381 3300028800 Bacteria 3926
189 Ga0265338_10254561 3300028800 Unclassified 1294
190 Ga0265330_10009003 3300031235 Bacteria 4765
191 Ga0265330_10096679 3300031235 Bacteria 1266
192 Ga0265332_10145123 3300031238 Bacteria 994
193 Ga0265320_10009735 3300031240 Bacteria 5767
194 Ga0265320_10013850 3300031240 Bacteria 4621
195 Ga0265320_10068653 3300031240 Bacteria 1674
196 Ga0265325_10001924 3300031241 Bacteria 14327
197 Ga0265325_10017939 3300031241 Bacteria 3929
198 Ga0265340_10000287 3300031247 Bacteria 26530
199 Ga0265340_10035584 3300031247 Bacteria 2472
200 Ga0265339_10010897 3300031249 Bacteria 5620
201 Ga0265339_10157754 3300031249 Bacteria 1143
202 Ga0265327_10001388 3300031251 Bacteria 30912
203 Ga0265316_10003170 3300031344 Bacteria 16723
204 Ga0265316_10013629 3300031344 Bacteria 7212
205 Ga0265316_10129704 3300031344 Bacteria 1900
206 Ga0265316_10221851 3300031344 Bacteria 1394
207 Ga0265316_10304077 3300031344 Bacteria 1161
208 Ga0265316_10655157 3300031344 Unclassified 742
209 Ga0307509_10000087 3300031507 Bacteria 126631
210 Ga0307509_10033159 3300031507 Bacteria 5685
211 Ga0307509_10441363 3300031507 Bacteria 997
212 Ga0265313_10003373 3300031595 Bacteria 13001
213 Ga0265313_10019475 3300031595 Bacteria 3773
214 Ga0265313_10071124 3300031595 Bacteria 1601
215 Ga0307508_10286062 3300031616 Bacteria 1242
216 Ga0265314_10037607 3300031711 Bacteria 3505
217 Ga0265342_10000138 3300031712 Bacteria 81937
218 Ga0265342_10020734 3300031712 Bacteria 4208
219 Ga0265342_10040175 3300031712 Bacteria 2838
220 Ga0307516_10029407 3300031730 Bacteria 5556
221 Ga0307516_10081840 3300031730 Bacteria 3071
222 Ga0373926_0001083 3300035083 Bacteria 8022
223 Ga0373926_0028919 3300035083 Bacteria 1947
224 Ga0373928_0080860 3300035084 Bacteria 819
225 Ga0373949_0010249 3300035090 Bacteria 2053
226 Ga0373951_0003727 3300035091 Bacteria 3678
227 Ga0373954_0182198 3300035118 Unclassified 1030
228 Ga0373943_0003158 3300035170 Bacteria 7484
229 Ga0373961_0000072 3300035241 Bacteria 54778
230 Ga0373961_0069718 3300035241 Bacteria 1085
231 Ga0373931_0060523 3300035691 Bacteria 2039
232 Ga0373931_0141056 3300035691 Bacteria 1396
233 Ga0373935_0005701 3300035692 Bacteria 7351
234 Ga0373927_0000981 3300035695 Bacteria 21691
235 Ga0373927_0243745 3300035695 Bacteria 1181
236 Ga0373933_0192616 3300035724 Bacteria 1303
237 Ga0373947_0010515 3300035725 Bacteria 5308
238 Ga0373937_0642129 3300036401 Unclassified 1007
239 Ga0373925_0000200 3300037068 Bacteria 65353
240 Ga0373925_0014250 3300037068 Bacteria 5751
241 Ga0395899_0443223 3300037312 Bacteria 852
242 Ga0436364_0529128 3300037853 Bacteria 8736
243 Ga0436364_0873228 3300037853 Bacteria 2499
244 Ga0436364_1145226 3300037853 Bacteria 2652
245 Ga0436364_1336177 3300037853 Bacteria 1170
246 Ga0436364_1498887 3300037853 Bacteria 1024
247 Ga0436365_0181741 3300039437 Bacteria 58736
248 Ga0436365_0594047 3300039437 Bacteria 17130
249 Ga0436365_0750630 3300039437 Bacteria 1908
250 Ga0436365_0913793 3300039437 Bacteria 11819
251 Ga0436360_0744089 3300039438 Bacteria 21760
252 Ga0436360_0963307 3300039438 Bacteria 6158
253 Ga0436363_0294819 3300039450 Bacteria 1407
254 Ga0436362_0124211 3300039453 Unclassified 657
255 Ga0436362_0573390 3300039453 Bacteria 983
256 Ga0439441_007171 3300042001 Bacteria 1787
257 Ga0439441_019720 3300042001 Unclassified 1229
258 Ga0439448_0003151 3300042005 Bacteria 4548
259 Ga0439455_0014470 3300042012 Bacteria 1802
260 Ga0450893_0033783 3300042532 Unclassified 919
261 Ga0451577_0028656 3300042876 Bacteria 5034
262 Ga0451577_1225268 3300042876 Unclassified 669
263 Ga0453684_0008232 3300044712 Bacteria 18796
264 Ga0453684_0009628 3300044712 Bacteria 16845
265 Ga0453684_0014726 3300044712 Bacteria 12467
266 Ga0451576_0000441 3300045051 Bacteria 94687
267 Ga0451576_0116468 3300045051 Bacteria 2782
268 Ga0451576_0129546 3300045051 Bacteria 2629
269 Ga0451576_0168319 3300045051 Bacteria 2287
270 Ga0451576_0884107 3300045051 Bacteria 938
271 Ga0466958_0321038 3300045836 Bacteria 995
272 Ga0495632_0112853 3300046519 Bacteria 1275
273 Ga0495652_0273944 3300046529 Bacteria 1239
274 Ga0495667_0077751 3300046559 Bacteria 2158
275 Ga0495657_0162317 3300046675 Bacteria 1382
276 Ga0495647_0121936 3300046681 Bacteria 1097
277 Ga0495604_0092748 3300047317 Bacteria 2236
278 Ga0495636_0114340 3300047318 Bacteria 1190
279 Ga0495680_0038565 3300047322 Bacteria 3817
280 Ga0495675_0087815 3300047444 Bacteria 1954
281 Ga0496102_0226320 3300048905 Unclassified 1763
282 Ga0496102_0444344 3300048905 Unclassified 1217
283 Ga0496106_0164877 3300048909 Bacteria 1754
284 Ga0496108_0130424 3300048911 Bacteria 2161
285 Ga0496109_0162026 3300048912 Bacteria 2096
286 Ga0496112_0166123 3300048915 Bacteria 2173
287 Ga0496115_0029984 3300048918 Unclassified 4276
288 Ga0496115_0302504 3300048918 Unclassified 1310
289 Ga0501033_0546383 3300049570 Unclassified 798
290 Ga0501040_0089814 3300049576 Bacteria 2135
291 Ga0501041_0527906 3300049577 Bacteria 752
292 Ga0501046_0294334 3300049580 Bacteria 1187
293 Ga0501048_0071583 3300049582 Bacteria 2448
294 Ga0501071_0009849 3300049587 Bacteria 6381
295 Ga0501072_0038476 3300049588 Bacteria 3754
296 Ga0501074_0130384 3300049590 Bacteria 1799
297 Ga0501076_0018121 3300049592 Bacteria 5362
298 Ga0501077_0362442 3300049593 Unclassified 925
299 Ga0501079_0041248 3300049741 Bacteria 3562
300 Ga0501079_0449492 3300049741 Unclassified 1012
301 Ga0501081_0869257 3300049743 Unclassified 679
302 nmdc:mga05p37_12344_c1 3300050507 Bacteria 10203
303 nmdc:mga05p37_39595_c2 3300050507 Bacteria 4442
304 nmdc:mga06r32_208_c1 3300050510 Bacteria 47351
305 nmdc:mga06r32_239500_c1 3300050510 Bacteria 1802
306 nmdc:mga0rr50_180520_c1 3300050513 Bacteria 1725
307 nmdc:mga0rr50_895568_c1 3300050513 Bacteria 757
308 nmdc:mga08x19_2756_c1 3300050514 Bacteria 10615
309 nmdc:mga0a205_378766_c1 3300050515 Bacteria 1280
310 Ga0495619_0241284 3300053085 Bacteria 1252
311 Ga0500555_000211 3300053103 Bacteria 27096
312 Ga0500616_0003193 3300053153 Bacteria 12759
313 Ga0500645_000284 3300053730 Bacteria 36344

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10016368 Ga0265338_100163685 178
2 3300031712 Ga0265342_10020734 Ga0265342_100207342 181
3 3300035083 Ga0373926_0028919 Ga0373926_0028919_750_1310 183
4 3300035084 Ga0373928_0080860 Ga0373928_0080860_66_626 183
5 3300035241 Ga0373961_0069718 Ga0373961_0069718_365_925 183
6 3300035691 Ga0373931_0141056 Ga0373931_0141056_135_695 183
7 3300037068 Ga0373925_0000200 Ga0373925_0000200_41844_42404 183
8 3300005336 Ga0070680_100036722 Ga0070680_1000367223 186
9 3300005530 Ga0070679_100997944 Ga0070679_1009979442 186
10 3300025917 Ga0207660_10024717 Ga0207660_100247173 186
11 3300025921 Ga0207652_10654484 Ga0207652_106544842 186
12 3300025935 Ga0207709_10023713 Ga0207709_100237134 186
13 3300025961 Ga0207712_10066587 Ga0207712_100665873 186
14 3300026116 Ga0207674_10023854 Ga0207674_100238548 186
15 3300028381 Ga0268264_10033678 Ga0268264_100336785 186
16 3300042001 Ga0439441_007171 Ga0439441_007171_1160_1759 186
17 3300039438 Ga0436360_0963307 Ga0436360_0963307_5506_6117 188
18 3300005471 Ga0070698_100757560 Ga0070698_1007575602 197
19 3300021384 Ga0213876_10008517 Ga0213876_100085176 197
20 3300039437 Ga0436365_0913793 Ga0436365_0913793_9885_10478 197
21 3300039453 Ga0436362_0124211 Ga0436362_0124211_18_611 197
22 3300049577 Ga0501041_0527906 Ga0501041_0527906_43_639 197
23 3300049580 Ga0501046_0294334 Ga0501046_0294334_538_1134 197
24 3300005327 Ga0070658_10149489 Ga0070658_101494892 198
25 3300005336 Ga0070680_100162631 Ga0070680_1001626312 198
26 3300005339 Ga0070660_100530231 Ga0070660_1005302312 198
27 3300005341 Ga0070691_10029020 Ga0070691_100290201 198
28 3300005344 Ga0070661_100035954 Ga0070661_1000359543 198
29 3300005353 Ga0070669_100419561 Ga0070669_1004195612 198
30 3300005434 Ga0070709_10166709 Ga0070709_101667092 198
31 3300005436 Ga0070713_100002612 Ga0070713_10000261210 198
32 3300005436 Ga0070713_100091199 Ga0070713_1000911992 198
33 3300005436 Ga0070713_100411883 Ga0070713_1004118832 198
34 3300005437 Ga0070710_10001045 Ga0070710_100010454 198
35 3300005456 Ga0070678_100272228 Ga0070678_1002722282 198
36 3300005458 Ga0070681_10280397 Ga0070681_102803972 198
37 3300005466 Ga0070685_10188354 Ga0070685_101883542 198
38 3300005468 Ga0070707_100211303 Ga0070707_1002113033 198
39 3300005536 Ga0070697_100318065 Ga0070697_1003180653 198
40 3300005536 Ga0070697_100323777 Ga0070697_1003237772 198
41 3300005539 Ga0068853_100622489 Ga0068853_1006224892 198
42 3300005546 Ga0070696_100235763 Ga0070696_1002357632 198
43 3300005563 Ga0068855_100003998 Ga0068855_10000399813 198
44 3300005563 Ga0068855_100604837 Ga0068855_1006048372 198
45 3300005564 Ga0070664_100214058 Ga0070664_1002140581 198
46 3300005614 Ga0068856_100005808 Ga0068856_10000580810 198
47 3300005614 Ga0068856_100520967 Ga0068856_1005209672 198
48 3300005618 Ga0068864_100309712 Ga0068864_1003097122 198
49 3300005841 Ga0068863_100092384 Ga0068863_1000923842 198
50 3300005842 Ga0068858_100050910 Ga0068858_1000509102 198
51 3300005842 Ga0068858_100909989 Ga0068858_1009099892 198
52 3300005937 Ga0081455_10259867 Ga0081455_102598672 198
53 3300006028 Ga0070717_10027175 Ga0070717_100271754 198
54 3300006163 Ga0070715_10011561 Ga0070715_100115614 198
55 3300006163 Ga0070715_10143535 Ga0070715_101435351 198
56 3300006358 Ga0068871_100038546 Ga0068871_1000385464 198
57 3300006852 Ga0075433_10384277 Ga0075433_103842772 198
58 3300006881 Ga0068865_100116173 Ga0068865_1001161733 198
59 3300009098 Ga0105245_10157519 Ga0105245_101575191 198
60 3300009176 Ga0105242_10049394 Ga0105242_100493942 198
61 3300009551 Ga0105238_10007987 Ga0105238_100079875 198
62 3300013104 Ga0157370_10081818 Ga0157370_100818183 198
63 3300013104 Ga0157370_10083804 Ga0157370_100838044 198
64 3300013104 Ga0157370_10139500 Ga0157370_101395003 198
65 3300013104 Ga0157370_10159175 Ga0157370_101591752 198
66 3300013105 Ga0157369_10000445 Ga0157369_1000044512 198
67 3300013296 Ga0157374_10009326 Ga0157374_100093264 198
68 3300013306 Ga0163162_11050451 Ga0163162_110504512 198
69 3300013307 Ga0157372_10093944 Ga0157372_100939442 198
70 3300013308 Ga0157375_10562643 Ga0157375_105626432 198
71 3300021384 Ga0213876_10001172 Ga0213876_1000117212 198
72 3300021384 Ga0213876_10048939 Ga0213876_100489392 198
73 3300025905 Ga0207685_10000729 Ga0207685_100007296 198
74 3300025917 Ga0207660_10200331 Ga0207660_102003312 198
75 3300025922 Ga0207646_10178443 Ga0207646_101784432 198
76 3300025923 Ga0207681_11118115 Ga0207681_111181151 198
77 3300025924 Ga0207694_10004858 Ga0207694_100048589 198
78 3300025925 Ga0207650_10514614 Ga0207650_105146142 198
79 3300025928 Ga0207700_10436064 Ga0207700_104360641 198
80 3300025929 Ga0207664_10015603 Ga0207664_100156034 198
81 3300025934 Ga0207686_10055905 Ga0207686_100559052 198
82 3300025945 Ga0207679_10180280 Ga0207679_101802802 198
83 3300026035 Ga0207703_10046028 Ga0207703_100460283 198
84 3300026041 Ga0207639_10456016 Ga0207639_104560162 198
85 3300026078 Ga0207702_10348427 Ga0207702_103484272 198
86 3300026078 Ga0207702_10908588 Ga0207702_109085882 198
87 3300026088 Ga0207641_10274116 Ga0207641_102741162 198
88 3300026089 Ga0207648_10589634 Ga0207648_105896342 198
89 3300026121 Ga0207683_10208984 Ga0207683_102089842 198
90 3300026142 Ga0207698_11221200 Ga0207698_112212001 198
91 3300028563 Ga0265319_1083241 Ga0265319_10832412 198
92 3300028573 Ga0265334_10076172 Ga0265334_100761722 198
93 3300028577 Ga0265318_10026562 Ga0265318_100265623 198
94 3300028653 Ga0265323_10000106 Ga0265323_1000010631 198
95 3300028653 Ga0265323_10001932 Ga0265323_100019324 198
96 3300028653 Ga0265323_10002890 Ga0265323_100028906 198
97 3300028653 Ga0265323_10012403 Ga0265323_100124032 198
98 3300028653 Ga0265323_10012687 Ga0265323_100126874 198
99 3300028653 Ga0265323_10023691 Ga0265323_100236912 198
100 3300028800 Ga0265338_10000184 Ga0265338_1000018437 198
101 3300028800 Ga0265338_10001238 Ga0265338_1000123816 198
102 3300028800 Ga0265338_10001285 Ga0265338_1000128521 198
103 3300028800 Ga0265338_10018462 Ga0265338_100184624 198
104 3300028800 Ga0265338_10254561 Ga0265338_102545612 198
105 3300031235 Ga0265330_10009003 Ga0265330_100090035 198
106 3300031235 Ga0265330_10096679 Ga0265330_100966792 198
107 3300031238 Ga0265332_10145123 Ga0265332_101451232 198
108 3300031240 Ga0265320_10009735 Ga0265320_100097356 198
109 3300031240 Ga0265320_10013850 Ga0265320_100138504 198
110 3300031240 Ga0265320_10068653 Ga0265320_100686533 198
111 3300031241 Ga0265325_10001924 Ga0265325_100019242 198
112 3300031241 Ga0265325_10017939 Ga0265325_100179392 198
113 3300031247 Ga0265340_10000287 Ga0265340_1000028719 198
114 3300031247 Ga0265340_10035584 Ga0265340_100355843 198
115 3300031249 Ga0265339_10010897 Ga0265339_100108974 198
116 3300031249 Ga0265339_10157754 Ga0265339_101577542 198
117 3300031251 Ga0265327_10001388 Ga0265327_1000138818 198
118 3300031344 Ga0265316_10003170 Ga0265316_1000317015 198
119 3300031344 Ga0265316_10013629 Ga0265316_100136292 198
120 3300031344 Ga0265316_10129704 Ga0265316_101297042 198
121 3300031344 Ga0265316_10221851 Ga0265316_102218511 198
122 3300031344 Ga0265316_10304077 Ga0265316_103040771 198
123 3300031344 Ga0265316_10655157 Ga0265316_106551571 198
124 3300031595 Ga0265313_10003373 Ga0265313_1000337311 198
125 3300031595 Ga0265313_10019475 Ga0265313_100194755 198
126 3300031595 Ga0265313_10071124 Ga0265313_100711241 198
127 3300031711 Ga0265314_10037607 Ga0265314_100376074 198
128 3300031712 Ga0265342_10000138 Ga0265342_1000013820 198
129 3300031712 Ga0265342_10040175 Ga0265342_100401754 198
130 3300035118 Ga0373954_0182198 Ga0373954_0182198_308_904 198
131 3300035695 Ga0373927_0243745 Ga0373927_0243745_108_704 198
132 3300035724 Ga0373933_0192616 Ga0373933_0192616_253_849 198
133 3300036401 Ga0373937_0642129 Ga0373937_0642129_182_778 198
134 3300037312 Ga0395899_0443223 Ga0395899_0443223_192_788 198
135 3300037853 Ga0436364_1336177 Ga0436364_1336177_530_1132 198
136 3300037853 Ga0436364_1498887 Ga0436364_1498887_253_852 198
137 3300039437 Ga0436365_0181741 Ga0436365_0181741_57252_57848 198
138 3300039437 Ga0436365_0594047 Ga0436365_0594047_14143_14742 198
139 3300039450 Ga0436363_0294819 Ga0436363_0294819_457_1053 198
140 3300042876 Ga0451577_1225268 Ga0451577_1225268_35_634 198
141 3300044712 Ga0453684_0014726 Ga0453684_0014726_2802_3398 198
142 3300045051 Ga0451576_0000441 Ga0451576_0000441_40140_40736 198
143 3300045051 Ga0451576_0168319 Ga0451576_0168319_1396_2001 198
144 3300045836 Ga0466958_0321038 Ga0466958_0321038_234_830 198
145 3300046529 Ga0495652_0273944 Ga0495652_0273944_292_909 198
146 3300046559 Ga0495667_0077751 Ga0495667_0077751_1211_1807 198
147 3300046675 Ga0495657_0162317 Ga0495657_0162317_105_701 198
148 3300047317 Ga0495604_0092748 Ga0495604_0092748_1245_1862 198
149 3300047322 Ga0495680_0038565 Ga0495680_0038565_1012_1629 198
150 3300047444 Ga0495675_0087815 Ga0495675_0087815_872_1489 198
151 3300048905 Ga0496102_0226320 Ga0496102_0226320_580_1176 198
152 3300048905 Ga0496102_0444344 Ga0496102_0444344_313_912 198
153 3300048918 Ga0496115_0029984 Ga0496115_0029984_617_1213 198
154 3300048918 Ga0496115_0302504 Ga0496115_0302504_143_745 198
155 3300049570 Ga0501033_0546383 Ga0501033_0546383_22_618 198
156 3300049582 Ga0501048_0071583 Ga0501048_0071583_1570_2166 198
157 3300049587 Ga0501071_0009849 Ga0501071_0009849_1021_1617 198
158 3300049588 Ga0501072_0038476 Ga0501072_0038476_930_1526 198
159 3300049592 Ga0501076_0018121 Ga0501076_0018121_2849_3445 198
160 3300049593 Ga0501077_0362442 Ga0501077_0362442_120_716 198
161 3300049741 Ga0501079_0449492 Ga0501079_0449492_234_830 198
162 3300049743 Ga0501081_0869257 Ga0501081_0869257_55_651 198
163 3300050513 nmdc:mga0rr50_180520_c1 nmdc:mga0rr50_180520_c1_69_665 198
164 3300050514 nmdc:mga08x19_2756_c1 nmdc:mga08x19_2756_c1_577_1185 198
165 3300050515 nmdc:mga0a205_378766_c1 nmdc:mga0a205_378766_c1_546_1145 198
166 3300053085 Ga0495619_0241284 Ga0495619_0241284_320_937 198
167 3300053103 Ga0500555_000211 Ga0500555_000211_4372_4974 198
168 3300053153 Ga0500616_0003193 Ga0500616_0003193_3097_3702 198
169 3300053730 Ga0500645_000284 Ga0500645_000284_4372_4968 198
170 3300005293 Ga0065715_10419228 Ga0065715_104192281 199
171 3300005337 Ga0070682_100013455 Ga0070682_1000134553 199
172 3300005338 Ga0068868_100199612 Ga0068868_1001996121 199
173 3300005339 Ga0070660_100007332 Ga0070660_1000073326 199
174 3300005340 Ga0070689_100351759 Ga0070689_1003517592 199
175 3300005341 Ga0070691_10010897 Ga0070691_100108973 199
176 3300005344 Ga0070661_100230370 Ga0070661_1002303702 199
177 3300005355 Ga0070671_100192642 Ga0070671_1001926422 199
178 3300005364 Ga0070673_100037566 Ga0070673_1000375662 199
179 3300005367 Ga0070667_100400547 Ga0070667_1004005472 199
180 3300005438 Ga0070701_10198810 Ga0070701_101988101 199
181 3300005440 Ga0070705_100117942 Ga0070705_1001179422 199
182 3300005441 Ga0070700_100131056 Ga0070700_1001310562 199
183 3300005444 Ga0070694_100000478 Ga0070694_10000047819 199
184 3300005444 Ga0070694_100331848 Ga0070694_1003318482 199
185 3300005457 Ga0070662_100033512 Ga0070662_1000335121 199
186 3300005458 Ga0070681_10426511 Ga0070681_104265112 199
187 3300005518 Ga0070699_100012854 Ga0070699_1000128547 199
188 3300005535 Ga0070684_100460287 Ga0070684_1004602872 199
189 3300005543 Ga0070672_100182511 Ga0070672_1001825113 199
190 3300005543 Ga0070672_100431699 Ga0070672_1004316993 199
191 3300005545 Ga0070695_100038228 Ga0070695_1000382283 199
192 3300005545 Ga0070695_100058668 Ga0070695_1000586682 199
193 3300005546 Ga0070696_100002512 Ga0070696_1000025122 199
194 3300005546 Ga0070696_100435914 Ga0070696_1004359142 199
195 3300005547 Ga0070693_100002083 Ga0070693_1000020838 199
196 3300005547 Ga0070693_100026914 Ga0070693_1000269143 199
197 3300005548 Ga0070665_100002244 Ga0070665_10000224423 199
198 3300005549 Ga0070704_100156348 Ga0070704_1001563482 199
199 3300005563 Ga0068855_100001156 Ga0068855_10000115610 199
200 3300005564 Ga0070664_100004765 Ga0070664_1000047653 199
201 3300005564 Ga0070664_100729646 Ga0070664_1007296461 199
202 3300005578 Ga0068854_100011152 Ga0068854_1000111523 199
203 3300005578 Ga0068854_100144757 Ga0068854_1001447573 199
204 3300005614 Ga0068856_100002286 Ga0068856_10000228610 199
205 3300005617 Ga0068859_100325792 Ga0068859_1003257923 199
206 3300005618 Ga0068864_100126188 Ga0068864_1001261883 199
207 3300005618 Ga0068864_100236933 Ga0068864_1002369333 199
208 3300005840 Ga0068870_10007091 Ga0068870_100070912 199
209 3300005841 Ga0068863_100593173 Ga0068863_1005931732 199
210 3300005843 Ga0068860_100296253 Ga0068860_1002962533 199
211 3300005844 Ga0068862_100007069 Ga0068862_1000070698 199
212 3300005981 Ga0081538_10013909 Ga0081538_100139095 199
213 3300006844 Ga0075428_100103393 Ga0075428_1001033933 199
214 3300006846 Ga0075430_100185548 Ga0075430_1001855482 199
215 3300006847 Ga0075431_100000162 Ga0075431_10000016220 199
216 3300006847 Ga0075431_100053723 Ga0075431_1000537232 199
217 3300006852 Ga0075433_10292132 Ga0075433_102921322 199
218 3300006871 Ga0075434_101128068 Ga0075434_1011280682 199
219 3300006914 Ga0075436_100227167 Ga0075436_1002271672 199
220 3300006931 Ga0097620_100325764 Ga0097620_1003257643 199
221 3300007076 Ga0075435_100039584 Ga0075435_1000395844 199
222 3300009098 Ga0105245_10265378 Ga0105245_102653782 199
223 3300009147 Ga0114129_10006777 Ga0114129_100067779 199
224 3300009147 Ga0114129_10027899 Ga0114129_100278993 199
225 3300009148 Ga0105243_10116816 Ga0105243_101168163 199
226 3300009176 Ga0105242_10334694 Ga0105242_103346943 199
227 3300009553 Ga0105249_10050289 Ga0105249_100502892 199
228 3300009553 Ga0105249_10111740 Ga0105249_101117402 199
229 3300011119 Ga0105246_10127590 Ga0105246_101275902 199
230 3300013105 Ga0157369_10581451 Ga0157369_105814512 199
231 3300013308 Ga0157375_10337244 Ga0157375_103372442 199
232 3300014325 Ga0163163_10151782 Ga0163163_101517821 199
233 3300014326 Ga0157380_10145669 Ga0157380_101456693 199
234 3300014969 Ga0157376_10129280 Ga0157376_101292802 199
235 3300021358 Ga0213873_10089877 Ga0213873_100898772 199
236 3300021388 Ga0213875_10008424 Ga0213875_100084244 199
237 3300021441 Ga0213871_10004813 Ga0213871_100048133 199
238 3300025908 Ga0207643_10004885 Ga0207643_100048853 199
239 3300025908 Ga0207643_10038476 Ga0207643_100384762 199
240 3300025912 Ga0207707_10002640 Ga0207707_1000264017 199
241 3300025912 Ga0207707_10365143 Ga0207707_103651432 199
242 3300025917 Ga0207660_10026226 Ga0207660_100262265 199
243 3300025919 Ga0207657_10009385 Ga0207657_100093856 199
244 3300025920 Ga0207649_10018731 Ga0207649_100187313 199
245 3300025921 Ga0207652_10003730 Ga0207652_1000373010 199
246 3300025925 Ga0207650_10011361 Ga0207650_100113616 199
247 3300025927 Ga0207687_10249564 Ga0207687_102495643 199
248 3300025931 Ga0207644_10212962 Ga0207644_102129622 199
249 3300025932 Ga0207690_10005427 Ga0207690_100054278 199
250 3300025933 Ga0207706_10024138 Ga0207706_100241384 199
251 3300025942 Ga0207689_10071322 Ga0207689_100713223 199
252 3300025945 Ga0207679_10001260 Ga0207679_1000126010 199
253 3300025945 Ga0207679_10357906 Ga0207679_103579062 199
254 3300025949 Ga0207667_10039022 Ga0207667_100390225 199
255 3300025949 Ga0207667_10857741 Ga0207667_108577412 199
256 3300025961 Ga0207712_10561195 Ga0207712_105611952 199
257 3300025981 Ga0207640_10006671 Ga0207640_100066713 199
258 3300026041 Ga0207639_10092417 Ga0207639_100924173 199
259 3300026078 Ga0207702_10222811 Ga0207702_102228113 199
260 3300026088 Ga0207641_10667793 Ga0207641_106677932 199
261 3300026095 Ga0207676_10047969 Ga0207676_100479694 199
262 3300026095 Ga0207676_10076357 Ga0207676_100763573 199
263 3300026116 Ga0207674_10000181 Ga0207674_1000018120 199
264 3300026118 Ga0207675_100060818 Ga0207675_1000608186 199
265 3300028379 Ga0268266_10002062 Ga0268266_1000206216 199
266 3300028800 Ga0265338_10047381 Ga0265338_100473813 199
267 3300031507 Ga0307509_10000087 Ga0307509_1000008750 199
268 3300031507 Ga0307509_10033159 Ga0307509_100331593 199
269 3300031507 Ga0307509_10441363 Ga0307509_104413631 199
270 3300031616 Ga0307508_10286062 Ga0307508_102860622 199
271 3300031730 Ga0307516_10029407 Ga0307516_100294075 199
272 3300031730 Ga0307516_10081840 Ga0307516_100818403 199
273 3300035083 Ga0373926_0001083 Ga0373926_0001083_2544_3143 199
274 3300035090 Ga0373949_0010249 Ga0373949_0010249_1202_1801 199
275 3300035091 Ga0373951_0003727 Ga0373951_0003727_1495_2094 199
276 3300035170 Ga0373943_0003158 Ga0373943_0003158_1899_2498 199
277 3300035241 Ga0373961_0000072 Ga0373961_0000072_9672_10271 199
278 3300035691 Ga0373931_0060523 Ga0373931_0060523_797_1396 199
279 3300035692 Ga0373935_0005701 Ga0373935_0005701_4204_4803 199
280 3300035695 Ga0373927_0000981 Ga0373927_0000981_16889_17488 199
281 3300035725 Ga0373947_0010515 Ga0373947_0010515_1705_2304 199
282 3300037068 Ga0373925_0014250 Ga0373925_0014250_2298_2897 199
283 3300037853 Ga0436364_0529128 Ga0436364_0529128_7760_8380 199
284 3300037853 Ga0436364_0873228 Ga0436364_0873228_216_836 199
285 3300037853 Ga0436364_1145226 Ga0436364_1145226_1192_1791 199
286 3300039437 Ga0436365_0750630 Ga0436365_0750630_668_1324 199
287 3300039438 Ga0436360_0744089 Ga0436360_0744089_366_977 199
288 3300039453 Ga0436362_0573390 Ga0436362_0573390_162_773 199
289 3300042001 Ga0439441_019720 Ga0439441_019720_34_633 199
290 3300042005 Ga0439448_0003151 Ga0439448_0003151_629_1228 199
291 3300042012 Ga0439455_0014470 Ga0439455_0014470_1044_1643 199
292 3300042532 Ga0450893_0033783 Ga0450893_0033783_245_844 199
293 3300042876 Ga0451577_0028656 Ga0451577_0028656_1006_1605 199
294 3300044712 Ga0453684_0008232 Ga0453684_0008232_5222_5830 199
295 3300044712 Ga0453684_0009628 Ga0453684_0009628_9690_10298 199
296 3300045051 Ga0451576_0116468 Ga0451576_0116468_634_1233 199
297 3300045051 Ga0451576_0129546 Ga0451576_0129546_460_1059 199
298 3300045051 Ga0451576_0884107 Ga0451576_0884107_231_830 199
299 3300046519 Ga0495632_0112853 Ga0495632_0112853_650_1249 199
300 3300046681 Ga0495647_0121936 Ga0495647_0121936_285_884 199
301 3300047318 Ga0495636_0114340 Ga0495636_0114340_401_1000 199
302 3300048909 Ga0496106_0164877 Ga0496106_0164877_442_1041 199
303 3300048911 Ga0496108_0130424 Ga0496108_0130424_982_1590 199
304 3300048912 Ga0496109_0162026 Ga0496109_0162026_489_1088 199
305 3300048915 Ga0496112_0166123 Ga0496112_0166123_26_658 199
306 3300049576 Ga0501040_0089814 Ga0501040_0089814_276_977 199
307 3300049590 Ga0501074_0130384 Ga0501074_0130384_208_909 199
308 3300049741 Ga0501079_0041248 Ga0501079_0041248_91_792 199
309 3300050507 nmdc:mga05p37_12344_c1 nmdc:mga05p37_12344_c1_476_1075 199
310 3300050507 nmdc:mga05p37_39595_c2 nmdc:mga05p37_39595_c2_2036_2635 199
311 3300050510 nmdc:mga06r32_208_c1 nmdc:mga06r32_208_c1_15942_16541 199
312 3300050510 nmdc:mga06r32_239500_c1 nmdc:mga06r32_239500_c1_1180_1779 199
313 3300050513 nmdc:mga0rr50_895568_c1 nmdc:mga0rr50_895568_c1_63_662 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13580

SIS_2

SIS domain

24

163

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bjz-assembly1.cif.gz_C crystal structure of pseudomonas aeruginosa phosphoheptose isomerase 0.8703 8 182
5i01-assembly1.cif.gz_C structure of phosphoheptose isomerase gmha from neisseria gonorrhoeae 0.8452 4 182
1x94-assembly1.cif.gz_A crystal structure of a hypothetical protein 0.8426 2 182
2i2w-assembly3.cif.gz_B crystal structure of escherichia coli phosphoheptose isomerase 0.8369 2 182
2i22-assembly1.cif.gz_A crystal structure of escherichia coli phosphoheptose isomerase in complex with reaction substrate sedoheptulose 7-phosphate 0.8367 2 182
ID Description Score Start End Superfamily
5i01C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8452 4 182 3.40.50.10490
2i2wB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8369 2 182 3.40.50.10490
2x3yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8263 3 182 3.40.50.10490
3trjC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8156 3 182 3.40.50.10490
af_P9WGG1_3_194_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8079 1 182 3.40.50.10490
ID Description Score Start End GO Terms
AF-A0A212KGQ9-F1-model_v4 Sugar isomerase family protein 0.9728 87 196 GO:0016853
GO:0097367
GO:1901135
AF-A0A7V8T0J9-F1-model_v4 Sugar isomerase 0.97 88 194 GO:0016853
GO:0097367
GO:1901135
AF-A0A7V8T0J9-F1-model_v4 Sugar isomerase 0.9612 88 194 GO:0016853
GO:0097367
GO:1901135
AF-A0A2V5XBY7-F1-model_v4 Sugar isomerase 0.9579 98 194 GO:0016853
GO:0097367
GO:1901135
AF-A0A1G1W783-F1-model_v4 SIS domain-containing protein 0.9531 107 191 GO:0097367
GO:1901135

Feature Viewer

pLDDT pTM Quality
91.67 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map