F402016
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 313 | 201 | 313 | 199 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10149489|Ga0070658_101494892 |
| Length | 219 |
| Sequence | VRDSAGACPSHNVSLINRECPLSFTTEFLSEVSQIVSKLDPAAVERCVAKLAEVRARGGRLFFLGVGGSAANASHAVNDFRKIAGFEAYAPTDNVSELTARVNDESWESVFVSWLKGSRLTSKDGIVVFSVGGGDLEKNISPNLVRAVQFAKETGAAVVGIVGRSGGYTAQVADACVIVPTVNPTHVTPHSEAFQAVVWHLFVSHPALKTGQTKWESAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 80 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 81 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 82 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 83 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 120 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 122 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 123 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 127 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 128 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 129 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 131 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 133 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 135 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 137 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 138 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 139 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 140 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 141 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 142 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 143 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 144 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 145 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 146 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 148 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 149 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 150 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 153 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 154 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 155 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 156 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 157 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 158 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 159 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 160 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 161 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 162 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 163 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 164 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 165 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 166 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 176 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 177 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 180 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 181 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 200 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 201 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.96 |
| Nodule | 0 |
| Rhizoplane | 2.56 |
| Rhizosphere | 90.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10419228 | 3300005293 | Bacteria | 860 |
| 2 | Ga0070658_10149489 | 3300005327 | Unclassified | 1955 |
| 3 | Ga0070680_100036722 | 3300005336 | Bacteria | 3959 |
| 4 | Ga0070680_100162631 | 3300005336 | Bacteria | 1876 |
| 5 | Ga0070682_100013455 | 3300005337 | Bacteria | 4707 |
| 6 | Ga0068868_100199612 | 3300005338 | Bacteria | 1667 |
| 7 | Ga0070660_100007332 | 3300005339 | Bacteria | 7686 |
| 8 | Ga0070660_100530231 | 3300005339 | Unclassified | 981 |
| 9 | Ga0070689_100351759 | 3300005340 | Bacteria | 1236 |
| 10 | Ga0070691_10010897 | 3300005341 | Bacteria | 4151 |
| 11 | Ga0070691_10029020 | 3300005341 | Bacteria | 2587 |
| 12 | Ga0070661_100035954 | 3300005344 | Bacteria | 3600 |
| 13 | Ga0070661_100230370 | 3300005344 | Bacteria | 1424 |
| 14 | Ga0070669_100419561 | 3300005353 | Bacteria | 1098 |
| 15 | Ga0070671_100192642 | 3300005355 | Bacteria | 1728 |
| 16 | Ga0070673_100037566 | 3300005364 | Bacteria | 3691 |
| 17 | Ga0070667_100400547 | 3300005367 | Bacteria | 1249 |
| 18 | Ga0070709_10166709 | 3300005434 | Bacteria | 1536 |
| 19 | Ga0070713_100002612 | 3300005436 | Bacteria | 11768 |
| 20 | Ga0070713_100091199 | 3300005436 | Bacteria | 2621 |
| 21 | Ga0070713_100411883 | 3300005436 | Bacteria | 1264 |
| 22 | Ga0070710_10001045 | 3300005437 | Bacteria | 13169 |
| 23 | Ga0070701_10198810 | 3300005438 | Bacteria | 1183 |
| 24 | Ga0070705_100117942 | 3300005440 | Bacteria | 1708 |
| 25 | Ga0070700_100131056 | 3300005441 | Bacteria | 1692 |
| 26 | Ga0070694_100000478 | 3300005444 | Bacteria | 21966 |
| 27 | Ga0070694_100331848 | 3300005444 | Bacteria | 1173 |
| 28 | Ga0070678_100272228 | 3300005456 | Bacteria | 1429 |
| 29 | Ga0070662_100033512 | 3300005457 | Bacteria | 3617 |
| 30 | Ga0070681_10280397 | 3300005458 | Bacteria | 1577 |
| 31 | Ga0070681_10426511 | 3300005458 | Bacteria | 1238 |
| 32 | Ga0070685_10188354 | 3300005466 | Bacteria | 1333 |
| 33 | Ga0070707_100211303 | 3300005468 | Bacteria | 1891 |
| 34 | Ga0070698_100757560 | 3300005471 | Unclassified | 914 |
| 35 | Ga0070699_100012854 | 3300005518 | Bacteria | 7217 |
| 36 | Ga0070679_100997944 | 3300005530 | Bacteria | 781 |
| 37 | Ga0070684_100460287 | 3300005535 | Bacteria | 1176 |
| 38 | Ga0070697_100318065 | 3300005536 | Bacteria | 1340 |
| 39 | Ga0070697_100323777 | 3300005536 | Unclassified | 1328 |
| 40 | Ga0068853_100622489 | 3300005539 | Unclassified | 1026 |
| 41 | Ga0070672_100182511 | 3300005543 | Bacteria | 1749 |
| 42 | Ga0070672_100431699 | 3300005543 | Bacteria | 1133 |
| 43 | Ga0070695_100038228 | 3300005545 | Bacteria | 3027 |
| 44 | Ga0070695_100058668 | 3300005545 | Bacteria | 2489 |
| 45 | Ga0070696_100002512 | 3300005546 | Bacteria | 12144 |
| 46 | Ga0070696_100235763 | 3300005546 | Bacteria | 1378 |
| 47 | Ga0070696_100435914 | 3300005546 | Bacteria | 1031 |
| 48 | Ga0070693_100002083 | 3300005547 | Bacteria | 9155 |
| 49 | Ga0070693_100026914 | 3300005547 | Bacteria | 3109 |
| 50 | Ga0070665_100002244 | 3300005548 | Bacteria | 21508 |
| 51 | Ga0070704_100156348 | 3300005549 | Bacteria | 1798 |
| 52 | Ga0068855_100001156 | 3300005563 | Bacteria | 32706 |
| 53 | Ga0068855_100003998 | 3300005563 | Bacteria | 18007 |
| 54 | Ga0068855_100604837 | 3300005563 | Bacteria | 1182 |
| 55 | Ga0070664_100004765 | 3300005564 | Bacteria | 10872 |
| 56 | Ga0070664_100214058 | 3300005564 | Bacteria | 1722 |
| 57 | Ga0070664_100729646 | 3300005564 | Bacteria | 924 |
| 58 | Ga0068854_100011152 | 3300005578 | Bacteria | 5837 |
| 59 | Ga0068854_100144757 | 3300005578 | Bacteria | 1827 |
| 60 | Ga0068856_100002286 | 3300005614 | Bacteria | 19772 |
| 61 | Ga0068856_100005808 | 3300005614 | Bacteria | 12159 |
| 62 | Ga0068856_100520967 | 3300005614 | Bacteria | 1210 |
| 63 | Ga0068859_100325792 | 3300005617 | Bacteria | 1630 |
| 64 | Ga0068864_100126188 | 3300005618 | Bacteria | 2294 |
| 65 | Ga0068864_100236933 | 3300005618 | Bacteria | 1689 |
| 66 | Ga0068864_100309712 | 3300005618 | Bacteria | 1480 |
| 67 | Ga0068870_10007091 | 3300005840 | Bacteria | 4980 |
| 68 | Ga0068863_100092384 | 3300005841 | Bacteria | 2871 |
| 69 | Ga0068863_100593173 | 3300005841 | Bacteria | 1096 |
| 70 | Ga0068858_100050910 | 3300005842 | Unclassified | 3833 |
| 71 | Ga0068858_100909989 | 3300005842 | Bacteria | 860 |
| 72 | Ga0068860_100296253 | 3300005843 | Bacteria | 1584 |
| 73 | Ga0068862_100007069 | 3300005844 | Bacteria | 9320 |
| 74 | Ga0081455_10259867 | 3300005937 | Bacteria | 1265 |
| 75 | Ga0081538_10013909 | 3300005981 | Bacteria | 6341 |
| 76 | Ga0070717_10027175 | 3300006028 | Unclassified | 4571 |
| 77 | Ga0070715_10011561 | 3300006163 | Unclassified | 3183 |
| 78 | Ga0070715_10143535 | 3300006163 | Bacteria | 1162 |
| 79 | Ga0068871_100038546 | 3300006358 | Unclassified | 3818 |
| 80 | Ga0075428_100103393 | 3300006844 | Bacteria | 3106 |
| 81 | Ga0075430_100185548 | 3300006846 | Bacteria | 1730 |
| 82 | Ga0075431_100000162 | 3300006847 | Bacteria | 46892 |
| 83 | Ga0075431_100053723 | 3300006847 | Bacteria | 4153 |
| 84 | Ga0075433_10292132 | 3300006852 | Bacteria | 1443 |
| 85 | Ga0075433_10384277 | 3300006852 | Bacteria | 1239 |
| 86 | Ga0075434_101128068 | 3300006871 | Bacteria | 797 |
| 87 | Ga0068865_100116173 | 3300006881 | Unclassified | 1982 |
| 88 | Ga0075436_100227167 | 3300006914 | Bacteria | 1325 |
| 89 | Ga0097620_100325764 | 3300006931 | Bacteria | 1630 |
| 90 | Ga0075435_100039584 | 3300007076 | Bacteria | 3762 |
| 91 | Ga0105245_10157519 | 3300009098 | Unclassified | 2152 |
| 92 | Ga0105245_10265378 | 3300009098 | Bacteria | 1672 |
| 93 | Ga0114129_10006777 | 3300009147 | Bacteria | 16265 |
| 94 | Ga0114129_10027899 | 3300009147 | Bacteria | 7995 |
| 95 | Ga0105243_10116816 | 3300009148 | Bacteria | 2242 |
| 96 | Ga0105242_10049394 | 3300009176 | Unclassified | 3424 |
| 97 | Ga0105242_10334694 | 3300009176 | Bacteria | 1393 |
| 98 | Ga0105238_10007987 | 3300009551 | Bacteria | 10586 |
| 99 | Ga0105249_10050289 | 3300009553 | Bacteria | 3800 |
| 100 | Ga0105249_10111740 | 3300009553 | Bacteria | 2584 |
| 101 | Ga0105246_10127590 | 3300011119 | Bacteria | 1895 |
| 102 | Ga0157370_10081818 | 3300013104 | Unclassified | 3038 |
| 103 | Ga0157370_10083804 | 3300013104 | Bacteria | 2997 |
| 104 | Ga0157370_10139500 | 3300013104 | Bacteria | 2259 |
| 105 | Ga0157370_10159175 | 3300013104 | Bacteria | 2101 |
| 106 | Ga0157369_10000445 | 3300013105 | Bacteria | 54768 |
| 107 | Ga0157369_10581451 | 3300013105 | Bacteria | 1157 |
| 108 | Ga0157374_10009326 | 3300013296 | Bacteria | 8418 |
| 109 | Ga0163162_11050451 | 3300013306 | Unclassified | 922 |
| 110 | Ga0157372_10093944 | 3300013307 | Bacteria | 3414 |
| 111 | Ga0157375_10337244 | 3300013308 | Bacteria | 1673 |
| 112 | Ga0157375_10562643 | 3300013308 | Unclassified | 1301 |
| 113 | Ga0163163_10151782 | 3300014325 | Bacteria | 2360 |
| 114 | Ga0157380_10145669 | 3300014326 | Bacteria | 2041 |
| 115 | Ga0157376_10129280 | 3300014969 | Bacteria | 2251 |
| 116 | Ga0213873_10089877 | 3300021358 | Bacteria | 871 |
| 117 | Ga0213876_10001172 | 3300021384 | Bacteria | 16571 |
| 118 | Ga0213876_10008517 | 3300021384 | Bacteria | 5552 |
| 119 | Ga0213876_10048939 | 3300021384 | Bacteria | 2232 |
| 120 | Ga0213875_10008424 | 3300021388 | Bacteria | 5285 |
| 121 | Ga0213871_10004813 | 3300021441 | Bacteria | 2734 |
| 122 | Ga0207685_10000729 | 3300025905 | Bacteria | 5977 |
| 123 | Ga0207643_10004885 | 3300025908 | Bacteria | 7174 |
| 124 | Ga0207643_10038476 | 3300025908 | Bacteria | 2686 |
| 125 | Ga0207707_10002640 | 3300025912 | Bacteria | 16015 |
| 126 | Ga0207707_10365143 | 3300025912 | Bacteria | 1243 |
| 127 | Ga0207660_10024717 | 3300025917 | Bacteria | 4070 |
| 128 | Ga0207660_10026226 | 3300025917 | Bacteria | 3967 |
| 129 | Ga0207660_10200331 | 3300025917 | Bacteria | 1559 |
| 130 | Ga0207657_10009385 | 3300025919 | Bacteria | 9841 |
| 131 | Ga0207649_10018731 | 3300025920 | Bacteria | 3944 |
| 132 | Ga0207652_10003730 | 3300025921 | Bacteria | 12504 |
| 133 | Ga0207652_10654484 | 3300025921 | Bacteria | 939 |
| 134 | Ga0207646_10178443 | 3300025922 | Bacteria | 1918 |
| 135 | Ga0207681_11118115 | 3300025923 | Bacteria | 662 |
| 136 | Ga0207694_10004858 | 3300025924 | Bacteria | 10435 |
| 137 | Ga0207650_10011361 | 3300025925 | Bacteria | 6129 |
| 138 | Ga0207650_10514614 | 3300025925 | Bacteria | 1001 |
| 139 | Ga0207687_10249564 | 3300025927 | Bacteria | 1410 |
| 140 | Ga0207700_10436064 | 3300025928 | Bacteria | 1153 |
| 141 | Ga0207664_10015603 | 3300025929 | Bacteria | 5520 |
| 142 | Ga0207644_10212962 | 3300025931 | Bacteria | 1529 |
| 143 | Ga0207690_10005427 | 3300025932 | Bacteria | 7509 |
| 144 | Ga0207706_10024138 | 3300025933 | Bacteria | 5453 |
| 145 | Ga0207686_10055905 | 3300025934 | Bacteria | 2478 |
| 146 | Ga0207709_10023713 | 3300025935 | Bacteria | 3495 |
| 147 | Ga0207689_10071322 | 3300025942 | Bacteria | 2853 |
| 148 | Ga0207679_10001260 | 3300025945 | Bacteria | 16057 |
| 149 | Ga0207679_10180280 | 3300025945 | Bacteria | 1747 |
| 150 | Ga0207679_10357906 | 3300025945 | Bacteria | 1274 |
| 151 | Ga0207667_10039022 | 3300025949 | Bacteria | 5063 |
| 152 | Ga0207667_10857741 | 3300025949 | Bacteria | 902 |
| 153 | Ga0207712_10066587 | 3300025961 | Bacteria | 2575 |
| 154 | Ga0207712_10561195 | 3300025961 | Bacteria | 983 |
| 155 | Ga0207640_10006671 | 3300025981 | Bacteria | 6343 |
| 156 | Ga0207703_10046028 | 3300026035 | Bacteria | 3512 |
| 157 | Ga0207639_10092417 | 3300026041 | Bacteria | 2425 |
| 158 | Ga0207639_10456016 | 3300026041 | Unclassified | 1161 |
| 159 | Ga0207702_10222811 | 3300026078 | Bacteria | 1758 |
| 160 | Ga0207702_10348427 | 3300026078 | Bacteria | 1416 |
| 161 | Ga0207702_10908588 | 3300026078 | Bacteria | 872 |
| 162 | Ga0207641_10274116 | 3300026088 | Bacteria | 1584 |
| 163 | Ga0207641_10667793 | 3300026088 | Bacteria | 1022 |
| 164 | Ga0207648_10589634 | 3300026089 | Unclassified | 1024 |
| 165 | Ga0207676_10047969 | 3300026095 | Bacteria | 3313 |
| 166 | Ga0207676_10076357 | 3300026095 | Bacteria | 2707 |
| 167 | Ga0207674_10000181 | 3300026116 | Bacteria | 77248 |
| 168 | Ga0207674_10023854 | 3300026116 | Bacteria | 6544 |
| 169 | Ga0207675_100060818 | 3300026118 | Bacteria | 3526 |
| 170 | Ga0207683_10208984 | 3300026121 | Bacteria | 1776 |
| 171 | Ga0207698_11221200 | 3300026142 | Bacteria | 766 |
| 172 | Ga0268266_10002062 | 3300028379 | Bacteria | 22269 |
| 173 | Ga0268264_10033678 | 3300028381 | Bacteria | 4211 |
| 174 | Ga0265319_1083241 | 3300028563 | Unclassified | 1014 |
| 175 | Ga0265334_10076172 | 3300028573 | Bacteria | 1242 |
| 176 | Ga0265318_10026562 | 3300028577 | Bacteria | 2279 |
| 177 | Ga0265323_10000106 | 3300028653 | Bacteria | 48787 |
| 178 | Ga0265323_10001932 | 3300028653 | Bacteria | 9777 |
| 179 | Ga0265323_10002890 | 3300028653 | Bacteria | 7710 |
| 180 | Ga0265323_10012403 | 3300028653 | Bacteria | 3415 |
| 181 | Ga0265323_10012687 | 3300028653 | Bacteria | 3371 |
| 182 | Ga0265323_10023691 | 3300028653 | Bacteria | 2339 |
| 183 | Ga0265338_10000184 | 3300028800 | Bacteria | 116834 |
| 184 | Ga0265338_10001238 | 3300028800 | Bacteria | 42063 |
| 185 | Ga0265338_10001285 | 3300028800 | Bacteria | 41182 |
| 186 | Ga0265338_10016368 | 3300028800 | Bacteria | 8075 |
| 187 | Ga0265338_10018462 | 3300028800 | Bacteria | 7464 |
| 188 | Ga0265338_10047381 | 3300028800 | Bacteria | 3926 |
| 189 | Ga0265338_10254561 | 3300028800 | Unclassified | 1294 |
| 190 | Ga0265330_10009003 | 3300031235 | Bacteria | 4765 |
| 191 | Ga0265330_10096679 | 3300031235 | Bacteria | 1266 |
| 192 | Ga0265332_10145123 | 3300031238 | Bacteria | 994 |
| 193 | Ga0265320_10009735 | 3300031240 | Bacteria | 5767 |
| 194 | Ga0265320_10013850 | 3300031240 | Bacteria | 4621 |
| 195 | Ga0265320_10068653 | 3300031240 | Bacteria | 1674 |
| 196 | Ga0265325_10001924 | 3300031241 | Bacteria | 14327 |
| 197 | Ga0265325_10017939 | 3300031241 | Bacteria | 3929 |
| 198 | Ga0265340_10000287 | 3300031247 | Bacteria | 26530 |
| 199 | Ga0265340_10035584 | 3300031247 | Bacteria | 2472 |
| 200 | Ga0265339_10010897 | 3300031249 | Bacteria | 5620 |
| 201 | Ga0265339_10157754 | 3300031249 | Bacteria | 1143 |
| 202 | Ga0265327_10001388 | 3300031251 | Bacteria | 30912 |
| 203 | Ga0265316_10003170 | 3300031344 | Bacteria | 16723 |
| 204 | Ga0265316_10013629 | 3300031344 | Bacteria | 7212 |
| 205 | Ga0265316_10129704 | 3300031344 | Bacteria | 1900 |
| 206 | Ga0265316_10221851 | 3300031344 | Bacteria | 1394 |
| 207 | Ga0265316_10304077 | 3300031344 | Bacteria | 1161 |
| 208 | Ga0265316_10655157 | 3300031344 | Unclassified | 742 |
| 209 | Ga0307509_10000087 | 3300031507 | Bacteria | 126631 |
| 210 | Ga0307509_10033159 | 3300031507 | Bacteria | 5685 |
| 211 | Ga0307509_10441363 | 3300031507 | Bacteria | 997 |
| 212 | Ga0265313_10003373 | 3300031595 | Bacteria | 13001 |
| 213 | Ga0265313_10019475 | 3300031595 | Bacteria | 3773 |
| 214 | Ga0265313_10071124 | 3300031595 | Bacteria | 1601 |
| 215 | Ga0307508_10286062 | 3300031616 | Bacteria | 1242 |
| 216 | Ga0265314_10037607 | 3300031711 | Bacteria | 3505 |
| 217 | Ga0265342_10000138 | 3300031712 | Bacteria | 81937 |
| 218 | Ga0265342_10020734 | 3300031712 | Bacteria | 4208 |
| 219 | Ga0265342_10040175 | 3300031712 | Bacteria | 2838 |
| 220 | Ga0307516_10029407 | 3300031730 | Bacteria | 5556 |
| 221 | Ga0307516_10081840 | 3300031730 | Bacteria | 3071 |
| 222 | Ga0373926_0001083 | 3300035083 | Bacteria | 8022 |
| 223 | Ga0373926_0028919 | 3300035083 | Bacteria | 1947 |
| 224 | Ga0373928_0080860 | 3300035084 | Bacteria | 819 |
| 225 | Ga0373949_0010249 | 3300035090 | Bacteria | 2053 |
| 226 | Ga0373951_0003727 | 3300035091 | Bacteria | 3678 |
| 227 | Ga0373954_0182198 | 3300035118 | Unclassified | 1030 |
| 228 | Ga0373943_0003158 | 3300035170 | Bacteria | 7484 |
| 229 | Ga0373961_0000072 | 3300035241 | Bacteria | 54778 |
| 230 | Ga0373961_0069718 | 3300035241 | Bacteria | 1085 |
| 231 | Ga0373931_0060523 | 3300035691 | Bacteria | 2039 |
| 232 | Ga0373931_0141056 | 3300035691 | Bacteria | 1396 |
| 233 | Ga0373935_0005701 | 3300035692 | Bacteria | 7351 |
| 234 | Ga0373927_0000981 | 3300035695 | Bacteria | 21691 |
| 235 | Ga0373927_0243745 | 3300035695 | Bacteria | 1181 |
| 236 | Ga0373933_0192616 | 3300035724 | Bacteria | 1303 |
| 237 | Ga0373947_0010515 | 3300035725 | Bacteria | 5308 |
| 238 | Ga0373937_0642129 | 3300036401 | Unclassified | 1007 |
| 239 | Ga0373925_0000200 | 3300037068 | Bacteria | 65353 |
| 240 | Ga0373925_0014250 | 3300037068 | Bacteria | 5751 |
| 241 | Ga0395899_0443223 | 3300037312 | Bacteria | 852 |
| 242 | Ga0436364_0529128 | 3300037853 | Bacteria | 8736 |
| 243 | Ga0436364_0873228 | 3300037853 | Bacteria | 2499 |
| 244 | Ga0436364_1145226 | 3300037853 | Bacteria | 2652 |
| 245 | Ga0436364_1336177 | 3300037853 | Bacteria | 1170 |
| 246 | Ga0436364_1498887 | 3300037853 | Bacteria | 1024 |
| 247 | Ga0436365_0181741 | 3300039437 | Bacteria | 58736 |
| 248 | Ga0436365_0594047 | 3300039437 | Bacteria | 17130 |
| 249 | Ga0436365_0750630 | 3300039437 | Bacteria | 1908 |
| 250 | Ga0436365_0913793 | 3300039437 | Bacteria | 11819 |
| 251 | Ga0436360_0744089 | 3300039438 | Bacteria | 21760 |
| 252 | Ga0436360_0963307 | 3300039438 | Bacteria | 6158 |
| 253 | Ga0436363_0294819 | 3300039450 | Bacteria | 1407 |
| 254 | Ga0436362_0124211 | 3300039453 | Unclassified | 657 |
| 255 | Ga0436362_0573390 | 3300039453 | Bacteria | 983 |
| 256 | Ga0439441_007171 | 3300042001 | Bacteria | 1787 |
| 257 | Ga0439441_019720 | 3300042001 | Unclassified | 1229 |
| 258 | Ga0439448_0003151 | 3300042005 | Bacteria | 4548 |
| 259 | Ga0439455_0014470 | 3300042012 | Bacteria | 1802 |
| 260 | Ga0450893_0033783 | 3300042532 | Unclassified | 919 |
| 261 | Ga0451577_0028656 | 3300042876 | Bacteria | 5034 |
| 262 | Ga0451577_1225268 | 3300042876 | Unclassified | 669 |
| 263 | Ga0453684_0008232 | 3300044712 | Bacteria | 18796 |
| 264 | Ga0453684_0009628 | 3300044712 | Bacteria | 16845 |
| 265 | Ga0453684_0014726 | 3300044712 | Bacteria | 12467 |
| 266 | Ga0451576_0000441 | 3300045051 | Bacteria | 94687 |
| 267 | Ga0451576_0116468 | 3300045051 | Bacteria | 2782 |
| 268 | Ga0451576_0129546 | 3300045051 | Bacteria | 2629 |
| 269 | Ga0451576_0168319 | 3300045051 | Bacteria | 2287 |
| 270 | Ga0451576_0884107 | 3300045051 | Bacteria | 938 |
| 271 | Ga0466958_0321038 | 3300045836 | Bacteria | 995 |
| 272 | Ga0495632_0112853 | 3300046519 | Bacteria | 1275 |
| 273 | Ga0495652_0273944 | 3300046529 | Bacteria | 1239 |
| 274 | Ga0495667_0077751 | 3300046559 | Bacteria | 2158 |
| 275 | Ga0495657_0162317 | 3300046675 | Bacteria | 1382 |
| 276 | Ga0495647_0121936 | 3300046681 | Bacteria | 1097 |
| 277 | Ga0495604_0092748 | 3300047317 | Bacteria | 2236 |
| 278 | Ga0495636_0114340 | 3300047318 | Bacteria | 1190 |
| 279 | Ga0495680_0038565 | 3300047322 | Bacteria | 3817 |
| 280 | Ga0495675_0087815 | 3300047444 | Bacteria | 1954 |
| 281 | Ga0496102_0226320 | 3300048905 | Unclassified | 1763 |
| 282 | Ga0496102_0444344 | 3300048905 | Unclassified | 1217 |
| 283 | Ga0496106_0164877 | 3300048909 | Bacteria | 1754 |
| 284 | Ga0496108_0130424 | 3300048911 | Bacteria | 2161 |
| 285 | Ga0496109_0162026 | 3300048912 | Bacteria | 2096 |
| 286 | Ga0496112_0166123 | 3300048915 | Bacteria | 2173 |
| 287 | Ga0496115_0029984 | 3300048918 | Unclassified | 4276 |
| 288 | Ga0496115_0302504 | 3300048918 | Unclassified | 1310 |
| 289 | Ga0501033_0546383 | 3300049570 | Unclassified | 798 |
| 290 | Ga0501040_0089814 | 3300049576 | Bacteria | 2135 |
| 291 | Ga0501041_0527906 | 3300049577 | Bacteria | 752 |
| 292 | Ga0501046_0294334 | 3300049580 | Bacteria | 1187 |
| 293 | Ga0501048_0071583 | 3300049582 | Bacteria | 2448 |
| 294 | Ga0501071_0009849 | 3300049587 | Bacteria | 6381 |
| 295 | Ga0501072_0038476 | 3300049588 | Bacteria | 3754 |
| 296 | Ga0501074_0130384 | 3300049590 | Bacteria | 1799 |
| 297 | Ga0501076_0018121 | 3300049592 | Bacteria | 5362 |
| 298 | Ga0501077_0362442 | 3300049593 | Unclassified | 925 |
| 299 | Ga0501079_0041248 | 3300049741 | Bacteria | 3562 |
| 300 | Ga0501079_0449492 | 3300049741 | Unclassified | 1012 |
| 301 | Ga0501081_0869257 | 3300049743 | Unclassified | 679 |
| 302 | nmdc:mga05p37_12344_c1 | 3300050507 | Bacteria | 10203 |
| 303 | nmdc:mga05p37_39595_c2 | 3300050507 | Bacteria | 4442 |
| 304 | nmdc:mga06r32_208_c1 | 3300050510 | Bacteria | 47351 |
| 305 | nmdc:mga06r32_239500_c1 | 3300050510 | Bacteria | 1802 |
| 306 | nmdc:mga0rr50_180520_c1 | 3300050513 | Bacteria | 1725 |
| 307 | nmdc:mga0rr50_895568_c1 | 3300050513 | Bacteria | 757 |
| 308 | nmdc:mga08x19_2756_c1 | 3300050514 | Bacteria | 10615 |
| 309 | nmdc:mga0a205_378766_c1 | 3300050515 | Bacteria | 1280 |
| 310 | Ga0495619_0241284 | 3300053085 | Bacteria | 1252 |
| 311 | Ga0500555_000211 | 3300053103 | Bacteria | 27096 |
| 312 | Ga0500616_0003193 | 3300053153 | Bacteria | 12759 |
| 313 | Ga0500645_000284 | 3300053730 | Bacteria | 36344 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028800 | Ga0265338_10016368 | Ga0265338_100163685 | 178 |
| 2 | 3300031712 | Ga0265342_10020734 | Ga0265342_100207342 | 181 |
| 3 | 3300035083 | Ga0373926_0028919 | Ga0373926_0028919_750_1310 | 183 |
| 4 | 3300035084 | Ga0373928_0080860 | Ga0373928_0080860_66_626 | 183 |
| 5 | 3300035241 | Ga0373961_0069718 | Ga0373961_0069718_365_925 | 183 |
| 6 | 3300035691 | Ga0373931_0141056 | Ga0373931_0141056_135_695 | 183 |
| 7 | 3300037068 | Ga0373925_0000200 | Ga0373925_0000200_41844_42404 | 183 |
| 8 | 3300005336 | Ga0070680_100036722 | Ga0070680_1000367223 | 186 |
| 9 | 3300005530 | Ga0070679_100997944 | Ga0070679_1009979442 | 186 |
| 10 | 3300025917 | Ga0207660_10024717 | Ga0207660_100247173 | 186 |
| 11 | 3300025921 | Ga0207652_10654484 | Ga0207652_106544842 | 186 |
| 12 | 3300025935 | Ga0207709_10023713 | Ga0207709_100237134 | 186 |
| 13 | 3300025961 | Ga0207712_10066587 | Ga0207712_100665873 | 186 |
| 14 | 3300026116 | Ga0207674_10023854 | Ga0207674_100238548 | 186 |
| 15 | 3300028381 | Ga0268264_10033678 | Ga0268264_100336785 | 186 |
| 16 | 3300042001 | Ga0439441_007171 | Ga0439441_007171_1160_1759 | 186 |
| 17 | 3300039438 | Ga0436360_0963307 | Ga0436360_0963307_5506_6117 | 188 |
| 18 | 3300005471 | Ga0070698_100757560 | Ga0070698_1007575602 | 197 |
| 19 | 3300021384 | Ga0213876_10008517 | Ga0213876_100085176 | 197 |
| 20 | 3300039437 | Ga0436365_0913793 | Ga0436365_0913793_9885_10478 | 197 |
| 21 | 3300039453 | Ga0436362_0124211 | Ga0436362_0124211_18_611 | 197 |
| 22 | 3300049577 | Ga0501041_0527906 | Ga0501041_0527906_43_639 | 197 |
| 23 | 3300049580 | Ga0501046_0294334 | Ga0501046_0294334_538_1134 | 197 |
| 24 | 3300005327 | Ga0070658_10149489 | Ga0070658_101494892 | 198 |
| 25 | 3300005336 | Ga0070680_100162631 | Ga0070680_1001626312 | 198 |
| 26 | 3300005339 | Ga0070660_100530231 | Ga0070660_1005302312 | 198 |
| 27 | 3300005341 | Ga0070691_10029020 | Ga0070691_100290201 | 198 |
| 28 | 3300005344 | Ga0070661_100035954 | Ga0070661_1000359543 | 198 |
| 29 | 3300005353 | Ga0070669_100419561 | Ga0070669_1004195612 | 198 |
| 30 | 3300005434 | Ga0070709_10166709 | Ga0070709_101667092 | 198 |
| 31 | 3300005436 | Ga0070713_100002612 | Ga0070713_10000261210 | 198 |
| 32 | 3300005436 | Ga0070713_100091199 | Ga0070713_1000911992 | 198 |
| 33 | 3300005436 | Ga0070713_100411883 | Ga0070713_1004118832 | 198 |
| 34 | 3300005437 | Ga0070710_10001045 | Ga0070710_100010454 | 198 |
| 35 | 3300005456 | Ga0070678_100272228 | Ga0070678_1002722282 | 198 |
| 36 | 3300005458 | Ga0070681_10280397 | Ga0070681_102803972 | 198 |
| 37 | 3300005466 | Ga0070685_10188354 | Ga0070685_101883542 | 198 |
| 38 | 3300005468 | Ga0070707_100211303 | Ga0070707_1002113033 | 198 |
| 39 | 3300005536 | Ga0070697_100318065 | Ga0070697_1003180653 | 198 |
| 40 | 3300005536 | Ga0070697_100323777 | Ga0070697_1003237772 | 198 |
| 41 | 3300005539 | Ga0068853_100622489 | Ga0068853_1006224892 | 198 |
| 42 | 3300005546 | Ga0070696_100235763 | Ga0070696_1002357632 | 198 |
| 43 | 3300005563 | Ga0068855_100003998 | Ga0068855_10000399813 | 198 |
| 44 | 3300005563 | Ga0068855_100604837 | Ga0068855_1006048372 | 198 |
| 45 | 3300005564 | Ga0070664_100214058 | Ga0070664_1002140581 | 198 |
| 46 | 3300005614 | Ga0068856_100005808 | Ga0068856_10000580810 | 198 |
| 47 | 3300005614 | Ga0068856_100520967 | Ga0068856_1005209672 | 198 |
| 48 | 3300005618 | Ga0068864_100309712 | Ga0068864_1003097122 | 198 |
| 49 | 3300005841 | Ga0068863_100092384 | Ga0068863_1000923842 | 198 |
| 50 | 3300005842 | Ga0068858_100050910 | Ga0068858_1000509102 | 198 |
| 51 | 3300005842 | Ga0068858_100909989 | Ga0068858_1009099892 | 198 |
| 52 | 3300005937 | Ga0081455_10259867 | Ga0081455_102598672 | 198 |
| 53 | 3300006028 | Ga0070717_10027175 | Ga0070717_100271754 | 198 |
| 54 | 3300006163 | Ga0070715_10011561 | Ga0070715_100115614 | 198 |
| 55 | 3300006163 | Ga0070715_10143535 | Ga0070715_101435351 | 198 |
| 56 | 3300006358 | Ga0068871_100038546 | Ga0068871_1000385464 | 198 |
| 57 | 3300006852 | Ga0075433_10384277 | Ga0075433_103842772 | 198 |
| 58 | 3300006881 | Ga0068865_100116173 | Ga0068865_1001161733 | 198 |
| 59 | 3300009098 | Ga0105245_10157519 | Ga0105245_101575191 | 198 |
| 60 | 3300009176 | Ga0105242_10049394 | Ga0105242_100493942 | 198 |
| 61 | 3300009551 | Ga0105238_10007987 | Ga0105238_100079875 | 198 |
| 62 | 3300013104 | Ga0157370_10081818 | Ga0157370_100818183 | 198 |
| 63 | 3300013104 | Ga0157370_10083804 | Ga0157370_100838044 | 198 |
| 64 | 3300013104 | Ga0157370_10139500 | Ga0157370_101395003 | 198 |
| 65 | 3300013104 | Ga0157370_10159175 | Ga0157370_101591752 | 198 |
| 66 | 3300013105 | Ga0157369_10000445 | Ga0157369_1000044512 | 198 |
| 67 | 3300013296 | Ga0157374_10009326 | Ga0157374_100093264 | 198 |
| 68 | 3300013306 | Ga0163162_11050451 | Ga0163162_110504512 | 198 |
| 69 | 3300013307 | Ga0157372_10093944 | Ga0157372_100939442 | 198 |
| 70 | 3300013308 | Ga0157375_10562643 | Ga0157375_105626432 | 198 |
| 71 | 3300021384 | Ga0213876_10001172 | Ga0213876_1000117212 | 198 |
| 72 | 3300021384 | Ga0213876_10048939 | Ga0213876_100489392 | 198 |
| 73 | 3300025905 | Ga0207685_10000729 | Ga0207685_100007296 | 198 |
| 74 | 3300025917 | Ga0207660_10200331 | Ga0207660_102003312 | 198 |
| 75 | 3300025922 | Ga0207646_10178443 | Ga0207646_101784432 | 198 |
| 76 | 3300025923 | Ga0207681_11118115 | Ga0207681_111181151 | 198 |
| 77 | 3300025924 | Ga0207694_10004858 | Ga0207694_100048589 | 198 |
| 78 | 3300025925 | Ga0207650_10514614 | Ga0207650_105146142 | 198 |
| 79 | 3300025928 | Ga0207700_10436064 | Ga0207700_104360641 | 198 |
| 80 | 3300025929 | Ga0207664_10015603 | Ga0207664_100156034 | 198 |
| 81 | 3300025934 | Ga0207686_10055905 | Ga0207686_100559052 | 198 |
| 82 | 3300025945 | Ga0207679_10180280 | Ga0207679_101802802 | 198 |
| 83 | 3300026035 | Ga0207703_10046028 | Ga0207703_100460283 | 198 |
| 84 | 3300026041 | Ga0207639_10456016 | Ga0207639_104560162 | 198 |
| 85 | 3300026078 | Ga0207702_10348427 | Ga0207702_103484272 | 198 |
| 86 | 3300026078 | Ga0207702_10908588 | Ga0207702_109085882 | 198 |
| 87 | 3300026088 | Ga0207641_10274116 | Ga0207641_102741162 | 198 |
| 88 | 3300026089 | Ga0207648_10589634 | Ga0207648_105896342 | 198 |
| 89 | 3300026121 | Ga0207683_10208984 | Ga0207683_102089842 | 198 |
| 90 | 3300026142 | Ga0207698_11221200 | Ga0207698_112212001 | 198 |
| 91 | 3300028563 | Ga0265319_1083241 | Ga0265319_10832412 | 198 |
| 92 | 3300028573 | Ga0265334_10076172 | Ga0265334_100761722 | 198 |
| 93 | 3300028577 | Ga0265318_10026562 | Ga0265318_100265623 | 198 |
| 94 | 3300028653 | Ga0265323_10000106 | Ga0265323_1000010631 | 198 |
| 95 | 3300028653 | Ga0265323_10001932 | Ga0265323_100019324 | 198 |
| 96 | 3300028653 | Ga0265323_10002890 | Ga0265323_100028906 | 198 |
| 97 | 3300028653 | Ga0265323_10012403 | Ga0265323_100124032 | 198 |
| 98 | 3300028653 | Ga0265323_10012687 | Ga0265323_100126874 | 198 |
| 99 | 3300028653 | Ga0265323_10023691 | Ga0265323_100236912 | 198 |
| 100 | 3300028800 | Ga0265338_10000184 | Ga0265338_1000018437 | 198 |
| 101 | 3300028800 | Ga0265338_10001238 | Ga0265338_1000123816 | 198 |
| 102 | 3300028800 | Ga0265338_10001285 | Ga0265338_1000128521 | 198 |
| 103 | 3300028800 | Ga0265338_10018462 | Ga0265338_100184624 | 198 |
| 104 | 3300028800 | Ga0265338_10254561 | Ga0265338_102545612 | 198 |
| 105 | 3300031235 | Ga0265330_10009003 | Ga0265330_100090035 | 198 |
| 106 | 3300031235 | Ga0265330_10096679 | Ga0265330_100966792 | 198 |
| 107 | 3300031238 | Ga0265332_10145123 | Ga0265332_101451232 | 198 |
| 108 | 3300031240 | Ga0265320_10009735 | Ga0265320_100097356 | 198 |
| 109 | 3300031240 | Ga0265320_10013850 | Ga0265320_100138504 | 198 |
| 110 | 3300031240 | Ga0265320_10068653 | Ga0265320_100686533 | 198 |
| 111 | 3300031241 | Ga0265325_10001924 | Ga0265325_100019242 | 198 |
| 112 | 3300031241 | Ga0265325_10017939 | Ga0265325_100179392 | 198 |
| 113 | 3300031247 | Ga0265340_10000287 | Ga0265340_1000028719 | 198 |
| 114 | 3300031247 | Ga0265340_10035584 | Ga0265340_100355843 | 198 |
| 115 | 3300031249 | Ga0265339_10010897 | Ga0265339_100108974 | 198 |
| 116 | 3300031249 | Ga0265339_10157754 | Ga0265339_101577542 | 198 |
| 117 | 3300031251 | Ga0265327_10001388 | Ga0265327_1000138818 | 198 |
| 118 | 3300031344 | Ga0265316_10003170 | Ga0265316_1000317015 | 198 |
| 119 | 3300031344 | Ga0265316_10013629 | Ga0265316_100136292 | 198 |
| 120 | 3300031344 | Ga0265316_10129704 | Ga0265316_101297042 | 198 |
| 121 | 3300031344 | Ga0265316_10221851 | Ga0265316_102218511 | 198 |
| 122 | 3300031344 | Ga0265316_10304077 | Ga0265316_103040771 | 198 |
| 123 | 3300031344 | Ga0265316_10655157 | Ga0265316_106551571 | 198 |
| 124 | 3300031595 | Ga0265313_10003373 | Ga0265313_1000337311 | 198 |
| 125 | 3300031595 | Ga0265313_10019475 | Ga0265313_100194755 | 198 |
| 126 | 3300031595 | Ga0265313_10071124 | Ga0265313_100711241 | 198 |
| 127 | 3300031711 | Ga0265314_10037607 | Ga0265314_100376074 | 198 |
| 128 | 3300031712 | Ga0265342_10000138 | Ga0265342_1000013820 | 198 |
| 129 | 3300031712 | Ga0265342_10040175 | Ga0265342_100401754 | 198 |
| 130 | 3300035118 | Ga0373954_0182198 | Ga0373954_0182198_308_904 | 198 |
| 131 | 3300035695 | Ga0373927_0243745 | Ga0373927_0243745_108_704 | 198 |
| 132 | 3300035724 | Ga0373933_0192616 | Ga0373933_0192616_253_849 | 198 |
| 133 | 3300036401 | Ga0373937_0642129 | Ga0373937_0642129_182_778 | 198 |
| 134 | 3300037312 | Ga0395899_0443223 | Ga0395899_0443223_192_788 | 198 |
| 135 | 3300037853 | Ga0436364_1336177 | Ga0436364_1336177_530_1132 | 198 |
| 136 | 3300037853 | Ga0436364_1498887 | Ga0436364_1498887_253_852 | 198 |
| 137 | 3300039437 | Ga0436365_0181741 | Ga0436365_0181741_57252_57848 | 198 |
| 138 | 3300039437 | Ga0436365_0594047 | Ga0436365_0594047_14143_14742 | 198 |
| 139 | 3300039450 | Ga0436363_0294819 | Ga0436363_0294819_457_1053 | 198 |
| 140 | 3300042876 | Ga0451577_1225268 | Ga0451577_1225268_35_634 | 198 |
| 141 | 3300044712 | Ga0453684_0014726 | Ga0453684_0014726_2802_3398 | 198 |
| 142 | 3300045051 | Ga0451576_0000441 | Ga0451576_0000441_40140_40736 | 198 |
| 143 | 3300045051 | Ga0451576_0168319 | Ga0451576_0168319_1396_2001 | 198 |
| 144 | 3300045836 | Ga0466958_0321038 | Ga0466958_0321038_234_830 | 198 |
| 145 | 3300046529 | Ga0495652_0273944 | Ga0495652_0273944_292_909 | 198 |
| 146 | 3300046559 | Ga0495667_0077751 | Ga0495667_0077751_1211_1807 | 198 |
| 147 | 3300046675 | Ga0495657_0162317 | Ga0495657_0162317_105_701 | 198 |
| 148 | 3300047317 | Ga0495604_0092748 | Ga0495604_0092748_1245_1862 | 198 |
| 149 | 3300047322 | Ga0495680_0038565 | Ga0495680_0038565_1012_1629 | 198 |
| 150 | 3300047444 | Ga0495675_0087815 | Ga0495675_0087815_872_1489 | 198 |
| 151 | 3300048905 | Ga0496102_0226320 | Ga0496102_0226320_580_1176 | 198 |
| 152 | 3300048905 | Ga0496102_0444344 | Ga0496102_0444344_313_912 | 198 |
| 153 | 3300048918 | Ga0496115_0029984 | Ga0496115_0029984_617_1213 | 198 |
| 154 | 3300048918 | Ga0496115_0302504 | Ga0496115_0302504_143_745 | 198 |
| 155 | 3300049570 | Ga0501033_0546383 | Ga0501033_0546383_22_618 | 198 |
| 156 | 3300049582 | Ga0501048_0071583 | Ga0501048_0071583_1570_2166 | 198 |
| 157 | 3300049587 | Ga0501071_0009849 | Ga0501071_0009849_1021_1617 | 198 |
| 158 | 3300049588 | Ga0501072_0038476 | Ga0501072_0038476_930_1526 | 198 |
| 159 | 3300049592 | Ga0501076_0018121 | Ga0501076_0018121_2849_3445 | 198 |
| 160 | 3300049593 | Ga0501077_0362442 | Ga0501077_0362442_120_716 | 198 |
| 161 | 3300049741 | Ga0501079_0449492 | Ga0501079_0449492_234_830 | 198 |
| 162 | 3300049743 | Ga0501081_0869257 | Ga0501081_0869257_55_651 | 198 |
| 163 | 3300050513 | nmdc:mga0rr50_180520_c1 | nmdc:mga0rr50_180520_c1_69_665 | 198 |
| 164 | 3300050514 | nmdc:mga08x19_2756_c1 | nmdc:mga08x19_2756_c1_577_1185 | 198 |
| 165 | 3300050515 | nmdc:mga0a205_378766_c1 | nmdc:mga0a205_378766_c1_546_1145 | 198 |
| 166 | 3300053085 | Ga0495619_0241284 | Ga0495619_0241284_320_937 | 198 |
| 167 | 3300053103 | Ga0500555_000211 | Ga0500555_000211_4372_4974 | 198 |
| 168 | 3300053153 | Ga0500616_0003193 | Ga0500616_0003193_3097_3702 | 198 |
| 169 | 3300053730 | Ga0500645_000284 | Ga0500645_000284_4372_4968 | 198 |
| 170 | 3300005293 | Ga0065715_10419228 | Ga0065715_104192281 | 199 |
| 171 | 3300005337 | Ga0070682_100013455 | Ga0070682_1000134553 | 199 |
| 172 | 3300005338 | Ga0068868_100199612 | Ga0068868_1001996121 | 199 |
| 173 | 3300005339 | Ga0070660_100007332 | Ga0070660_1000073326 | 199 |
| 174 | 3300005340 | Ga0070689_100351759 | Ga0070689_1003517592 | 199 |
| 175 | 3300005341 | Ga0070691_10010897 | Ga0070691_100108973 | 199 |
| 176 | 3300005344 | Ga0070661_100230370 | Ga0070661_1002303702 | 199 |
| 177 | 3300005355 | Ga0070671_100192642 | Ga0070671_1001926422 | 199 |
| 178 | 3300005364 | Ga0070673_100037566 | Ga0070673_1000375662 | 199 |
| 179 | 3300005367 | Ga0070667_100400547 | Ga0070667_1004005472 | 199 |
| 180 | 3300005438 | Ga0070701_10198810 | Ga0070701_101988101 | 199 |
| 181 | 3300005440 | Ga0070705_100117942 | Ga0070705_1001179422 | 199 |
| 182 | 3300005441 | Ga0070700_100131056 | Ga0070700_1001310562 | 199 |
| 183 | 3300005444 | Ga0070694_100000478 | Ga0070694_10000047819 | 199 |
| 184 | 3300005444 | Ga0070694_100331848 | Ga0070694_1003318482 | 199 |
| 185 | 3300005457 | Ga0070662_100033512 | Ga0070662_1000335121 | 199 |
| 186 | 3300005458 | Ga0070681_10426511 | Ga0070681_104265112 | 199 |
| 187 | 3300005518 | Ga0070699_100012854 | Ga0070699_1000128547 | 199 |
| 188 | 3300005535 | Ga0070684_100460287 | Ga0070684_1004602872 | 199 |
| 189 | 3300005543 | Ga0070672_100182511 | Ga0070672_1001825113 | 199 |
| 190 | 3300005543 | Ga0070672_100431699 | Ga0070672_1004316993 | 199 |
| 191 | 3300005545 | Ga0070695_100038228 | Ga0070695_1000382283 | 199 |
| 192 | 3300005545 | Ga0070695_100058668 | Ga0070695_1000586682 | 199 |
| 193 | 3300005546 | Ga0070696_100002512 | Ga0070696_1000025122 | 199 |
| 194 | 3300005546 | Ga0070696_100435914 | Ga0070696_1004359142 | 199 |
| 195 | 3300005547 | Ga0070693_100002083 | Ga0070693_1000020838 | 199 |
| 196 | 3300005547 | Ga0070693_100026914 | Ga0070693_1000269143 | 199 |
| 197 | 3300005548 | Ga0070665_100002244 | Ga0070665_10000224423 | 199 |
| 198 | 3300005549 | Ga0070704_100156348 | Ga0070704_1001563482 | 199 |
| 199 | 3300005563 | Ga0068855_100001156 | Ga0068855_10000115610 | 199 |
| 200 | 3300005564 | Ga0070664_100004765 | Ga0070664_1000047653 | 199 |
| 201 | 3300005564 | Ga0070664_100729646 | Ga0070664_1007296461 | 199 |
| 202 | 3300005578 | Ga0068854_100011152 | Ga0068854_1000111523 | 199 |
| 203 | 3300005578 | Ga0068854_100144757 | Ga0068854_1001447573 | 199 |
| 204 | 3300005614 | Ga0068856_100002286 | Ga0068856_10000228610 | 199 |
| 205 | 3300005617 | Ga0068859_100325792 | Ga0068859_1003257923 | 199 |
| 206 | 3300005618 | Ga0068864_100126188 | Ga0068864_1001261883 | 199 |
| 207 | 3300005618 | Ga0068864_100236933 | Ga0068864_1002369333 | 199 |
| 208 | 3300005840 | Ga0068870_10007091 | Ga0068870_100070912 | 199 |
| 209 | 3300005841 | Ga0068863_100593173 | Ga0068863_1005931732 | 199 |
| 210 | 3300005843 | Ga0068860_100296253 | Ga0068860_1002962533 | 199 |
| 211 | 3300005844 | Ga0068862_100007069 | Ga0068862_1000070698 | 199 |
| 212 | 3300005981 | Ga0081538_10013909 | Ga0081538_100139095 | 199 |
| 213 | 3300006844 | Ga0075428_100103393 | Ga0075428_1001033933 | 199 |
| 214 | 3300006846 | Ga0075430_100185548 | Ga0075430_1001855482 | 199 |
| 215 | 3300006847 | Ga0075431_100000162 | Ga0075431_10000016220 | 199 |
| 216 | 3300006847 | Ga0075431_100053723 | Ga0075431_1000537232 | 199 |
| 217 | 3300006852 | Ga0075433_10292132 | Ga0075433_102921322 | 199 |
| 218 | 3300006871 | Ga0075434_101128068 | Ga0075434_1011280682 | 199 |
| 219 | 3300006914 | Ga0075436_100227167 | Ga0075436_1002271672 | 199 |
| 220 | 3300006931 | Ga0097620_100325764 | Ga0097620_1003257643 | 199 |
| 221 | 3300007076 | Ga0075435_100039584 | Ga0075435_1000395844 | 199 |
| 222 | 3300009098 | Ga0105245_10265378 | Ga0105245_102653782 | 199 |
| 223 | 3300009147 | Ga0114129_10006777 | Ga0114129_100067779 | 199 |
| 224 | 3300009147 | Ga0114129_10027899 | Ga0114129_100278993 | 199 |
| 225 | 3300009148 | Ga0105243_10116816 | Ga0105243_101168163 | 199 |
| 226 | 3300009176 | Ga0105242_10334694 | Ga0105242_103346943 | 199 |
| 227 | 3300009553 | Ga0105249_10050289 | Ga0105249_100502892 | 199 |
| 228 | 3300009553 | Ga0105249_10111740 | Ga0105249_101117402 | 199 |
| 229 | 3300011119 | Ga0105246_10127590 | Ga0105246_101275902 | 199 |
| 230 | 3300013105 | Ga0157369_10581451 | Ga0157369_105814512 | 199 |
| 231 | 3300013308 | Ga0157375_10337244 | Ga0157375_103372442 | 199 |
| 232 | 3300014325 | Ga0163163_10151782 | Ga0163163_101517821 | 199 |
| 233 | 3300014326 | Ga0157380_10145669 | Ga0157380_101456693 | 199 |
| 234 | 3300014969 | Ga0157376_10129280 | Ga0157376_101292802 | 199 |
| 235 | 3300021358 | Ga0213873_10089877 | Ga0213873_100898772 | 199 |
| 236 | 3300021388 | Ga0213875_10008424 | Ga0213875_100084244 | 199 |
| 237 | 3300021441 | Ga0213871_10004813 | Ga0213871_100048133 | 199 |
| 238 | 3300025908 | Ga0207643_10004885 | Ga0207643_100048853 | 199 |
| 239 | 3300025908 | Ga0207643_10038476 | Ga0207643_100384762 | 199 |
| 240 | 3300025912 | Ga0207707_10002640 | Ga0207707_1000264017 | 199 |
| 241 | 3300025912 | Ga0207707_10365143 | Ga0207707_103651432 | 199 |
| 242 | 3300025917 | Ga0207660_10026226 | Ga0207660_100262265 | 199 |
| 243 | 3300025919 | Ga0207657_10009385 | Ga0207657_100093856 | 199 |
| 244 | 3300025920 | Ga0207649_10018731 | Ga0207649_100187313 | 199 |
| 245 | 3300025921 | Ga0207652_10003730 | Ga0207652_1000373010 | 199 |
| 246 | 3300025925 | Ga0207650_10011361 | Ga0207650_100113616 | 199 |
| 247 | 3300025927 | Ga0207687_10249564 | Ga0207687_102495643 | 199 |
| 248 | 3300025931 | Ga0207644_10212962 | Ga0207644_102129622 | 199 |
| 249 | 3300025932 | Ga0207690_10005427 | Ga0207690_100054278 | 199 |
| 250 | 3300025933 | Ga0207706_10024138 | Ga0207706_100241384 | 199 |
| 251 | 3300025942 | Ga0207689_10071322 | Ga0207689_100713223 | 199 |
| 252 | 3300025945 | Ga0207679_10001260 | Ga0207679_1000126010 | 199 |
| 253 | 3300025945 | Ga0207679_10357906 | Ga0207679_103579062 | 199 |
| 254 | 3300025949 | Ga0207667_10039022 | Ga0207667_100390225 | 199 |
| 255 | 3300025949 | Ga0207667_10857741 | Ga0207667_108577412 | 199 |
| 256 | 3300025961 | Ga0207712_10561195 | Ga0207712_105611952 | 199 |
| 257 | 3300025981 | Ga0207640_10006671 | Ga0207640_100066713 | 199 |
| 258 | 3300026041 | Ga0207639_10092417 | Ga0207639_100924173 | 199 |
| 259 | 3300026078 | Ga0207702_10222811 | Ga0207702_102228113 | 199 |
| 260 | 3300026088 | Ga0207641_10667793 | Ga0207641_106677932 | 199 |
| 261 | 3300026095 | Ga0207676_10047969 | Ga0207676_100479694 | 199 |
| 262 | 3300026095 | Ga0207676_10076357 | Ga0207676_100763573 | 199 |
| 263 | 3300026116 | Ga0207674_10000181 | Ga0207674_1000018120 | 199 |
| 264 | 3300026118 | Ga0207675_100060818 | Ga0207675_1000608186 | 199 |
| 265 | 3300028379 | Ga0268266_10002062 | Ga0268266_1000206216 | 199 |
| 266 | 3300028800 | Ga0265338_10047381 | Ga0265338_100473813 | 199 |
| 267 | 3300031507 | Ga0307509_10000087 | Ga0307509_1000008750 | 199 |
| 268 | 3300031507 | Ga0307509_10033159 | Ga0307509_100331593 | 199 |
| 269 | 3300031507 | Ga0307509_10441363 | Ga0307509_104413631 | 199 |
| 270 | 3300031616 | Ga0307508_10286062 | Ga0307508_102860622 | 199 |
| 271 | 3300031730 | Ga0307516_10029407 | Ga0307516_100294075 | 199 |
| 272 | 3300031730 | Ga0307516_10081840 | Ga0307516_100818403 | 199 |
| 273 | 3300035083 | Ga0373926_0001083 | Ga0373926_0001083_2544_3143 | 199 |
| 274 | 3300035090 | Ga0373949_0010249 | Ga0373949_0010249_1202_1801 | 199 |
| 275 | 3300035091 | Ga0373951_0003727 | Ga0373951_0003727_1495_2094 | 199 |
| 276 | 3300035170 | Ga0373943_0003158 | Ga0373943_0003158_1899_2498 | 199 |
| 277 | 3300035241 | Ga0373961_0000072 | Ga0373961_0000072_9672_10271 | 199 |
| 278 | 3300035691 | Ga0373931_0060523 | Ga0373931_0060523_797_1396 | 199 |
| 279 | 3300035692 | Ga0373935_0005701 | Ga0373935_0005701_4204_4803 | 199 |
| 280 | 3300035695 | Ga0373927_0000981 | Ga0373927_0000981_16889_17488 | 199 |
| 281 | 3300035725 | Ga0373947_0010515 | Ga0373947_0010515_1705_2304 | 199 |
| 282 | 3300037068 | Ga0373925_0014250 | Ga0373925_0014250_2298_2897 | 199 |
| 283 | 3300037853 | Ga0436364_0529128 | Ga0436364_0529128_7760_8380 | 199 |
| 284 | 3300037853 | Ga0436364_0873228 | Ga0436364_0873228_216_836 | 199 |
| 285 | 3300037853 | Ga0436364_1145226 | Ga0436364_1145226_1192_1791 | 199 |
| 286 | 3300039437 | Ga0436365_0750630 | Ga0436365_0750630_668_1324 | 199 |
| 287 | 3300039438 | Ga0436360_0744089 | Ga0436360_0744089_366_977 | 199 |
| 288 | 3300039453 | Ga0436362_0573390 | Ga0436362_0573390_162_773 | 199 |
| 289 | 3300042001 | Ga0439441_019720 | Ga0439441_019720_34_633 | 199 |
| 290 | 3300042005 | Ga0439448_0003151 | Ga0439448_0003151_629_1228 | 199 |
| 291 | 3300042012 | Ga0439455_0014470 | Ga0439455_0014470_1044_1643 | 199 |
| 292 | 3300042532 | Ga0450893_0033783 | Ga0450893_0033783_245_844 | 199 |
| 293 | 3300042876 | Ga0451577_0028656 | Ga0451577_0028656_1006_1605 | 199 |
| 294 | 3300044712 | Ga0453684_0008232 | Ga0453684_0008232_5222_5830 | 199 |
| 295 | 3300044712 | Ga0453684_0009628 | Ga0453684_0009628_9690_10298 | 199 |
| 296 | 3300045051 | Ga0451576_0116468 | Ga0451576_0116468_634_1233 | 199 |
| 297 | 3300045051 | Ga0451576_0129546 | Ga0451576_0129546_460_1059 | 199 |
| 298 | 3300045051 | Ga0451576_0884107 | Ga0451576_0884107_231_830 | 199 |
| 299 | 3300046519 | Ga0495632_0112853 | Ga0495632_0112853_650_1249 | 199 |
| 300 | 3300046681 | Ga0495647_0121936 | Ga0495647_0121936_285_884 | 199 |
| 301 | 3300047318 | Ga0495636_0114340 | Ga0495636_0114340_401_1000 | 199 |
| 302 | 3300048909 | Ga0496106_0164877 | Ga0496106_0164877_442_1041 | 199 |
| 303 | 3300048911 | Ga0496108_0130424 | Ga0496108_0130424_982_1590 | 199 |
| 304 | 3300048912 | Ga0496109_0162026 | Ga0496109_0162026_489_1088 | 199 |
| 305 | 3300048915 | Ga0496112_0166123 | Ga0496112_0166123_26_658 | 199 |
| 306 | 3300049576 | Ga0501040_0089814 | Ga0501040_0089814_276_977 | 199 |
| 307 | 3300049590 | Ga0501074_0130384 | Ga0501074_0130384_208_909 | 199 |
| 308 | 3300049741 | Ga0501079_0041248 | Ga0501079_0041248_91_792 | 199 |
| 309 | 3300050507 | nmdc:mga05p37_12344_c1 | nmdc:mga05p37_12344_c1_476_1075 | 199 |
| 310 | 3300050507 | nmdc:mga05p37_39595_c2 | nmdc:mga05p37_39595_c2_2036_2635 | 199 |
| 311 | 3300050510 | nmdc:mga06r32_208_c1 | nmdc:mga06r32_208_c1_15942_16541 | 199 |
| 312 | 3300050510 | nmdc:mga06r32_239500_c1 | nmdc:mga06r32_239500_c1_1180_1779 | 199 |
| 313 | 3300050513 | nmdc:mga0rr50_895568_c1 | nmdc:mga0rr50_895568_c1_63_662 | 199 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3bjz-assembly1.cif.gz_C | crystal structure of pseudomonas aeruginosa phosphoheptose isomerase | 0.8703 | 8 | 182 |
| 5i01-assembly1.cif.gz_C | structure of phosphoheptose isomerase gmha from neisseria gonorrhoeae | 0.8452 | 4 | 182 |
| 1x94-assembly1.cif.gz_A | crystal structure of a hypothetical protein | 0.8426 | 2 | 182 |
| 2i2w-assembly3.cif.gz_B | crystal structure of escherichia coli phosphoheptose isomerase | 0.8369 | 2 | 182 |
| 2i22-assembly1.cif.gz_A | crystal structure of escherichia coli phosphoheptose isomerase in complex with reaction substrate sedoheptulose 7-phosphate | 0.8367 | 2 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5i01C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.8452 | 4 | 182 | 3.40.50.10490 |
| 2i2wB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.8369 | 2 | 182 | 3.40.50.10490 |
| 2x3yA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.8263 | 3 | 182 | 3.40.50.10490 |
| 3trjC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.8156 | 3 | 182 | 3.40.50.10490 |
| af_P9WGG1_3_194_3.40.50.10490 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.8079 | 1 | 182 | 3.40.50.10490 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A212KGQ9-F1-model_v4 | Sugar isomerase family protein | 0.9728 | 87 | 196 |
GO:0016853
GO:0097367 GO:1901135 |
| AF-A0A7V8T0J9-F1-model_v4 | Sugar isomerase | 0.97 | 88 | 194 |
GO:0016853
GO:0097367 GO:1901135 |
| AF-A0A7V8T0J9-F1-model_v4 | Sugar isomerase | 0.9612 | 88 | 194 |
GO:0016853
GO:0097367 GO:1901135 |
| AF-A0A2V5XBY7-F1-model_v4 | Sugar isomerase | 0.9579 | 98 | 194 |
GO:0016853
GO:0097367 GO:1901135 |
| AF-A0A1G1W783-F1-model_v4 | SIS domain-containing protein | 0.9531 | 107 | 191 |
GO:0097367
GO:1901135 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar